Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|4482
Gene name
LocationContig_3:279762..280845
Strand-
Gene length (bp)1083
Transcript length (bp)1017
Coding sequence length (bp)1017
Protein length (aa) 339

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00581 Rhodanese Rhodanese-like domain 9.9E-10 215 324

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q08686|THTR_YEAST Thiosulfate sulfurtransferase TUM1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TUM1 PE=1 SV=1 61 329 2.0E-66
sp|Q99J99|THTM_MOUSE 3-mercaptopyruvate sulfurtransferase OS=Mus musculus GN=Mpst PE=1 SV=3 38 337 1.0E-62
sp|P97532|THTM_RAT 3-mercaptopyruvate sulfurtransferase OS=Rattus norvegicus GN=Mpst PE=1 SV=3 38 337 3.0E-62
sp|Q9USJ1|THTM_SCHPO Probable 3-mercaptopyruvate sulfurtransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tum1 PE=1 SV=2 61 337 3.0E-62
sp|P25325|THTM_HUMAN 3-mercaptopyruvate sulfurtransferase OS=Homo sapiens GN=MPST PE=1 SV=3 33 338 3.0E-62
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q08686|THTR_YEAST Thiosulfate sulfurtransferase TUM1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TUM1 PE=1 SV=1 61 329 2.0E-66
sp|Q99J99|THTM_MOUSE 3-mercaptopyruvate sulfurtransferase OS=Mus musculus GN=Mpst PE=1 SV=3 38 337 1.0E-62
sp|P97532|THTM_RAT 3-mercaptopyruvate sulfurtransferase OS=Rattus norvegicus GN=Mpst PE=1 SV=3 38 337 3.0E-62
sp|Q9USJ1|THTM_SCHPO Probable 3-mercaptopyruvate sulfurtransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tum1 PE=1 SV=2 61 337 3.0E-62
sp|P25325|THTM_HUMAN 3-mercaptopyruvate sulfurtransferase OS=Homo sapiens GN=MPST PE=1 SV=3 33 338 3.0E-62
sp|O64530|STR1_ARATH Thiosulfate/3-mercaptopyruvate sulfurtransferase 1, mitochondrial OS=Arabidopsis thaliana GN=STR1 PE=1 SV=1 59 326 5.0E-51
sp|P52196|THTR_MOUSE Thiosulfate sulfurtransferase OS=Mus musculus GN=Tst PE=1 SV=3 38 338 6.0E-49
sp|P24329|THTR_RAT Thiosulfate sulfurtransferase OS=Rattus norvegicus GN=Tst PE=1 SV=3 38 337 1.0E-48
sp|P25324|THTR_CHICK Thiosulfate sulfurtransferase OS=Gallus gallus GN=TST PE=1 SV=1 34 329 3.0E-48
sp|P00586|THTR_BOVIN Thiosulfate sulfurtransferase OS=Bos taurus GN=TST PE=1 SV=3 34 338 5.0E-48
sp|P46635|THTR_CRIGR Thiosulfate sulfurtransferase OS=Cricetulus griseus GN=TST PE=2 SV=2 38 337 3.0E-47
sp|Q24JL3|STR2_ARATH Thiosulfate/3-mercaptopyruvate sulfurtransferase 2 OS=Arabidopsis thaliana GN=STR2 PE=1 SV=1 59 324 5.0E-47
sp|Q16762|THTR_HUMAN Thiosulfate sulfurtransferase OS=Homo sapiens GN=TST PE=1 SV=4 34 338 3.0E-46
sp|P58388|THTM_ECO57 3-mercaptopyruvate sulfurtransferase OS=Escherichia coli O157:H7 GN=sseA PE=3 SV=2 76 326 5.0E-45
sp|P31142|THTM_ECOLI 3-mercaptopyruvate sulfurtransferase OS=Escherichia coli (strain K12) GN=sseA PE=1 SV=3 76 326 5.0E-45
sp|D4GYM0|THTR_HALVD Putative thiosulfate sulfurtransferase OS=Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2) GN=tssA PE=1 SV=1 80 338 1.0E-21
sp|Q9I452|THTM_PSEAE Probable 3-mercaptopyruvate sulfurtransferase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=sseA PE=3 SV=1 70 323 2.0E-19
sp|A0R4C9|THTR_MYCS2 Putative thiosulfate sulfurtransferase OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=MSMEG_5789 PE=1 SV=1 95 328 2.0E-18
sp|P52197|THTR_AZOVI Thiosulfate sulfurtransferase OS=Azotobacter vinelandii GN=rhdA PE=1 SV=1 82 325 4.0E-18
sp|P9WHF8|THTR_MYCTO Putative thiosulfate sulfurtransferase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=cysA1 PE=3 SV=1 95 328 5.0E-17
sp|P59989|THTR1_MYCBO Putative thiosulfate sulfurtransferase 1 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=cysA1 PE=3 SV=1 95 328 5.0E-17
sp|P9WHF9|THTR_MYCTU Putative thiosulfate sulfurtransferase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=cysA1 PE=1 SV=1 95 328 5.0E-17
sp|P71121|THTR_CORGL Thiosulfate sulfurtransferase OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=thtR PE=3 SV=2 65 327 2.0E-15
sp|Q9RXT9|THTR_DEIRA Thiosulfate sulfurtransferase OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=DR_0217 PE=1 SV=1 79 328 2.0E-15
sp|Q7TWT6|THT2_MYCBO Putative thiosulfate sulfurtransferase SseA OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=sseA PE=3 SV=1 65 327 3.0E-14
sp|P9WHF7|THT2_MYCTU Putative thiosulfate sulfurtransferase SseA OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=sseA PE=1 SV=1 65 327 3.0E-14
sp|P9WHF6|THT2_MYCTO Putative thiosulfate sulfurtransferase SseA OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=sseA PE=3 SV=1 65 327 3.0E-14
sp|Q50036|THTR_MYCLE Putative thiosulfate sulfurtransferase OS=Mycobacterium leprae (strain TN) GN=cysA PE=3 SV=1 95 328 8.0E-14
sp|P46700|THT2_MYCLE Putative thiosulfate sulfurtransferase SseA OS=Mycobacterium leprae (strain TN) GN=sseA PE=3 SV=1 112 327 2.0E-13
sp|P16385|THTR_SACER Putative thiosulfate sulfurtransferase OS=Saccharopolyspora erythraea GN=cysA PE=1 SV=1 115 337 3.0E-13
sp|Q7TX80|THTR2_MYCBO Putative thiosulfate sulfurtransferase 2 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=cysA2 PE=3 SV=1 95 292 2.0E-12
sp|P9WHF5|THT3_MYCTU Putative thiosulfate sulfurtransferase SseB OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=sseB PE=1 SV=1 38 324 3.0E-12
sp|P9WHF4|THT3_MYCTO Putative thiosulfate sulfurtransferase SseB OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=sseB PE=3 SV=1 38 324 3.0E-12
sp|O26719|THTR_METTH Putative thiosulfate sulfurtransferase OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=MTH_622 PE=3 SV=1 59 325 4.0E-11
sp|P27477|THTR_SYNE7 Putative thiosulfate sulfurtransferase OS=Synechococcus elongatus (strain PCC 7942) GN=rhdA PE=1 SV=1 106 331 2.0E-10
sp|O17730|THT2_CAEEL Putative thiosulfate sulfurtransferase mpst-1 OS=Caenorhabditis elegans GN=mpst-1 PE=3 SV=1 86 326 8.0E-08
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 14 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|4482
MASVVFASRAGRAAFPKWRLGKPLGFSATCRRNLSSYLVSPAELHEALKKNPPSPISTDPRVIPLCASWFLPNDG
RTGIQVFREQRIPKARFFDLDKVIDKRSPYPHMLPDAKRFAAAMSELGIHKDDVVVVYDSKELGIFSAPRVGWTL
KVFGHPRVHLLNNFKLWVEQDLPTESGELYSVDCCPYPIPAMETDNVATFEDVKQVASDHNKEGAEGVQIVDARS
QGRFSGQAPEPREGLSSGHMPGSINLPYTAVLDEKTKAYPSSQKLREIFKGAGLDPEKPIVTTCGTGVTACVVDA
ALDVAEFGSPEKRKVYDGSWTEWAQRVGPTENLIRKGN*
Coding >OphauB2|4482
ATGGCTTCCGTCGTCTTTGCAAGCCGCGCAGGGCGGGCAGCTTTTCCGAAATGGAGACTCGGCAAGCCTCTGGGG
TTCTCAGCAACTTGTCGACGCAATCTGTCGTCTTATCTCGTCAGCCCGGCTGAGCTTCACGAGGCTCTCAAGAAG
AATCCTCCGTCGCCAATAAGCACTGATCCTCGAGTCATTCCTCTCTGCGCAAGCTGGTTCCTCCCCAACGATGGC
CGGACAGGAATCCAAGTCTTTCGCGAACAGCGCATTCCCAAAGCTCGCTTTTTTGATCTAGACAAGGTGATTGAC
AAGCGCAGCCCGTATCCTCACATGCTGCCAGATGCGAAGCGCTTTGCTGCAGCCATGAGCGAGCTGGGCATCCAC
AAGGACGATGTAGTGGTTGTCTACGACAGCAAAGAACTAGGCATCTTTAGTGCACCGCGAGTTGGCTGGACGCTC
AAGGTCTTTGGGCACCCGAGGGTCCATCTTCTCAACAACTTCAAGCTGTGGGTGGAGCAAGACCTCCCGACAGAA
TCAGGAGAGCTATACAGCGTTGACTGCTGTCCATACCCCATACCCGCCATGGAAACAGACAATGTGGCCACTTTT
GAAGACGTCAAGCAGGTGGCATCGGATCATAACAAGGAGGGCGCCGAAGGTGTGCAAATTGTAGATGCACGGTCT
CAAGGACGATTTAGTGGCCAAGCGCCAGAGCCCCGAGAGGGTCTTTCCTCGGGACACATGCCGGGATCCATCAAT
CTTCCCTACACTGCCGTCTTGGATGAGAAAACCAAGGCGTACCCTTCGTCGCAAAAGCTTCGAGAGATTTTCAAG
GGCGCAGGTCTCGATCCTGAAAAGCCCATTGTCACAACCTGTGGCACTGGCGTGACTGCCTGTGTCGTCGACGCT
GCTCTCGACGTGGCAGAATTTGGCTCTCCCGAGAAACGCAAGGTCTATGATGGAAGCTGGACTGAATGGGCCCAA
CGCGTTGGGCCAACAGAGAACCTGATCCGGAAGGGAAATTGA
Transcript >OphauB2|4482
ATGGCTTCCGTCGTCTTTGCAAGCCGCGCAGGGCGGGCAGCTTTTCCGAAATGGAGACTCGGCAAGCCTCTGGGG
TTCTCAGCAACTTGTCGACGCAATCTGTCGTCTTATCTCGTCAGCCCGGCTGAGCTTCACGAGGCTCTCAAGAAG
AATCCTCCGTCGCCAATAAGCACTGATCCTCGAGTCATTCCTCTCTGCGCAAGCTGGTTCCTCCCCAACGATGGC
CGGACAGGAATCCAAGTCTTTCGCGAACAGCGCATTCCCAAAGCTCGCTTTTTTGATCTAGACAAGGTGATTGAC
AAGCGCAGCCCGTATCCTCACATGCTGCCAGATGCGAAGCGCTTTGCTGCAGCCATGAGCGAGCTGGGCATCCAC
AAGGACGATGTAGTGGTTGTCTACGACAGCAAAGAACTAGGCATCTTTAGTGCACCGCGAGTTGGCTGGACGCTC
AAGGTCTTTGGGCACCCGAGGGTCCATCTTCTCAACAACTTCAAGCTGTGGGTGGAGCAAGACCTCCCGACAGAA
TCAGGAGAGCTATACAGCGTTGACTGCTGTCCATACCCCATACCCGCCATGGAAACAGACAATGTGGCCACTTTT
GAAGACGTCAAGCAGGTGGCATCGGATCATAACAAGGAGGGCGCCGAAGGTGTGCAAATTGTAGATGCACGGTCT
CAAGGACGATTTAGTGGCCAAGCGCCAGAGCCCCGAGAGGGTCTTTCCTCGGGACACATGCCGGGATCCATCAAT
CTTCCCTACACTGCCGTCTTGGATGAGAAAACCAAGGCGTACCCTTCGTCGCAAAAGCTTCGAGAGATTTTCAAG
GGCGCAGGTCTCGATCCTGAAAAGCCCATTGTCACAACCTGTGGCACTGGCGTGACTGCCTGTGTCGTCGACGCT
GCTCTCGACGTGGCAGAATTTGGCTCTCCCGAGAAACGCAAGGTCTATGATGGAAGCTGGACTGAATGGGCCCAA
CGCGTTGGGCCAACAGAGAACCTGATCCGGAAGGGAAATTGA
Gene >OphauB2|4482
ATGGCTTCCGTCGTCTTTGCAAGCCGCGCAGGGCGGGCAGCTTTTCCGAAATGGAGACTCGGCAAGCCTCTGGGG
TTCTCAGCAACTTGTCGACGCAATCTGTCGTCTTATCTCGTCAGCCCGGCTGAGCTTCACGAGGCTCTCAAGAAG
AATCCTCCGTCGCCAATAAGCACTGATCCTCGAGTCATTCCTCTCTGCGCAAGCTGGTTCCTCCCCAACGATGGC
CGGACAGGAATCCAAGTCTTTCGCGAACAGCGCATTCCCAAAGCTCGCTTTTTTGATCTAGACAAGGTGATTGAC
AAGCGCAGCCCGTATCCTCACATGCTGCCAGATGCGAAGCGCTTTGCTGCAGCCATGAGCGAGCTGGGCATCCAC
AAGGACGATGTAGTGGTTGTCTACGACAGCAAAGAACTAGGCATCTTTAGTGCACCGCGAGTTGGCTGGACGCTC
AAGGTCTTTGGGCACCCGAGGGTCCATCTTCTCAACAACTTCAAGCTGTGGGTGGAGCAAGACCTCCCGACAGAA
TCAGGAGAGCTATACAGCGTTGACTGCTGTCCATACCCCATACCCGCCATGGAAACAGACAATGTGGCCACTTTT
GAAGACGTCAAGCAGGTGGCATCGGATCATAACAAGGAGGGCGCCGAAGGTGTGCAAATTGTAGATGCACGGTCT
CAAGGACGATTTAGTGGCCAAGCGCCAGAGCCCCGAGAGGGTCTTTCCTCGGGACACATGCCGGGATCCATCAAT
CTTCCCTACACTGCCGTCTTGGATGAGAAAACCAAGGCGTACCCTTCGTCGCAAAAGCTTCGAGAGATTTTCAAG
GGCGCAGGTCTCGATCCTGAAAAGCCCATTGTCACAACCTGTGGCACTGGCGTGACTGCCTGTGTCGTCGACGCT
GCTCTCGACGTGGCAGAATTTGGCTCTCCCGAGAAACGCAAGGTCTATGATGGAAGCTGGACGTGAGTACTTTTG
ACGAGTATATCTGCTGGGAGTATTTGCAAGTCTGCTGATACTTGAGATGCCAGTGAATGGGCCCAACGCGTTGGG
CCAACAGAGAACCTGATCCGGAAGGGAAATTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail