Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|4493
Gene name
LocationContig_3:307367..312531
Strand+
Gene length (bp)5164
Transcript length (bp)4989
Coding sequence length (bp)4989
Protein length (aa) 1663

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00616 RasGAP GTPase-activator protein for Ras-like GTPase 2.1E-51 1035 1241
PF03836 RasGAP_C RasGAP C-terminus 1.0E-46 1442 1582
PF00612 IQ IQ calmodulin-binding motif 2.0E-03 510 530
PF00307 CH Calponin homology (CH) domain 9.4E-12 280 379

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O14188|RNG2_SCHPO Ras GTPase-activating-like protein rng2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rng2 PE=1 SV=1 454 1659 0.0E+00
sp|Q5AH02|IQG1_CANAL Ras GTPase-activating-like protein IQG1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=IQG1 PE=1 SV=1 271 1659 2.0E-163
sp|Q3UQ44|IQGA2_MOUSE Ras GTPase-activating-like protein IQGAP2 OS=Mus musculus GN=Iqgap2 PE=1 SV=2 742 1659 5.0E-137
sp|P46940|IQGA1_HUMAN Ras GTPase-activating-like protein IQGAP1 OS=Homo sapiens GN=IQGAP1 PE=1 SV=1 726 1659 3.0E-136
sp|Q9JKF1|IQGA1_MOUSE Ras GTPase-activating-like protein IQGAP1 OS=Mus musculus GN=Iqgap1 PE=1 SV=2 726 1659 5.0E-135
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O14188|RNG2_SCHPO Ras GTPase-activating-like protein rng2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rng2 PE=1 SV=1 454 1659 0.0E+00
sp|Q5AH02|IQG1_CANAL Ras GTPase-activating-like protein IQG1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=IQG1 PE=1 SV=1 271 1659 2.0E-163
sp|Q3UQ44|IQGA2_MOUSE Ras GTPase-activating-like protein IQGAP2 OS=Mus musculus GN=Iqgap2 PE=1 SV=2 742 1659 5.0E-137
sp|P46940|IQGA1_HUMAN Ras GTPase-activating-like protein IQGAP1 OS=Homo sapiens GN=IQGAP1 PE=1 SV=1 726 1659 3.0E-136
sp|Q9JKF1|IQGA1_MOUSE Ras GTPase-activating-like protein IQGAP1 OS=Mus musculus GN=Iqgap1 PE=1 SV=2 726 1659 5.0E-135
sp|Q13576|IQGA2_HUMAN Ras GTPase-activating-like protein IQGAP2 OS=Homo sapiens GN=IQGAP2 PE=1 SV=4 742 1659 2.0E-128
sp|Q86VI3|IQGA3_HUMAN Ras GTPase-activating-like protein IQGAP3 OS=Homo sapiens GN=IQGAP3 PE=1 SV=2 723 1660 1.0E-112
sp|Q54K32|RGAA_DICDI Ras GTPase-activating-like protein rgaA OS=Dictyostelium discoideum GN=rgaA PE=1 SV=1 892 1613 8.0E-62
sp|Q12280|IQG1_YEAST Ras GTPase-activating-like protein IQG1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=IQG1 PE=1 SV=1 508 1660 1.0E-55
sp|O00899|GAPA_DICDI Ras GTPase-activating-like protein gapA OS=Dictyostelium discoideum GN=gapA PE=1 SV=1 892 1661 5.0E-54
sp|Q12280|IQG1_YEAST Ras GTPase-activating-like protein IQG1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=IQG1 PE=1 SV=1 269 826 2.0E-38
sp|O14188|RNG2_SCHPO Ras GTPase-activating-like protein rng2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rng2 PE=1 SV=1 233 438 2.0E-36
sp|P46940|IQGA1_HUMAN Ras GTPase-activating-like protein IQGAP1 OS=Homo sapiens GN=IQGAP1 PE=1 SV=1 262 427 6.0E-35
sp|Q13576|IQGA2_HUMAN Ras GTPase-activating-like protein IQGAP2 OS=Homo sapiens GN=IQGAP2 PE=1 SV=4 262 427 8.0E-35
sp|Q9JKF1|IQGA1_MOUSE Ras GTPase-activating-like protein IQGAP1 OS=Mus musculus GN=Iqgap1 PE=1 SV=2 262 427 9.0E-35
sp|Q3UQ44|IQGA2_MOUSE Ras GTPase-activating-like protein IQGAP2 OS=Mus musculus GN=Iqgap2 PE=1 SV=2 262 427 2.0E-34
sp|P33277|GAP1_SCHPO GTPase-activating protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gap1 PE=3 SV=1 887 1347 3.0E-32
sp|Q86VI3|IQGA3_HUMAN Ras GTPase-activating-like protein IQGAP3 OS=Homo sapiens GN=IQGAP3 PE=1 SV=2 250 427 2.0E-30
sp|Q10201|YBX7_SCHPO Uncharacterized protein C17D1.07c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC17D1.07c PE=3 SV=2 271 429 3.0E-14
sp|P14318|MP20_DROME Muscle-specific protein 20 OS=Drosophila melanogaster GN=Mp20 PE=2 SV=2 280 377 4.0E-10
sp|Q55AR6|NFAA_DICDI Neurofibromin-A OS=Dictyostelium discoideum GN=nfaA PE=3 SV=1 1052 1266 2.0E-08
sp|Q24799|MYPH_ECHGR Myophilin OS=Echinococcus granulosus PE=2 SV=1 280 378 3.0E-08
sp|Q12280|IQG1_YEAST Ras GTPase-activating-like protein IQG1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=IQG1 PE=1 SV=1 448 807 5.0E-08
sp|P97526|NF1_RAT Neurofibromin OS=Rattus norvegicus GN=Nf1 PE=1 SV=1 1028 1313 8.0E-08
sp|O14185|STG1_SCHPO Transgelin OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=stg1 PE=3 SV=1 280 378 3.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0043087 regulation of GTPase activity Yes
GO:0051336 regulation of hydrolase activity No
GO:0003674 molecular_function No
GO:0008150 biological_process No
GO:0005488 binding No
GO:0065009 regulation of molecular function No
GO:0050790 regulation of catalytic activity No
GO:0065007 biological regulation No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup2432
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4683
Ophiocordyceps australis map64 (Brazil) OphauB2|4493 (this protein)
Ophiocordyceps camponoti-floridani Ophcf2|03312
Ophiocordyceps camponoti-rufipedis Ophun1|5346
Ophiocordyceps kimflemingae Ophio5|3524
Ophiocordyceps subramaniannii Hirsu2|3452

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|4493
MPSKAQTAGSMLDRYPSTTSSSASSGYSHASENSLSSHLTLTSASSGGTPTSAGHKRGRSDVLARARTFEQGAMT
SSSLASAKPSSSPQATARRTLRPLPQAPTSPPKPPSTPPHGVGGHERGKSFDTGKLALTQADGPSSPSSPPRPLL
RPNSMLLTRSDSLLRGSPALAHSHSPQALHAPLHAAHIGRPDLELLGKSSTRELRTLSRLAQSQSADDFAMTQPV
QEVTGLRGRRRLQRAPRPNGTRDSKTTGYGWEGRNWMDKERQFLQAYEYLCHIGEAKEWIEDVTSKPLPPIVELE
EALRDGVTLAQIVEALNPDRRHRIFHNAKLQYRHSDNIAIFFRYLDEVQLPDLFRFELIDLYEKKNIPKVIYCIH
ALSWLLFRKGILTFRIGNLVGQLEFEDHELEAMQKGLDKLGVSMPSFGNMGADFGVAEPEPEPEETEEERIDRQL
AQHETTIVDFEAQIRGALLRLKLGETMQKLWDGEDWLVDLQARIRGDFTRQIMSYRLQMRQSAITVQSAARGFLV
RQRLKQRDQTCKALEPDILKLQSLIRAAKVRRQVQHVKSQFAACRGPVREIQAISRGFLVRRNHAAQRQETVQSS
TSVRLVQALARGMLLRSRVAHDMRLLEREVKAICKLQAAARALLTRNHMNLQQQHLGAFESQWTKLQSAARGASA
RAHHKSLKADLMAHDGEVAQLQALMRAAAVRRDIAKQLDELASNHDETVRLQSHARGLFQRQRTAALREELSSHE
DMVVRLQGYARGLVGRSRLSQLMDEVKSHDEQTAAFQAILKAMVVRADIEDIMTELAEEEEAIVEFQAAARAFLV
RVRFEEKRRFFNENMQKVVKIQSFVRAKVQGQAYKSLTTGKNPPVNAVKNFVHLLNDSDFDFNEEIEFERMRKTV
VQQVRQNEMLEQYIDQLDIKIALLVKNKITLDEVVRHQHNYGGHSMGLLANVGMVSTNQFDLKALNKSSRKKLES
YQQLFFCLQTQPQYLARLFKRIREQGMADKECKRIELLMMSLFGYAQKRREEYYLLKVMARSIREEVEGATVLQD
YVRGNYFWARLLGNYTRSPRDRKYLRMLLGPLIRDNIVEDPALDLESDPMQIYRSAINNEELRTGRPDQRPLDVP
REVAIRDAETRRLFIDHLRDLREICDQFLVALEDSLHKMPYGLRFLCRQMWEALCQHFEREAPEQLLQVVSNWLW
KFYLQPAVTAPEQVGVLEKTLSPLQRRNLGEVAKVISQVASGRPFGGDNIYLQPLNAFVGESVERLGLIMQHLIA
VPDAERSFDIDEFNDLYAKNKPTLYIKMTDVFAIHSLVAGELAAMSLGRDDVLHEIMQDLGSAKSNENEMNAAGS
SDIHMFLTPKLHEVEDPDEHIKALFMETKRCVLYIIRVQTGANLLEILVKPITADDEHKWAALLHDDFAPEAGKT
RGAYSDANMVDVTRMTYHELKRTALENIMQLEHMGRISKHNLYQDVLNAIASDIRTKSRRRVQRQRELEGVRLTL
GNLHEKAKWLEQQRKSYDDYIEQAMATLQNKKGKKRFLLPFTKQYNHQRELERSGRVPKFGSFKYSARALLEKGV
LVSWKGLTDRELDKINLTISCDQVGIFALEGSRGHIQIPGASALVPIEDLLQAQFEAHQFMNLFEANLKLNVNLL
LHLVYKKFYRTQ*
Coding >OphauB2|4493
ATGCCATCCAAAGCACAGACGGCGGGGAGCATGCTCGATCGATATCCTTCAACCACATCATCATCAGCATCGTCA
GGCTACTCGCATGCGTCGGAAAACAGCCTCAGCAGCCACTTGACCCTGACGTCGGCCTCTAGTGGTGGCACCCCG
ACGTCGGCTGGCCACAAGCGCGGCCGCAGCGATGTTCTTGCCAGAGCGCGCACCTTTGAGCAAGGCGCCATGACA
AGCTCCAGCCTTGCCAGTGCCAAGCCAAGCAGCAGTCCCCAAGCCACAGCCCGCAGGACACTGCGCCCGCTGCCC
CAAGCTCCCACATCGCCGCCCAAGCCACCGTCGACACCACCCCATGGCGTCGGCGGCCACGAGCGCGGCAAGAGC
TTCGACACGGGCAAGCTGGCGCTCACACAAGCCGACGGCCCCTCGTCACCATCTTCACCACCTCGGCCCCTGCTG
CGGCCCAATTCCATGCTGCTGACGCGATCCGACTCGCTTCTCCGCGGCAGCCCTGCTCTTGCTCACAGCCACTCT
CCTCAGGCTCTGCACGCGCCCCTTCACGCAGCCCACATTGGCCGTCCAGATCTCGAGCTTCTCGGCAAGTCGTCG
ACGAGGGAGCTGCGCACTCTGTCGCGCCTGGCCCAGTCCCAGTCGGCCGACGACTTTGCCATGACCCAGCCCGTC
CAAGAAGTCACTGGACTGCGCGGCCGGCGTCGTCTCCAGCGCGCGCCCAGACCCAATGGCACCCGTGACTCTAAG
ACGACGGGCTACGGCTGGGAGGGCCGCAACTGGATGGACAAGGAGCGCCAGTTCCTCCAAGCCTACGAGTATCTT
TGTCACATAGGGGAGGCTAAGGAATGGATCGAGGACGTGACAAGCAAGCCTCTGCCTCCAATCGTTGAGCTGGAG
GAGGCGCTTCGAGACGGCGTCACGCTCGCGCAGATTGTCGAGGCTCTCAATCCCGATCGCCGCCATCGCATTTTC
CATAATGCAAAGCTTCAATATCGCCATTCAGACAATATTGCCATTTTTTTTCGCTATCTCGACGAGGTGCAGCTA
CCCGACCTCTTTCGCTTCGAACTCATTGACCTTTACGAGAAGAAGAATATACCCAAGGTTATATACTGTATACAC
GCTCTGAGCTGGCTCCTTTTCCGCAAGGGCATCCTAACTTTCCGCATTGGAAACCTTGTCGGCCAGCTCGAGTTT
GAAGACCACGAGTTGGAGGCGATGCAAAAGGGCCTGGACAAGCTAGGCGTTAGCATGCCCAGTTTTGGCAACATG
GGCGCCGATTTTGGAGTTGCCGAGCCCGAGCCCGAGCCTGAGGAGACGGAAGAAGAGAGAATCGACCGCCAACTT
GCCCAGCACGAGACAACTATTGTTGACTTTGAAGCGCAGATTCGCGGTGCCCTGTTGCGCTTGAAGCTGGGAGAG
ACAATGCAGAAGCTTTGGGACGGTGAGGATTGGCTGGTTGACTTGCAGGCCAGGATCCGCGGCGACTTTACGCGA
CAGATTATGAGCTATCGGCTTCAGATGCGCCAATCTGCCATTACCGTTCAGAGCGCTGCGCGAGGGTTTCTAGTC
CGGCAGAGGCTCAAACAACGAGACCAAACCTGCAAGGCTCTGGAGCCAGATATCTTGAAGCTGCAGAGTCTGATT
CGAGCGGCCAAGGTGCGCCGCCAAGTCCAACATGTCAAGTCACAGTTTGCTGCTTGCAGAGGCCCGGTTCGAGAG
ATTCAGGCAATCTCAAGGGGGTTCTTGGTGCGCCGAAATCACGCGGCCCAACGGCAGGAGACGGTGCAGTCGTCA
ACATCTGTTCGACTTGTCCAGGCTCTAGCTCGGGGGATGCTCTTGAGAAGCCGCGTTGCTCATGACATGCGCTTG
CTGGAGAGGGAAGTCAAGGCTATTTGCAAGCTTCAAGCTGCTGCCAGGGCACTATTGACCAGGAATCACATGAAT
CTGCAGCAACAGCACTTGGGCGCCTTTGAAAGCCAGTGGACCAAGCTTCAGAGCGCGGCGCGAGGAGCGAGTGCC
CGAGCCCACCACAAGTCTCTCAAGGCGGATTTGATGGCGCACGACGGCGAGGTGGCTCAGCTTCAAGCGTTGATG
CGAGCTGCAGCTGTGCGCAGAGACATTGCGAAGCAATTAGACGAGCTGGCTTCAAACCACGACGAGACGGTGCGC
CTTCAGTCACATGCAAGGGGCTTGTTCCAAAGACAGCGGACGGCGGCACTGAGAGAGGAGCTCAGCAGCCACGAG
GACATGGTTGTCAGGTTGCAAGGCTACGCGCGAGGCCTTGTTGGGCGCAGTCGCTTGTCGCAGCTCATGGATGAA
GTCAAGTCTCATGACGAGCAGACGGCGGCTTTCCAAGCGATATTAAAGGCCATGGTGGTTCGAGCAGACATTGAA
GACATCATGACGGAGCTGGCAGAGGAGGAAGAGGCCATTGTTGAGTTTCAGGCAGCGGCGCGGGCATTCTTGGTT
CGGGTGCGGTTTGAGGAGAAGCGGCGCTTCTTCAACGAAAACATGCAAAAGGTGGTCAAGATTCAAAGCTTTGTC
AGGGCCAAGGTGCAGGGCCAGGCCTACAAGAGCTTGACAACGGGCAAGAATCCGCCGGTGAATGCGGTCAAGAAC
TTTGTGCATTTGCTCAATGACAGCGATTTCGACTTCAACGAGGAAATCGAGTTTGAGCGGATGCGCAAGACGGTG
GTGCAACAAGTGCGGCAAAACGAGATGCTGGAGCAGTACATTGATCAGCTCGACATCAAGATTGCCCTCTTGGTC
AAGAACAAGATCACATTGGACGAAGTGGTGCGCCACCAGCACAACTATGGGGGTCACTCGATGGGCCTGCTGGCC
AATGTGGGCATGGTTTCCACCAACCAGTTTGACCTCAAGGCGCTCAACAAGAGCTCGCGCAAGAAGCTCGAGTCG
TATCAGCAGCTCTTTTTCTGTCTGCAGACGCAGCCGCAGTACCTGGCGCGTCTGTTCAAGCGGATCCGCGAGCAA
GGAATGGCAGACAAGGAGTGCAAGAGGATTGAGCTGCTCATGATGAGTCTGTTCGGCTATGCGCAGAAGCGACGC
GAAGAGTACTACTTGCTCAAAGTCATGGCAAGGTCGATCCGAGAGGAGGTTGAGGGCGCGACGGTGCTGCAGGAC
TATGTCAGGGGCAACTACTTCTGGGCCAGGCTGCTGGGCAACTATACGCGGTCTCCGCGCGACCGCAAGTATCTG
CGCATGCTGCTGGGCCCGCTGATTCGCGACAACATTGTGGAGGATCCGGCGCTGGACCTGGAGAGCGACCCGATG
CAGATATACCGGTCGGCAATCAACAATGAGGAGCTGCGGACCGGACGGCCGGACCAGCGGCCGCTGGATGTGCCG
CGCGAAGTGGCGATTCGAGACGCGGAGACGCGGCGGCTCTTTATCGACCATCTGCGGGACCTGCGGGAGATATGC
GACCAGTTCCTTGTAGCGCTCGAGGACTCGCTGCATAAGATGCCCTATGGGCTGCGCTTCCTCTGCCGGCAAATG
TGGGAAGCCCTATGCCAGCACTTTGAGCGAGAGGCGCCGGAGCAGCTGCTGCAGGTGGTGAGCAACTGGCTGTGG
AAGTTTTACCTGCAGCCGGCCGTGACTGCGCCGGAGCAGGTGGGCGTGCTGGAGAAGACGCTGAGCCCGCTGCAG
CGGCGCAATCTGGGCGAGGTGGCCAAGGTGATTAGCCAGGTGGCGTCGGGGCGGCCGTTTGGCGGCGACAACATT
TACCTGCAGCCGCTCAATGCCTTTGTGGGCGAGTCGGTGGAGCGGCTGGGCCTCATTATGCAGCATCTCATTGCA
GTGCCGGATGCCGAGCGCAGCTTCGACATTGACGAGTTCAACGACTTGTACGCCAAGAACAAGCCGACGCTCTAC
ATCAAGATGACGGACGTGTTTGCCATCCACAGCCTGGTGGCGGGCGAGCTGGCGGCCATGAGTCTGGGGCGCGAC
GACGTGCTGCACGAAATCATGCAGGATCTGGGCAGCGCCAAGAGCAACGAGAACGAGATGAATGCAGCCGGCTCC
TCCGACATCCACATGTTTCTGACGCCCAAGCTGCACGAGGTGGAGGATCCCGACGAGCACATCAAGGCGCTCTTC
ATGGAGACGAAGCGCTGCGTCTTGTACATTATCCGAGTCCAGACGGGCGCCAACCTGCTTGAGATTCTCGTCAAG
CCCATTACAGCCGACGACGAGCACAAGTGGGCCGCTCTGCTGCACGACGACTTTGCCCCCGAGGCGGGCAAGACG
CGCGGCGCCTACTCAGACGCCAACATGGTGGACGTGACGCGCATGACGTACCACGAGCTCAAGCGGACGGCGCTC
GAGAACATTATGCAGCTGGAGCACATGGGGCGCATCTCCAAGCACAATCTCTACCAAGACGTGCTCAATGCCATT
GCCAGCGACATTCGCACCAAGAGCAGGCGGCGCGTGCAGCGGCAGCGCGAGCTCGAGGGCGTGCGTCTGACGCTG
GGCAACTTGCACGAAAAGGCAAAGTGGCTGGAGCAGCAGCGCAAGAGCTACGACGACTATATTGAGCAGGCCATG
GCGACGCTGCAAAACAAGAAGGGCAAAAAACGCTTCCTGCTCCCCTTCACCAAGCAGTACAACCACCAGCGCGAG
CTCGAGCGCAGCGGCAGAGTGCCCAAATTCGGCAGCTTCAAGTATAGTGCACGCGCACTGCTTGAAAAGGGCGTC
CTCGTCTCCTGGAAGGGACTCACCGACCGCGAGCTCGACAAGATCAACCTCACCATTTCCTGCGACCAAGTCGGC
ATCTTTGCCCTCGAGGGCTCGCGCGGCCACATCCAGATCCCCGGAGCAAGCGCCCTCGTGCCCATTGAGGACCTG
CTGCAGGCCCAATTCGAGGCACACCAGTTCATGAATCTGTTTGAGGCCAACCTCAAGCTCAATGTCAACCTGCTG
CTACACCTTGTCTACAAGAAGTTTTACCGCACGCAATAA
Transcript >OphauB2|4493
ATGCCATCCAAAGCACAGACGGCGGGGAGCATGCTCGATCGATATCCTTCAACCACATCATCATCAGCATCGTCA
GGCTACTCGCATGCGTCGGAAAACAGCCTCAGCAGCCACTTGACCCTGACGTCGGCCTCTAGTGGTGGCACCCCG
ACGTCGGCTGGCCACAAGCGCGGCCGCAGCGATGTTCTTGCCAGAGCGCGCACCTTTGAGCAAGGCGCCATGACA
AGCTCCAGCCTTGCCAGTGCCAAGCCAAGCAGCAGTCCCCAAGCCACAGCCCGCAGGACACTGCGCCCGCTGCCC
CAAGCTCCCACATCGCCGCCCAAGCCACCGTCGACACCACCCCATGGCGTCGGCGGCCACGAGCGCGGCAAGAGC
TTCGACACGGGCAAGCTGGCGCTCACACAAGCCGACGGCCCCTCGTCACCATCTTCACCACCTCGGCCCCTGCTG
CGGCCCAATTCCATGCTGCTGACGCGATCCGACTCGCTTCTCCGCGGCAGCCCTGCTCTTGCTCACAGCCACTCT
CCTCAGGCTCTGCACGCGCCCCTTCACGCAGCCCACATTGGCCGTCCAGATCTCGAGCTTCTCGGCAAGTCGTCG
ACGAGGGAGCTGCGCACTCTGTCGCGCCTGGCCCAGTCCCAGTCGGCCGACGACTTTGCCATGACCCAGCCCGTC
CAAGAAGTCACTGGACTGCGCGGCCGGCGTCGTCTCCAGCGCGCGCCCAGACCCAATGGCACCCGTGACTCTAAG
ACGACGGGCTACGGCTGGGAGGGCCGCAACTGGATGGACAAGGAGCGCCAGTTCCTCCAAGCCTACGAGTATCTT
TGTCACATAGGGGAGGCTAAGGAATGGATCGAGGACGTGACAAGCAAGCCTCTGCCTCCAATCGTTGAGCTGGAG
GAGGCGCTTCGAGACGGCGTCACGCTCGCGCAGATTGTCGAGGCTCTCAATCCCGATCGCCGCCATCGCATTTTC
CATAATGCAAAGCTTCAATATCGCCATTCAGACAATATTGCCATTTTTTTTCGCTATCTCGACGAGGTGCAGCTA
CCCGACCTCTTTCGCTTCGAACTCATTGACCTTTACGAGAAGAAGAATATACCCAAGGTTATATACTGTATACAC
GCTCTGAGCTGGCTCCTTTTCCGCAAGGGCATCCTAACTTTCCGCATTGGAAACCTTGTCGGCCAGCTCGAGTTT
GAAGACCACGAGTTGGAGGCGATGCAAAAGGGCCTGGACAAGCTAGGCGTTAGCATGCCCAGTTTTGGCAACATG
GGCGCCGATTTTGGAGTTGCCGAGCCCGAGCCCGAGCCTGAGGAGACGGAAGAAGAGAGAATCGACCGCCAACTT
GCCCAGCACGAGACAACTATTGTTGACTTTGAAGCGCAGATTCGCGGTGCCCTGTTGCGCTTGAAGCTGGGAGAG
ACAATGCAGAAGCTTTGGGACGGTGAGGATTGGCTGGTTGACTTGCAGGCCAGGATCCGCGGCGACTTTACGCGA
CAGATTATGAGCTATCGGCTTCAGATGCGCCAATCTGCCATTACCGTTCAGAGCGCTGCGCGAGGGTTTCTAGTC
CGGCAGAGGCTCAAACAACGAGACCAAACCTGCAAGGCTCTGGAGCCAGATATCTTGAAGCTGCAGAGTCTGATT
CGAGCGGCCAAGGTGCGCCGCCAAGTCCAACATGTCAAGTCACAGTTTGCTGCTTGCAGAGGCCCGGTTCGAGAG
ATTCAGGCAATCTCAAGGGGGTTCTTGGTGCGCCGAAATCACGCGGCCCAACGGCAGGAGACGGTGCAGTCGTCA
ACATCTGTTCGACTTGTCCAGGCTCTAGCTCGGGGGATGCTCTTGAGAAGCCGCGTTGCTCATGACATGCGCTTG
CTGGAGAGGGAAGTCAAGGCTATTTGCAAGCTTCAAGCTGCTGCCAGGGCACTATTGACCAGGAATCACATGAAT
CTGCAGCAACAGCACTTGGGCGCCTTTGAAAGCCAGTGGACCAAGCTTCAGAGCGCGGCGCGAGGAGCGAGTGCC
CGAGCCCACCACAAGTCTCTCAAGGCGGATTTGATGGCGCACGACGGCGAGGTGGCTCAGCTTCAAGCGTTGATG
CGAGCTGCAGCTGTGCGCAGAGACATTGCGAAGCAATTAGACGAGCTGGCTTCAAACCACGACGAGACGGTGCGC
CTTCAGTCACATGCAAGGGGCTTGTTCCAAAGACAGCGGACGGCGGCACTGAGAGAGGAGCTCAGCAGCCACGAG
GACATGGTTGTCAGGTTGCAAGGCTACGCGCGAGGCCTTGTTGGGCGCAGTCGCTTGTCGCAGCTCATGGATGAA
GTCAAGTCTCATGACGAGCAGACGGCGGCTTTCCAAGCGATATTAAAGGCCATGGTGGTTCGAGCAGACATTGAA
GACATCATGACGGAGCTGGCAGAGGAGGAAGAGGCCATTGTTGAGTTTCAGGCAGCGGCGCGGGCATTCTTGGTT
CGGGTGCGGTTTGAGGAGAAGCGGCGCTTCTTCAACGAAAACATGCAAAAGGTGGTCAAGATTCAAAGCTTTGTC
AGGGCCAAGGTGCAGGGCCAGGCCTACAAGAGCTTGACAACGGGCAAGAATCCGCCGGTGAATGCGGTCAAGAAC
TTTGTGCATTTGCTCAATGACAGCGATTTCGACTTCAACGAGGAAATCGAGTTTGAGCGGATGCGCAAGACGGTG
GTGCAACAAGTGCGGCAAAACGAGATGCTGGAGCAGTACATTGATCAGCTCGACATCAAGATTGCCCTCTTGGTC
AAGAACAAGATCACATTGGACGAAGTGGTGCGCCACCAGCACAACTATGGGGGTCACTCGATGGGCCTGCTGGCC
AATGTGGGCATGGTTTCCACCAACCAGTTTGACCTCAAGGCGCTCAACAAGAGCTCGCGCAAGAAGCTCGAGTCG
TATCAGCAGCTCTTTTTCTGTCTGCAGACGCAGCCGCAGTACCTGGCGCGTCTGTTCAAGCGGATCCGCGAGCAA
GGAATGGCAGACAAGGAGTGCAAGAGGATTGAGCTGCTCATGATGAGTCTGTTCGGCTATGCGCAGAAGCGACGC
GAAGAGTACTACTTGCTCAAAGTCATGGCAAGGTCGATCCGAGAGGAGGTTGAGGGCGCGACGGTGCTGCAGGAC
TATGTCAGGGGCAACTACTTCTGGGCCAGGCTGCTGGGCAACTATACGCGGTCTCCGCGCGACCGCAAGTATCTG
CGCATGCTGCTGGGCCCGCTGATTCGCGACAACATTGTGGAGGATCCGGCGCTGGACCTGGAGAGCGACCCGATG
CAGATATACCGGTCGGCAATCAACAATGAGGAGCTGCGGACCGGACGGCCGGACCAGCGGCCGCTGGATGTGCCG
CGCGAAGTGGCGATTCGAGACGCGGAGACGCGGCGGCTCTTTATCGACCATCTGCGGGACCTGCGGGAGATATGC
GACCAGTTCCTTGTAGCGCTCGAGGACTCGCTGCATAAGATGCCCTATGGGCTGCGCTTCCTCTGCCGGCAAATG
TGGGAAGCCCTATGCCAGCACTTTGAGCGAGAGGCGCCGGAGCAGCTGCTGCAGGTGGTGAGCAACTGGCTGTGG
AAGTTTTACCTGCAGCCGGCCGTGACTGCGCCGGAGCAGGTGGGCGTGCTGGAGAAGACGCTGAGCCCGCTGCAG
CGGCGCAATCTGGGCGAGGTGGCCAAGGTGATTAGCCAGGTGGCGTCGGGGCGGCCGTTTGGCGGCGACAACATT
TACCTGCAGCCGCTCAATGCCTTTGTGGGCGAGTCGGTGGAGCGGCTGGGCCTCATTATGCAGCATCTCATTGCA
GTGCCGGATGCCGAGCGCAGCTTCGACATTGACGAGTTCAACGACTTGTACGCCAAGAACAAGCCGACGCTCTAC
ATCAAGATGACGGACGTGTTTGCCATCCACAGCCTGGTGGCGGGCGAGCTGGCGGCCATGAGTCTGGGGCGCGAC
GACGTGCTGCACGAAATCATGCAGGATCTGGGCAGCGCCAAGAGCAACGAGAACGAGATGAATGCAGCCGGCTCC
TCCGACATCCACATGTTTCTGACGCCCAAGCTGCACGAGGTGGAGGATCCCGACGAGCACATCAAGGCGCTCTTC
ATGGAGACGAAGCGCTGCGTCTTGTACATTATCCGAGTCCAGACGGGCGCCAACCTGCTTGAGATTCTCGTCAAG
CCCATTACAGCCGACGACGAGCACAAGTGGGCCGCTCTGCTGCACGACGACTTTGCCCCCGAGGCGGGCAAGACG
CGCGGCGCCTACTCAGACGCCAACATGGTGGACGTGACGCGCATGACGTACCACGAGCTCAAGCGGACGGCGCTC
GAGAACATTATGCAGCTGGAGCACATGGGGCGCATCTCCAAGCACAATCTCTACCAAGACGTGCTCAATGCCATT
GCCAGCGACATTCGCACCAAGAGCAGGCGGCGCGTGCAGCGGCAGCGCGAGCTCGAGGGCGTGCGTCTGACGCTG
GGCAACTTGCACGAAAAGGCAAAGTGGCTGGAGCAGCAGCGCAAGAGCTACGACGACTATATTGAGCAGGCCATG
GCGACGCTGCAAAACAAGAAGGGCAAAAAACGCTTCCTGCTCCCCTTCACCAAGCAGTACAACCACCAGCGCGAG
CTCGAGCGCAGCGGCAGAGTGCCCAAATTCGGCAGCTTCAAGTATAGTGCACGCGCACTGCTTGAAAAGGGCGTC
CTCGTCTCCTGGAAGGGACTCACCGACCGCGAGCTCGACAAGATCAACCTCACCATTTCCTGCGACCAAGTCGGC
ATCTTTGCCCTCGAGGGCTCGCGCGGCCACATCCAGATCCCCGGAGCAAGCGCCCTCGTGCCCATTGAGGACCTG
CTGCAGGCCCAATTCGAGGCACACCAGTTCATGAATCTGTTTGAGGCCAACCTCAAGCTCAATGTCAACCTGCTG
CTACACCTTGTCTACAAGAAGTTTTACCGCACGCAATAA
Gene >OphauB2|4493
ATGCCATCCAAAGCACAGACGGCGGGGAGCATGCTCGATCGATATCCTTCAACCACATCATCATCAGCATCGTCA
GGCTACTCGCATGCGTCGGAAAACAGCCTCAGCAGCCACTTGACCCTGACGTCGGCCTCTAGTGGTGGCACCCCG
ACGTCGGCTGGCCACAAGCGCGGCCGCAGCGATGTTCTTGCCAGAGCGCGCACCTTTGAGCAAGGCGCCATGACA
AGCTCCAGCCTTGCCAGTGCCAAGCCAAGCAGCAGTCCCCAAGCCACAGCCCGCAGGACACTGCGCCCGCTGCCC
CAAGCTCCCACATCGCCGCCCAAGCCACCGTCGACACCACCCCATGGCGTCGGCGGCCACGAGCGCGGCAAGAGC
TTCGACACGGGCAAGCTGGCGCTCACACAAGCCGACGGCCCCTCGTCACCATCTTCACCACCTCGGCCCCTGCTG
CGGCCCAATTCCATGCTGCTGACGCGATCCGACTCGCTTCTCCGCGGCAGCCCTGCTCTTGCTCACAGCCACTCT
CCTCAGGCTCTGCACGCGCCCCTTCACGCAGCCCACATTGGCCGTCCAGATCTCGAGCTTCTCGGCAAGTCGTCG
ACGAGGGAGCTGCGCACTCTGTCGCGCCTGGCCCAGTCCCAGTCGGCCGACGACTTTGCCATGACCCAGCCCGTC
CAAGAAGTCACTGGACTGCGCGGCCGGCGTCGTCTCCAGCGCGCGCCCAGACCCAATGGCACCCGTGACTCTAAG
ACGACGGGCTACGGCTGGGAGGGCCGCAACTGGATGGACAAGGAGCGCCAGTTCCTCCAAGCCTACGAGTATCTT
TGTCACATAGGGGAGGCTAAGGAATGGATCGAGGACGTGACAAGCAAGCCTCTGCCTCCAATCGTTGAGCTGGAG
GAGGCGCTTCGAGACGGCGTCACGCTCGCGCAGATTGTCGAGGCTCTCAATCCCGATCGCCGCCATCGCATTTTC
CATAATGCAAAGCTTCAATATCGCCATTCAGACAATATTGCCATTTTTTTTCGCTATCTCGACGAGGTGCAGCTA
CCCGACCTCTTTCGCTTCGAACTCATTGACCTTTACGAGAAGAAGAATATACCCAAGGTTATATACTGTATACAC
GCTCTGAGCTGGCTCCTTTTCCGCAAGGGCATCCTAACTTTCCGCATTGGAAACCTTGTCGGCCAGCTCGAGTTT
GAAGACCACGAGTTGGAGGCGATGCAAAAGGGCCTGGACAAGCTAGGCGTTAGCATGCCCAGTTTTGGCAACATG
GGCGCCGATTTTGGAGTTGCCGAGCCCGAGCCCGAGCCTGAGGAGACGGAAGAAGAGAGAATCGACCGCCAACTT
GCCCAGCACGAGACAACTATTGTTGACTTTGAAGCGCAGATTCGCGGTGCCCTGTTGCGCTTGAAGCTGGGAGAG
ACAATGCAGAAGCTTTGGGACGGTGAGGATTGGCTGGTTGACTTGCAGGCCAGGATCCGCGGCGACTTTACGCGA
CAGATTATGAGCTATCGGCTTCAGATGCGCCAATCTGCCATTACCGTTCAGAGCGCTGCGCGAGGGTTTCTAGTC
CGGCAGAGGCTCAAACAACGAGACCAAACCTGCAAGGCTCTGGAGCCAGATATCTTGAAGCTGCAGAGTCTGATT
CGAGCGGCCAAGGTGCGCCGCCAAGTCCAACATGTCAAGTCACAGTTTGCTGCTTGCAGAGGCCCGGTTCGAGAG
ATTCAGGCAATCTCAAGGGGGTTCTTGGTGCGCCGAAATCACGCGGCCCAACGGCAGGAGACGGTGCAGTCGTCA
ACATCTGTTCGACTTGTCCAGGCTCTAGCTCGGGGGATGCTCTTGAGAAGCCGCGTTGCTCATGACATGCGCTTG
CTGGAGAGGGAAGTCAAGGCTATTTGCAAGCTTCAAGCTGCTGCCAGGGCACTATTGACCAGGAATCACATGAAT
CTGCAGCAACAGCACTTGGGCGCCTTTGAAAGCCAGTGGACCAAGCTTCAGAGCGCGGCGCGAGGAGCGAGTGCC
CGAGCCCACCACAAGTCTCTCAAGGCGGATTTGATGGCGCACGACGGCGAGGTGGCTCAGCTTCAAGCGTTGATG
CGAGCTGCAGCTGTGCGCAGAGACATTGCGAAGCAATTAGACGAGCTGGCTTCAAACCACGACGAGACGGTGCGC
CTTCAGTCACATGCAAGGGGCTTGTTCCAAAGACAGCGGACGGCGGCACTGAGAGAGGAGCTCAGCAGCCACGAG
GACATGGTTGTCAGGTTGCAAGGCTACGCGCGAGGCCTTGTTGGGCGCAGTCGCTTGTCGCAGCTCATGGATGAA
GTCAAGTCTCATGACGAGCAGACGGCGGCTTTCCAAGCGATATTAAAGGCCATGGTGGTTCGAGCAGACATTGAA
GACATCATGACGGAGCTGGCAGAGGAGGAAGAGGCCATTGTTGAGTTTCAGGCAGCGGCGCGGGCATTCTTGGTT
CGGGTGCGGTTTGAGGAGAAGCGGCGCTTCTTCAACGAAAACATGCAAAAGGTGGTCAAGATTCAAAGCTTTGTC
AGGGCCAAGGTGCAGGGCCAGGCCTACAAGAGCTTGACAACGGGCAAGAATCCGCCGGTGAATGCGGTCAAGAAC
TTTGTGCATTTGCTCAATGACAGCGATTTCGACTTCAACGAGGAAATCGAGTTTGAGCGGATGCGCAAGACGGTG
GTGCAACAAGTGCGGCAAAACGAGATGCTGGAGCAGTACATTGATCAGCTCGACATCAAGATTGCCCTCTTGGTC
AAGAACAAGATCACATTGGACGAAGTGGTGCGCCACCAGCACAACTATGGGGGTCACTCGATGGGCCTGCTGGCC
AATGTGGGCATGGTTTCCACCAACCAGTTTGACCTCAAGGCGCTCAACAAGAGCTCGCGCAAGAAGCTCGAGTCG
TATCAGCAGCTCTTTTTCTGTCTGCAGACGCAGCCGCAGTACCTGGCGCGTCTGTTCAAGCGGATCCGCGAGCAA
GGAATGGCAGACAAGGAGTGCAAGAGGATTGAGCTGCTCATGATGAGTCTGTTCGGCTATGCGCAGAAGCGACGC
GAAGAGTACTACTTGCTCAAAGTCATGGCAAGGTCGATCCGAGAGGAGGTTGAGGGCGCGACGGTGCTGCAGGAC
TATGTCAGGGGCAACTACTTCTGGGCCAGGCTGCTGGGCAACTATACGCGGTCTCCGCGCGACCGCAAGTATCTG
CGCATGCTGCTGGGCCCGCTGATTCGCGACAACATTGTGGAGGATCCGGCGCTGGACCTGGAGAGCGACCCGATG
CAGATATACCGGTCGGCAATCAACAATGAGGAGCTGCGGACCGGACGGCCGGACCAGCGGCCGCTGGATGTGCCG
CGCGAAGTGGCGATTCGAGACGCGGAGACGCGGCGGCTCTTTATCGACCATCTGCGGGACCTGCGGGAGATATGC
GACCAGTTCCTTGTAGCGCTCGAGGACTCGCTGCATAAGATGCCCTATGGGCTGCGCTTCCTCTGCCGGCAAATG
TGGGAAGCCCTATGCCAGCACTTTGAGCGAGAGGCGCCGGAGCAGCTGCTGCAGGTGGTGAGCAACTGGCTGTGG
AAGTTTTACCTGCAGCCGGCCGTGACTGCGCCGGAGCAGGTGGGCGTGCTGGAGAAGACGCTGAGCCCGCTGCAG
CGGCGCAATCTGGGCGAGGTGGCCAAGGTGATTAGCCAGGTGGCGTCGGGGCGGCCGTTTGGCGGCGACAACATT
TACCTGCAGCCGCTCAATGCCTTTGTGGGCGAGTCGGTGGAGCGGCTGGGCCTCATTATGCAGCATCTCATTGCA
GTGCCGGATGCCGAGCGCAGCTTCGACATTGACGAGTTCAACGACTTGTACGCCAAGAACAAGCCGACGCTCTAC
ATCAAGATGACGGACGTGTTTGCCATCCACAGCCTGGTGGCGGGCGAGCTGGCGGCCATGAGTCTGGGGCGCGAC
GACGTGCTGCACGAAATCATGCAGGATCTGGGCAGCGCCAAGAGCAACGAGAACGAGATGAATGCAGCCGGCTCC
TCCGACATCCACATGTTTCTGACGCCCAAGCTGCACGAGGTGGAGGATCCCGACGAGCACATCAAGGCGCTCTTC
ATGGAGACGAAGCGCTGCGTCTTGTACATTATCCGAGTCCAGACGGGCGCCAACCTGCTTGAGATTCTCGTCAAG
CCCATTACAGCCGACGACGAGCACAAGTGGGCCGCTCTGCTGCACGACGACTTTGCCCCCGAGGCGGGCAAGACG
CGCGGCGCCTACTCAGACGCCAACATGGTGGACGTGACGCGCATGACGTACCACGAGCTCAAGCGGACGGCGCTC
GAGAACATTATGCAGCTGGAGCACATGGGGCGCATCTCCAAGCACAATCTCTACCAAGACGTGCTCAATGCCATT
GCCAGCGACATTCGCACCAAGAGCAGGCGGCGCGTGCAGCGGCAGCGCGAGCTCGAGGGCGTGCGTCTGACGCTG
GGCAACTTGCACGAAAAGGCAAAGTGGCTGGAGCAGCAGCGCAAGAGCTACGACGACTATATTGAGCAGGCCATG
GCGACGCTGCAAAACAAGAAGGGGTGAGTTTTCTTTTTTNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNAAAAAAAAAAAAGACTAACTTTTTTTCCTCTTCGCCGTGCAGCAAAAAACGCTTCCTGCTCCCCTTCAC
CAAGCAGTACAACCACCAGCGCGAGCTCGAGCGCAGCGGCAGAGTGCCCAAATTCGGCAGCTTCAAGTATAGTGC
ACGCGCACTGCTTGAAAAGGGCGTCCTCGTCTCCTGGAAGGGACTCACCGACCGCGAGCTCGACAAGATCAACCT
CACCATTTCCTGCGACCAAGTCGGCATCTTTGCCCTCGAGGGCTCGCGCGGCCACATCCAGATCCCCGGAGCAAG
CGCCCTCGTGCCCATTGAGGACCTGCTGCAGGCCCAATTCGAGGCACACCAGTTCATGAATCTGTTTGAGGCCAA
CCTCAAGCTCAATGTCAACCTGCTGCTACACCTTGTCTACAAGAAGTTTTACCGCACGCAATAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail