Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|4487
Gene name
LocationContig_3:286997..288239
Strand+
Gene length (bp)1242
Transcript length (bp)1089
Coding sequence length (bp)1089
Protein length (aa) 363

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00615 RGS Regulator of G protein signaling domain 3.3E-10 40 239

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q9P7S8|RAX1_SCHPO Protein rax1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rax1 PE=3 SV=1 22 362 7.0E-51
sp|Q08760|RAX1_YEAST Bud site selection protein RAX1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RAX1 PE=1 SV=1 18 362 2.0E-35

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 19 0.45

Transmembrane Domains

Domain # Start End Length
1 250 272 22
2 284 303 19
3 336 358 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|4487
MTEHEMSSPQSPLSDPTRNRLPTLFEVLSRRTLPPVDLFSFYIYMRDQQRSVDYLDFWLDVAQHMSLCRHYVREL
RRSVLVATPDMEKTGSKRSSTILENIGDIEPRMAGPSMYATDKEKSQDAQMSAFLREDQTHESPASGSGAVRPSP
QFSNSRDVTDSNSPAHTVARQDIRASAEKILYTFLLPGAEREITLPGSITQDVTTAIEDHGRDDPEVFDVAKDYV
FQAMERDAFPGFLRMKALGNLIPPTLVMRLIVGLVSLFSAFWAAFVLIFLDKSRATKCWLILPFTVGVYFLASYQ
YSLDPIIAMIGFSEYTPFNFSRIREPYVRRLLAKRAAMVLAITILIVAALCVLFILVPGKRL*
Coding >OphauB2|4487
ATGACTGAACACGAAATGTCGTCACCTCAGTCGCCGCTGTCGGATCCGACGAGAAATCGACTGCCCACGCTCTTT
GAAGTATTGAGTCGTCGCACTCTTCCGCCAGTCGATTTATTTTCCTTTTATATTTATATGCGTGACCAGCAGCGG
TCGGTCGACTATCTAGACTTTTGGCTCGATGTAGCCCAACACATGTCCTTGTGCCGCCACTATGTGCGCGAGCTA
CGACGGTCTGTTCTCGTGGCCACGCCTGATATGGAAAAGACGGGCTCTAAGCGATCCTCGACAATACTGGAAAAC
ATTGGCGATATCGAGCCCCGCATGGCCGGCCCTTCAATGTACGCGACAGACAAGGAAAAGAGTCAAGATGCTCAA
ATGTCTGCCTTTCTCCGCGAAGATCAAACTCACGAGTCACCTGCAAGCGGTTCTGGTGCCGTTCGACCAAGTCCG
CAATTTAGTAATTCGCGCGACGTGACCGATTCCAACTCTCCCGCTCACACAGTCGCGCGTCAAGATATTCGAGCC
TCGGCTGAGAAGATTTTGTACACGTTTCTCCTGCCTGGAGCAGAGCGCGAAATCACGCTTCCAGGATCCATTACA
CAGGACGTTACCACTGCCATTGAGGACCATGGACGCGACGACCCAGAGGTATTTGATGTGGCCAAGGACTATGTC
TTTCAGGCCATGGAACGCGATGCCTTTCCTGGATTTTTACGCATGAAGGCACTGGGCAACTTGATTCCTCCGACG
CTTGTTATGCGCCTGATTGTCGGACTCGTCTCGCTATTTAGTGCCTTTTGGGCAGCCTTTGTTCTCATCTTCCTC
GACAAGTCGCGTGCTACCAAGTGCTGGCTAATACTGCCCTTTACTGTTGGCGTCTATTTCCTGGCCTCGTATCAA
TACTCTCTGGACCCAATCATTGCCATGATTGGCTTTAGCGAGTACACGCCATTCAACTTTTCGCGGATAAGGGAG
CCATATGTCCGACGTCTGTTGGCCAAGCGAGCCGCCATGGTTTTGGCTATTACGATACTCATTGTCGCCGCCCTA
TGTGTCCTCTTTATCCTCGTGCCTGGAAAGAGACTCTAG
Transcript >OphauB2|4487
ATGACTGAACACGAAATGTCGTCACCTCAGTCGCCGCTGTCGGATCCGACGAGAAATCGACTGCCCACGCTCTTT
GAAGTATTGAGTCGTCGCACTCTTCCGCCAGTCGATTTATTTTCCTTTTATATTTATATGCGTGACCAGCAGCGG
TCGGTCGACTATCTAGACTTTTGGCTCGATGTAGCCCAACACATGTCCTTGTGCCGCCACTATGTGCGCGAGCTA
CGACGGTCTGTTCTCGTGGCCACGCCTGATATGGAAAAGACGGGCTCTAAGCGATCCTCGACAATACTGGAAAAC
ATTGGCGATATCGAGCCCCGCATGGCCGGCCCTTCAATGTACGCGACAGACAAGGAAAAGAGTCAAGATGCTCAA
ATGTCTGCCTTTCTCCGCGAAGATCAAACTCACGAGTCACCTGCAAGCGGTTCTGGTGCCGTTCGACCAAGTCCG
CAATTTAGTAATTCGCGCGACGTGACCGATTCCAACTCTCCCGCTCACACAGTCGCGCGTCAAGATATTCGAGCC
TCGGCTGAGAAGATTTTGTACACGTTTCTCCTGCCTGGAGCAGAGCGCGAAATCACGCTTCCAGGATCCATTACA
CAGGACGTTACCACTGCCATTGAGGACCATGGACGCGACGACCCAGAGGTATTTGATGTGGCCAAGGACTATGTC
TTTCAGGCCATGGAACGCGATGCCTTTCCTGGATTTTTACGCATGAAGGCACTGGGCAACTTGATTCCTCCGACG
CTTGTTATGCGCCTGATTGTCGGACTCGTCTCGCTATTTAGTGCCTTTTGGGCAGCCTTTGTTCTCATCTTCCTC
GACAAGTCGCGTGCTACCAAGTGCTGGCTAATACTGCCCTTTACTGTTGGCGTCTATTTCCTGGCCTCGTATCAA
TACTCTCTGGACCCAATCATTGCCATGATTGGCTTTAGCGAGTACACGCCATTCAACTTTTCGCGGATAAGGGAG
CCATATGTCCGACGTCTGTTGGCCAAGCGAGCCGCCATGGTTTTGGCTATTACGATACTCATTGTCGCCGCCCTA
TGTGTCCTCTTTATCCTCGTGCCTGGAAAGAGACTCTAG
Gene >OphauB2|4487
ATGACTGAACACGAAATGTCGTCACCTCAGTCGCCGCTGTCGGATCCGACGAGAAATCGACTGCCCACGCTCTTT
GAAGTATTGAGTCGTCGCACTCTTCCGCCAGTCGATTTATTTTCCTTTTATATTTATATGCGTGACCAGCAGCGG
TCGGTCGACTATCTAGACTTTTGGTGCGTCACCTGGCTCGCTGCTACTTTACTTGTTGGCACTTGTGGGCAGACA
GTGTACTGACTTGCCTTGGTTTGCAGGCTCGATGTAGCCCAACACATGTCCTTGTGCCGCCACTATGTGCGCGAG
CTACGACGGTCTGTTCTCGTGGCCACGCCTGATATGGAAAAGACGGGCTCTAAGCGATCCTCGACAATACTGGAA
AACATTGGCGATATCGAGCCCCGCATGGCCGGCCCTTCAATGTACGCGACAGACAAGGAAAAGAGTCAAGATGCT
CAAATGTCTGCCTTTCTCCGCGAAGATCAAACTCACGAGTCACCTGCAAGCGGTTCTGGTGCCGTTCGACCAAGT
CCGCAATTTAGTAATTCGCGCGACGTGACCGATTCCAACTCTCCCGCTCACACAGTCGCGCGTCAAGATATTCGA
GCCTCGGCTGAGAAGATTTTGTACACGTTTCTCCTGCCTGGAGCAGAGCGCGAAATCACGCTTCCAGGATCCATT
ACACAGGACGTTACCACTGCCATTGAGGACCATGGACGCGACGACCCAGAGGTATTTGATGTGGCCAAGGACTAT
GTCTTTCAGGCCATGGAACGCGATGCCTTTCCTGGATTTTTACGCATGAAGGCACTGGGCAACTTGATTCCTCCG
ACGCTTGTTATGCGCCTGATTGTCGGACTCGTCTCGCTATTTAGTGCCTTTTGGGCAGCCTTTGTTCTCATCTTC
CTCGACAAGTCGCGTGCTACCAAGTGCTGGGTAAGTTGCTTCTATTCTCGGCCATTTTGAGAGTGGACAAATAGA
CCTGGAAATACTAACAAGAGCCACGCAAAGCTAATACTGCCCTTTACTGTTGGCGTCTATTTCCTGGCCTCGTAT
CAATACTCTCTGGACCCAATCATTGCCATGATTGGCTTTAGCGAGTACACGCCATTCAACTTTTCGCGGATAAGG
GAGCCATATGTCCGACGTCTGTTGGCCAAGCGAGCCGCCATGGTTTTGGCTATTACGATACTCATTGTCGCCGCC
CTATGTGTCCTCTTTATCCTCGTGCCTGGAAAGAGACTCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail