Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|4492
Gene name
LocationContig_3:304017..306036
Strand-
Gene length (bp)2019
Transcript length (bp)1872
Coding sequence length (bp)1872
Protein length (aa) 624

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02582 DUF155 RMND1/Sif2-Sif3/Mrx10, DUF155 1.2E-53 310 492

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q09877|SIF3_SCHPO Sad1-interacting factor 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sif3 PE=1 SV=2 91 515 2.0E-84
sp|P43620|RMD8_YEAST Sporulation protein RMD8 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RMD8 PE=1 SV=1 308 545 2.0E-82
sp|O74446|SIF2_SCHPO Sad1-interacting factor 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sif2 PE=1 SV=2 83 536 4.0E-57
sp|Q03441|RMD1_YEAST Sporulation protein RMD1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RMD1 PE=1 SV=1 309 536 4.0E-53
sp|P43620|RMD8_YEAST Sporulation protein RMD8 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RMD8 PE=1 SV=1 34 297 1.0E-24
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q09877|SIF3_SCHPO Sad1-interacting factor 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sif3 PE=1 SV=2 91 515 2.0E-84
sp|P43620|RMD8_YEAST Sporulation protein RMD8 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RMD8 PE=1 SV=1 308 545 2.0E-82
sp|O74446|SIF2_SCHPO Sad1-interacting factor 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sif2 PE=1 SV=2 83 536 4.0E-57
sp|Q03441|RMD1_YEAST Sporulation protein RMD1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RMD1 PE=1 SV=1 309 536 4.0E-53
sp|P43620|RMD8_YEAST Sporulation protein RMD8 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RMD8 PE=1 SV=1 34 297 1.0E-24
sp|Q8CI78|RMND1_MOUSE Required for meiotic nuclear division protein 1 homolog OS=Mus musculus GN=Rmnd1 PE=1 SV=1 310 536 9.0E-19
sp|Q9NWS8|RMND1_HUMAN Required for meiotic nuclear division protein 1 homolog OS=Homo sapiens GN=RMND1 PE=1 SV=2 310 536 2.0E-18
sp|Q5RAR5|RMND1_PONAB Required for meiotic nuclear division protein 1 homolog OS=Pongo abelii GN=RMND1 PE=2 SV=1 310 536 1.0E-17
sp|Q05648|MRX10_YEAST MIOREX complex component 10 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MRX10 PE=1 SV=1 316 548 2.0E-15
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 69 0.45

Transmembrane Domains

Domain # Start End Length
1 516 538 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|4492
MSSSKQQRPSVLVTDSRQRRAPRRPDPTSGTSSRTPIRFMTVDNVLQYNSQIPSGQPRGPPAAATRPLAAMSRRV
SAGGLANLQSRTGQSMPSRTTKISQKLVLLPETEQQDEETADDEVESESVLARRVVQDEEAGPLRDEELDVLKKR
GGIRGKSYAERLPKMQRKDKISRLTAYCTAQAFKVEATSEFVRKRHEAKTKLYDDCLYAIYALPLLNGTDGYRVR
GRPMLKTPGTGKTVLDLEIERTEQRDHQQGYFEDDAYSTPESPERAARGSGSTSFGEEEPRREAQEELPSHMNRL
APDGKNFAELFVFSYGVVVFWNFTEHQEKDILADLTFADAEDAMSLMTGPLEQDDYETEEFHFEYSAYVKRPRVF
NDMITLLPRSDHMIKLTISHAIAQSTKLCFFEERMSETMLDAQDVPKKLALTGQLNMTRTAIVKILGRLFKSRVD
INLSSNILDVPNFFWDSEPTLHPLYEAVREYLEIDPRIKVLNERCRVFLDLAEILSDSVADAKMSNITWIVIVLI
VVSILVTVTEVGLRFGMLSKKPAAGVGCKGLASCVAGPPAAAGLPDPARIGPLAHDAAWPDDSFEALALVLGLRA
NATVGDFRSTIDRLQRLAASCSA*
Coding >OphauB2|4492
ATGTCTTCCAGCAAACAACAGAGACCATCAGTCCTTGTGACGGACTCGAGACAAAGACGAGCACCACGGCGCCCA
GACCCGACAAGCGGCACGTCGTCACGCACGCCAATACGATTCATGACGGTCGACAACGTCCTCCAGTACAACTCA
CAGATTCCATCCGGCCAGCCACGAGGGCCGCCAGCGGCTGCTACCAGGCCTCTTGCGGCAATGAGCCGTCGTGTC
TCGGCCGGCGGCCTTGCCAACCTCCAGTCGCGGACGGGCCAGTCAATGCCGTCGCGCACCACCAAGATCAGCCAG
AAGCTGGTGCTGCTTCCCGAGACGGAACAGCAGGATGAAGAGACTGCAGACGACGAGGTGGAGAGCGAGTCGGTG
CTTGCGAGGAGGGTGGTGCAGGACGAGGAGGCGGGCCCACTGCGAGACGAGGAGCTGGATGTGCTCAAGAAGAGG
GGAGGAATACGGGGCAAAAGCTACGCAGAACGGCTTCCCAAGATGCAGCGAAAGGACAAGATCAGCCGGCTGACT
GCCTACTGCACGGCGCAGGCCTTCAAGGTGGAGGCGACGTCTGAGTTTGTACGAAAGAGGCACGAGGCCAAGACG
AAGCTGTACGATGACTGCCTGTACGCCATTTATGCGCTTCCGCTGCTCAACGGCACCGACGGCTACCGCGTGCGC
GGCCGGCCGATGCTCAAGACGCCGGGGACGGGCAAGACGGTGCTAGACTTGGAGATTGAGCGGACGGAGCAGCGG
GACCATCAGCAGGGATACTTTGAAGACGACGCCTACAGCACGCCCGAGAGCCCAGAGCGGGCAGCACGGGGCTCG
GGCTCGACGTCGTTTGGGGAGGAGGAGCCGCGACGCGAGGCTCAGGAGGAGCTGCCATCACACATGAACCGACTG
GCTCCCGACGGCAAGAATTTTGCTGAGCTGTTTGTCTTTTCATATGGGGTTGTTGTGTTTTGGAACTTTACGGAG
CACCAGGAAAAGGACATTTTGGCCGACTTGACGTTTGCCGACGCGGAAGACGCCATGAGCCTCATGACAGGGCCG
CTGGAGCAGGACGACTATGAGACGGAGGAATTCCACTTTGAGTACAGCGCGTATGTGAAGCGGCCGCGCGTCTTC
AACGACATGATTACGCTGCTGCCGCGGTCGGACCACATGATTAAGCTGACGATTAGCCATGCCATTGCGCAGAGC
ACCAAGCTGTGTTTTTTTGAGGAGCGCATGAGCGAGACGATGCTGGATGCGCAAGACGTGCCCAAGAAGCTGGCG
CTGACGGGGCAGCTCAACATGACGAGGACGGCCATTGTCAAGATACTGGGGCGGCTGTTCAAGAGCCGCGTGGAC
ATTAATCTGTCATCCAACATTCTCGACGTGCCCAACTTCTTCTGGGACTCGGAGCCGACGCTGCACCCGCTCTAC
GAGGCGGTGCGCGAGTACCTGGAAATCGACCCGCGCATCAAGGTGCTGAATGAGCGGTGCCGCGTCTTTCTCGAC
CTGGCAGAGATCTTGTCCGACTCGGTGGCCGACGCCAAAATGAGCAACATTACATGGATCGTTATTGTGCTCATT
GTGGTGAGCATCCTGGTGACGGTGACCGAGGTTGGTCTGCGCTTTGGCATGCTGAGCAAGAAGCCGGCGGCCGGA
GTCGGGTGCAAGGGGCTGGCCAGTTGCGTCGCCGGGCCTCCCGCTGCTGCCGGGCTGCCGGACCCGGCCCGCATC
GGCCCATTGGCCCATGATGCAGCCTGGCCCGACGACAGCTTTGAGGCGCTTGCCCTTGTGCTTGGGCTGCGCGCA
AACGCCACCGTGGGCGACTTTCGCAGCACCATTGACCGCTTGCAGCGCCTGGCGGCTTCCTGCAGCGCCTGA
Transcript >OphauB2|4492
ATGTCTTCCAGCAAACAACAGAGACCATCAGTCCTTGTGACGGACTCGAGACAAAGACGAGCACCACGGCGCCCA
GACCCGACAAGCGGCACGTCGTCACGCACGCCAATACGATTCATGACGGTCGACAACGTCCTCCAGTACAACTCA
CAGATTCCATCCGGCCAGCCACGAGGGCCGCCAGCGGCTGCTACCAGGCCTCTTGCGGCAATGAGCCGTCGTGTC
TCGGCCGGCGGCCTTGCCAACCTCCAGTCGCGGACGGGCCAGTCAATGCCGTCGCGCACCACCAAGATCAGCCAG
AAGCTGGTGCTGCTTCCCGAGACGGAACAGCAGGATGAAGAGACTGCAGACGACGAGGTGGAGAGCGAGTCGGTG
CTTGCGAGGAGGGTGGTGCAGGACGAGGAGGCGGGCCCACTGCGAGACGAGGAGCTGGATGTGCTCAAGAAGAGG
GGAGGAATACGGGGCAAAAGCTACGCAGAACGGCTTCCCAAGATGCAGCGAAAGGACAAGATCAGCCGGCTGACT
GCCTACTGCACGGCGCAGGCCTTCAAGGTGGAGGCGACGTCTGAGTTTGTACGAAAGAGGCACGAGGCCAAGACG
AAGCTGTACGATGACTGCCTGTACGCCATTTATGCGCTTCCGCTGCTCAACGGCACCGACGGCTACCGCGTGCGC
GGCCGGCCGATGCTCAAGACGCCGGGGACGGGCAAGACGGTGCTAGACTTGGAGATTGAGCGGACGGAGCAGCGG
GACCATCAGCAGGGATACTTTGAAGACGACGCCTACAGCACGCCCGAGAGCCCAGAGCGGGCAGCACGGGGCTCG
GGCTCGACGTCGTTTGGGGAGGAGGAGCCGCGACGCGAGGCTCAGGAGGAGCTGCCATCACACATGAACCGACTG
GCTCCCGACGGCAAGAATTTTGCTGAGCTGTTTGTCTTTTCATATGGGGTTGTTGTGTTTTGGAACTTTACGGAG
CACCAGGAAAAGGACATTTTGGCCGACTTGACGTTTGCCGACGCGGAAGACGCCATGAGCCTCATGACAGGGCCG
CTGGAGCAGGACGACTATGAGACGGAGGAATTCCACTTTGAGTACAGCGCGTATGTGAAGCGGCCGCGCGTCTTC
AACGACATGATTACGCTGCTGCCGCGGTCGGACCACATGATTAAGCTGACGATTAGCCATGCCATTGCGCAGAGC
ACCAAGCTGTGTTTTTTTGAGGAGCGCATGAGCGAGACGATGCTGGATGCGCAAGACGTGCCCAAGAAGCTGGCG
CTGACGGGGCAGCTCAACATGACGAGGACGGCCATTGTCAAGATACTGGGGCGGCTGTTCAAGAGCCGCGTGGAC
ATTAATCTGTCATCCAACATTCTCGACGTGCCCAACTTCTTCTGGGACTCGGAGCCGACGCTGCACCCGCTCTAC
GAGGCGGTGCGCGAGTACCTGGAAATCGACCCGCGCATCAAGGTGCTGAATGAGCGGTGCCGCGTCTTTCTCGAC
CTGGCAGAGATCTTGTCCGACTCGGTGGCCGACGCCAAAATGAGCAACATTACATGGATCGTTATTGTGCTCATT
GTGGTGAGCATCCTGGTGACGGTGACCGAGGTTGGTCTGCGCTTTGGCATGCTGAGCAAGAAGCCGGCGGCCGGA
GTCGGGTGCAAGGGGCTGGCCAGTTGCGTCGCCGGGCCTCCCGCTGCTGCCGGGCTGCCGGACCCGGCCCGCATC
GGCCCATTGGCCCATGATGCAGCCTGGCCCGACGACAGCTTTGAGGCGCTTGCCCTTGTGCTTGGGCTGCGCGCA
AACGCCACCGTGGGCGACTTTCGCAGCACCATTGACCGCTTGCAGCGCCTGGCGGCTTCCTGCAGCGCCTGA
Gene >OphauB2|4492
ATGTCTTCCAGCAAACAACAGAGACCATCAGTCCTTGTGAGTCGCATTCTATAGAGGCTCTCGCAGCAGTTGCAG
GCCTGTTGACGCACAGGCCTCCAGGTGACGGACTCGAGACAAAGACGAGCACCACGGCGCCCAGACCCGACAAGC
GGCACGTCGTCACGCACGCCAATACGATTCATGACGGTCGACAACGTCCTCCAGTACAACTCACAGATTCCATCC
GGCCAGCCACGAGGGCCGCCAGCGGCTGCTACCAGGCCTCTTGCGGCAATGAGCCGTCGTGTCTCGGCCGGCGGC
CTTGCCAACCTCCAGTCGCGGACGGGCCAGTCAATGCCGTCGCGCACCACCAAGATCAGCCAGAAGCTGGTGCTG
CTTCCCGAGACGGAACAGCAGGATGAAGAGACTGCAGACGACGAGGTGGAGAGCGAGTCGGTGCTTGCGAGGAGG
GTGGTGCAGGACGAGGAGGCGGGCCCACTGCGAGACGAGGAGCTGGATGTGCTCAAGAAGAGGGGAGGAATACGG
GGCAAAAGCTACGCAGAACGGCTTCCCAAGATGCAGCGAAAGGACAAGATCAGCCGGCTGACTGCCTACTGCACG
GCGCAGGCCTTCAAGGTGGAGGCGACGTCTGAGTTTGTACGAAAGAGGCACGAGGCCAAGACGAAGCTGTACGAT
GACTGCCTGTACGCCATTTATGCGCTTCCGCTGCTCAACGGCACCGACGGCTACCGCGTGCGCGGCCGGCCGATG
CTCAAGACGCCGGGGACGGGCAAGACGGTGCTAGACTTGGAGATTGAGCGGACGGAGCAGCGGGACCATCAGCAG
GGATACTTTGAAGACGACGCCTACAGCACGCCCGAGAGCCCAGAGCGGGCAGCACGGGGCTCGGGCTCGACGTCG
TTTGGGGAGGAGGAGCCGCGACGCGAGGCTCAGGAGGAGCTGCCATCACACATGAACCGACTGGCTCCCGACGGC
AAGAATTTTGCTGAGCTGTTTGTCTTTTCATATGGGGTTGTTGTGTTTTGGAACTTTACGGAGCACCAGGAAAAG
GACATTTTGGCCGACTTGACGTTTGCCGACGCGGAAGACGCCATGAGCCTCATGACAGGGCCGCTGGAGCAGGAC
GACTATGAGACGGAGGAATTCCACTTTGAGTACAGCGCGTATGTGAAGCGGCCGCGCGTCTTCAACGACATGATT
ACGCTGCTGCCGCGGTCGGACCACATGATTAAGCTGACGATTAGCCATGCCATTGCGCAGAGCACCAAGCTGTGT
TTTTTTGAGGAGCGCATGAGCGAGACGATGCTGGATGCGCAAGACGTGCCCAAGAAGCTGGCGCTGACGGGGCAG
CTCAACATGACGAGGACGGCCATTGTCAAGATACTGGGGCGGCTGTTCAAGAGCCGCGTGGACATTAATCTGTGT
AGGGGCCAATCTCGAGTGCTTGTCTTTTTGGCAGTGGGTAAAGAAAGACTGGGTTGGCAGTGGCTGACTAGTAGT
GGCACAGCATCCAACATTCTCGACGTGCCCAACTTCTTCTGGGACTCGGAGCCGACGCTGCACCCGCTCTACGAG
GCGGTGCGCGAGTACCTGGAAATCGACCCGCGCATCAAGGTGCTGAATGAGCGGTGCCGCGTCTTTCTCGACCTG
GCAGAGATCTTGTCCGACTCGGTGGCCGACGCCAAAATGAGCAACATTACATGGATCGTTATTGTGCTCATTGTG
GTGAGCATCCTGGTGACGGTGACCGAGGTTGGTCTGCGCTTTGGCATGCTGAGCAAGAAGCCGGCGGCCGGAGTC
GGGTGCAAGGGGCTGGCCAGTTGCGTCGCCGGGCCTCCCGCTGCTGCCGGGCTGCCGGACCCGGCCCGCATCGGC
CCATTGGCCCATGATGCAGCCTGGCCCGACGACAGCTTTGAGGCGCTTGCCCTTGTGCTTGGGCTGCGCGCAAAC
GCCACCGTGGGCGACTTTCGCAGCACCATTGACCGCTTGCAGCGCCTGGCGGCTTCCTGCAGCGCCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail