Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|4477
Gene name
LocationContig_3:257935..259790
Strand+
Gene length (bp)1855
Transcript length (bp)1728
Coding sequence length (bp)1728
Protein length (aa) 576

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01545 Cation_efflux Cation efflux family 1.6E-49 17 418

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P20107|ZRC1_YEAST Zinc/cadmium resistance protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ZRC1 PE=1 SV=2 12 169 3.0E-48
sp|P32798|COT1_YEAST Cobalt uptake protein COT1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=COT1 PE=1 SV=2 11 239 1.0E-43
sp|O13918|ZHF1_SCHPO Zinc homeostasis factor 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=zhf1 PE=2 SV=3 11 233 5.0E-40
sp|P32798|COT1_YEAST Cobalt uptake protein COT1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=COT1 PE=1 SV=2 265 543 7.0E-39
sp|P20107|ZRC1_YEAST Zinc/cadmium resistance protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ZRC1 PE=1 SV=2 330 502 4.0E-36
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P20107|ZRC1_YEAST Zinc/cadmium resistance protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ZRC1 PE=1 SV=2 12 169 3.0E-48
sp|P32798|COT1_YEAST Cobalt uptake protein COT1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=COT1 PE=1 SV=2 11 239 1.0E-43
sp|O13918|ZHF1_SCHPO Zinc homeostasis factor 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=zhf1 PE=2 SV=3 11 233 5.0E-40
sp|P32798|COT1_YEAST Cobalt uptake protein COT1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=COT1 PE=1 SV=2 265 543 7.0E-39
sp|P20107|ZRC1_YEAST Zinc/cadmium resistance protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ZRC1 PE=1 SV=2 330 502 4.0E-36
sp|Q54T06|Y8206_DICDI Probable zinc transporter protein DDB_G0282067 OS=Dictyostelium discoideum GN=DDB_G0282067 PE=2 SV=1 352 544 2.0E-33
sp|O13918|ZHF1_SCHPO Zinc homeostasis factor 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=zhf1 PE=2 SV=3 352 501 1.0E-32
sp|Q3UVU3|ZNT10_MOUSE Zinc transporter 10 OS=Mus musculus GN=Slc30a10 PE=1 SV=1 12 201 3.0E-30
sp|Q6XR72|ZNT10_HUMAN Zinc transporter 10 OS=Homo sapiens GN=SLC30A10 PE=1 SV=2 12 138 9.0E-29
sp|Q3UVU3|ZNT10_MOUSE Zinc transporter 10 OS=Mus musculus GN=Slc30a10 PE=1 SV=1 353 545 8.0E-27
sp|Q60738|ZNT1_MOUSE Zinc transporter 1 OS=Mus musculus GN=Slc30a1 PE=1 SV=1 344 544 1.0E-24
sp|Q6XR72|ZNT10_HUMAN Zinc transporter 10 OS=Homo sapiens GN=SLC30A10 PE=1 SV=2 353 545 2.0E-24
sp|Q4R6K2|ZNT1_MACFA Zinc transporter 1 OS=Macaca fascicularis GN=SLC30A1 PE=2 SV=1 321 565 2.0E-24
sp|Q9Y6M5|ZNT1_HUMAN Zinc transporter 1 OS=Homo sapiens GN=SLC30A1 PE=1 SV=3 352 565 3.0E-24
sp|Q62720|ZNT1_RAT Zinc transporter 1 OS=Rattus norvegicus GN=Slc30a1 PE=2 SV=1 318 544 7.0E-24
sp|Q60738|ZNT1_MOUSE Zinc transporter 1 OS=Mus musculus GN=Slc30a1 PE=1 SV=1 10 144 1.0E-23
sp|Q62720|ZNT1_RAT Zinc transporter 1 OS=Rattus norvegicus GN=Slc30a1 PE=2 SV=1 10 144 2.0E-23
sp|Q9Y6M5|ZNT1_HUMAN Zinc transporter 1 OS=Homo sapiens GN=SLC30A1 PE=1 SV=3 10 149 3.0E-23
sp|Q4R6K2|ZNT1_MACFA Zinc transporter 1 OS=Macaca fascicularis GN=SLC30A1 PE=2 SV=1 10 149 4.0E-23
sp|Q95QW4|CDF1_CAEEL Cation diffusion facilitator family protein 1 OS=Caenorhabditis elegans GN=cdf-1 PE=1 SV=1 11 172 5.0E-21
sp|Q54T06|Y8206_DICDI Probable zinc transporter protein DDB_G0282067 OS=Dictyostelium discoideum GN=DDB_G0282067 PE=2 SV=1 11 142 3.0E-20
sp|Q8R4H9|ZNT5_MOUSE Zinc transporter 5 OS=Mus musculus GN=Slc30a5 PE=1 SV=1 11 147 3.0E-20
sp|Q8H329|MTP8_ORYSJ Metal tolerance protein 8 OS=Oryza sativa subsp. japonica GN=MTP8 PE=2 SV=2 343 505 3.0E-20
sp|Q8TAD4|ZNT5_HUMAN Zinc transporter 5 OS=Homo sapiens GN=SLC30A5 PE=1 SV=1 11 146 1.0E-19
sp|Q6DG36|ZNT5_DANRE Zinc transporter 5 OS=Danio rerio GN=slc30a5 PE=2 SV=1 13 146 2.0E-19
sp|Q54F34|Y1141_DICDI Probable zinc transporter protein DDB_G0291141 OS=Dictyostelium discoideum GN=DDB_G0291141 PE=3 SV=1 13 134 3.0E-19
sp|Q5ZLF4|ZNT5_CHICK Zinc transporter 5 OS=Gallus gallus GN=SLC30A5 PE=2 SV=1 13 146 5.0E-19
sp|Q8H329|MTP8_ORYSJ Metal tolerance protein 8 OS=Oryza sativa subsp. japonica GN=MTP8 PE=2 SV=2 12 138 2.0E-18
sp|Q5MNV6|ZNT7_CHICK Zinc transporter 7 OS=Gallus gallus GN=SLC30A7 PE=2 SV=1 1 138 2.0E-18
sp|Q28CE7|ZNT5_XENTR Zinc transporter 5 OS=Xenopus tropicalis GN=slc30a5 PE=2 SV=1 13 146 2.0E-18
sp|Q9SI03|MTP12_ARATH Metal tolerance protein 12 OS=Arabidopsis thaliana GN=MTP12 PE=3 SV=1 12 136 6.0E-18
sp|A4IFD7|ZNT7_BOVIN Zinc transporter 7 OS=Bos taurus GN=SLC30A7 PE=2 SV=1 13 175 7.0E-18
sp|A5PMX1|ZNT7_DANRE Zinc transporter 7 OS=Danio rerio GN=slc30a7 PE=2 SV=1 12 138 2.0E-17
sp|Q5BJM8|ZNT7_RAT Zinc transporter 7 OS=Rattus norvegicus GN=Slc30a7 PE=2 SV=2 13 158 2.0E-17
sp|Q8NEW0|ZNT7_HUMAN Zinc transporter 7 OS=Homo sapiens GN=SLC30A7 PE=2 SV=1 13 175 2.0E-17
sp|A7Z1S6|CZCD_BACMF Cadmium, cobalt and zinc/H(+)-K(+) antiporter OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=czcD PE=3 SV=1 2 140 2.0E-17
sp|Q9JKN1|ZNT7_MOUSE Zinc transporter 7 OS=Mus musculus GN=Slc30a7 PE=1 SV=1 13 155 5.0E-17
sp|Q52KD7|ZNT7A_XENLA Zinc transporter 7-A OS=Xenopus laevis GN=slc30a7-a PE=2 SV=1 11 138 7.0E-17
sp|Q6NRI1|ZNT7B_XENLA Zinc transporter 7-B OS=Xenopus laevis GN=slc30a7-b PE=2 SV=1 11 138 2.0E-16
sp|Q8Z8B6|ZITB_SALTI Zinc transporter ZitB OS=Salmonella typhi GN=zitB PE=3 SV=1 11 138 3.0E-16
sp|Q8ZGY6|ZITB_YERPE Zinc transporter ZitB OS=Yersinia pestis GN=zitB PE=3 SV=1 11 138 3.0E-16
sp|O07084|CZCD_BACSU Cadmium, cobalt and zinc/H(+)-K(+) antiporter OS=Bacillus subtilis (strain 168) GN=czcD PE=1 SV=1 17 133 3.0E-16
sp|Q2HJ10|ZNT2_MOUSE Zinc transporter 2 OS=Mus musculus GN=Slc30a2 PE=2 SV=1 15 150 5.0E-16
sp|Q66D85|ZITB_YERPS Zinc transporter ZitB OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=zitB PE=3 SV=1 11 138 1.0E-15
sp|Q95QW4|CDF1_CAEEL Cation diffusion facilitator family protein 1 OS=Caenorhabditis elegans GN=cdf-1 PE=1 SV=1 340 501 3.0E-15
sp|Q54QU8|Y3629_DICDI Probable zinc transporter protein DDB_G0283629 OS=Dictyostelium discoideum GN=DDB_G0283629 PE=3 SV=1 20 138 4.0E-15
sp|Q9HGQ3|CIS4_SCHPO Probable zinc transporter cis4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cis4 PE=1 SV=1 12 134 5.0E-15
sp|Q8Z8B6|ZITB_SALTI Zinc transporter ZitB OS=Salmonella typhi GN=zitB PE=3 SV=1 347 501 2.0E-14
sp|Q8ZQT3|ZITB_SALTY Zinc transporter ZitB OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=zitB PE=3 SV=1 347 501 2.0E-14
sp|Q8ZQT3|ZITB_SALTY Zinc transporter ZitB OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=zitB PE=3 SV=1 11 138 2.0E-14
sp|Q8X400|ZITB_ECO57 Zinc transporter ZitB OS=Escherichia coli O157:H7 GN=zitB PE=3 SV=1 11 138 2.0E-14
sp|Q54QU8|Y3629_DICDI Probable zinc transporter protein DDB_G0283629 OS=Dictyostelium discoideum GN=DDB_G0283629 PE=3 SV=1 352 510 3.0E-14
sp|Q8ZGY6|ZITB_YERPE Zinc transporter ZitB OS=Yersinia pestis GN=zitB PE=3 SV=1 347 501 6.0E-14
sp|Q83SA2|ZITB_SHIFL Zinc transporter ZitB OS=Shigella flexneri GN=zitB PE=3 SV=1 11 156 6.0E-14
sp|P75757|ZITB_ECOLI Zinc transporter ZitB OS=Escherichia coli (strain K12) GN=zitB PE=1 SV=1 11 156 6.0E-14
sp|Q66D85|ZITB_YERPS Zinc transporter ZitB OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=zitB PE=3 SV=1 347 501 7.0E-14
sp|Q8BGG0|ZNT8_MOUSE Zinc transporter 8 OS=Mus musculus GN=Slc30a8 PE=2 SV=1 347 521 1.0E-13
sp|Q6D7E5|ZITB_PECAS Zinc transporter ZitB OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=zitB PE=3 SV=1 347 520 1.0E-13
sp|Q5XHB4|ZNT8_XENTR Zinc transporter 8 OS=Xenopus tropicalis GN=slc30a8 PE=2 SV=1 21 166 5.0E-13
sp|Q5XHB4|ZNT8_XENTR Zinc transporter 8 OS=Xenopus tropicalis GN=slc30a8 PE=2 SV=1 332 500 5.0E-13
sp|Q5I020|ZNT8_XENLA Zinc transporter 8 OS=Xenopus laevis GN=slc30a8 PE=2 SV=1 21 166 8.0E-13
sp|O55174|ZNT4_RAT Zinc transporter 4 OS=Rattus norvegicus GN=Slc30a4 PE=2 SV=1 341 498 8.0E-13
sp|Q5I020|ZNT8_XENLA Zinc transporter 8 OS=Xenopus laevis GN=slc30a8 PE=2 SV=1 332 500 1.0E-12
sp|O55174|ZNT4_RAT Zinc transporter 4 OS=Rattus norvegicus GN=Slc30a4 PE=2 SV=1 14 148 1.0E-12
sp|Q688R1|MTP1_ORYSJ Metal tolerance protein 1 OS=Oryza sativa subsp. japonica GN=MTP1 PE=2 SV=1 340 500 1.0E-12
sp|Q08E25|ZNT3_BOVIN Zinc transporter 3 OS=Bos taurus GN=SLC30A3 PE=2 SV=1 352 500 2.0E-12
sp|P0CE46|ZNT8_RAT Zinc transporter 8 OS=Rattus norvegicus GN=Slc30a8 PE=1 SV=1 347 521 2.0E-12
sp|Q62941|ZNT2_RAT Zinc transporter 2 OS=Rattus norvegicus GN=Slc30a2 PE=2 SV=1 346 500 3.0E-12
sp|A7Z1S6|CZCD_BACMF Cadmium, cobalt and zinc/H(+)-K(+) antiporter OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=czcD PE=3 SV=1 347 511 4.0E-12
sp|O35149|ZNT4_MOUSE Zinc transporter 4 OS=Mus musculus GN=Slc30a4 PE=1 SV=2 341 500 4.0E-12
sp|Q2HJ10|ZNT2_MOUSE Zinc transporter 2 OS=Mus musculus GN=Slc30a2 PE=2 SV=1 332 500 5.0E-12
sp|O35149|ZNT4_MOUSE Zinc transporter 4 OS=Mus musculus GN=Slc30a4 PE=1 SV=2 14 148 5.0E-12
sp|O07084|CZCD_BACSU Cadmium, cobalt and zinc/H(+)-K(+) antiporter OS=Bacillus subtilis (strain 168) GN=czcD PE=1 SV=1 347 511 7.0E-12
sp|O14863|ZNT4_HUMAN Zinc transporter 4 OS=Homo sapiens GN=SLC30A4 PE=2 SV=2 12 137 7.0E-12
sp|Q8IWU4|ZNT8_HUMAN Zinc transporter 8 OS=Homo sapiens GN=SLC30A8 PE=1 SV=2 344 506 9.0E-12
sp|Q54F34|Y1141_DICDI Probable zinc transporter protein DDB_G0291141 OS=Dictyostelium discoideum GN=DDB_G0291141 PE=3 SV=1 353 498 1.0E-11
sp|Q99726|ZNT3_HUMAN Zinc transporter 3 OS=Homo sapiens GN=SLC30A3 PE=1 SV=2 352 500 2.0E-11
sp|Q5R617|ZNT3_PONAB Zinc transporter 3 OS=Pongo abelii GN=SLC30A3 PE=2 SV=1 352 500 3.0E-11
sp|Q55E98|Y9332_DICDI Probable zinc transporter protein DDB_G0269332 OS=Dictyostelium discoideum GN=DDB_G0269332 PE=3 SV=1 16 138 4.0E-11
sp|Q9SI03|MTP12_ARATH Metal tolerance protein 12 OS=Arabidopsis thaliana GN=MTP12 PE=3 SV=1 358 500 5.0E-11
sp|P13512|CZCD_CUPMC Metal cation efflux system protein CzcD OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) GN=czcD PE=1 SV=2 345 502 6.0E-11
sp|P94178|CZCD_ALCSC Cation efflux system protein CzcD OS=Alcaligenes sp. (strain CT14) GN=czcD PE=3 SV=1 345 502 6.0E-11
sp|Q6DBM8|MTPB_ARATH Metal tolerance protein B OS=Arabidopsis thaliana GN=MTPB PE=2 SV=1 344 500 8.0E-11
sp|Q9M271|MTPA1_ARATH Metal tolerance protein A1 OS=Arabidopsis thaliana GN=MTPA1 PE=2 SV=1 360 500 9.0E-11
sp|Q9BRI3|ZNT2_HUMAN Zinc transporter 2 OS=Homo sapiens GN=SLC30A2 PE=1 SV=1 347 500 9.0E-11
sp|Q62941|ZNT2_RAT Zinc transporter 2 OS=Rattus norvegicus GN=Slc30a2 PE=2 SV=1 22 135 1.0E-10
sp|Q8R4H9|ZNT5_MOUSE Zinc transporter 5 OS=Mus musculus GN=Slc30a5 PE=1 SV=1 354 500 2.0E-10
sp|Q03455|MSC2_YEAST Probable zinc transporter MSC2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MSC2 PE=1 SV=2 11 165 2.0E-10
sp|Q6QIX3|ZNT3_RAT Zinc transporter 3 OS=Rattus norvegicus GN=Slc30a3 PE=1 SV=1 347 500 2.0E-10
sp|Q9ZT63|MTP1_ARATH Metal tolerance protein 1 OS=Arabidopsis thaliana GN=MTP1 PE=1 SV=2 15 138 4.0E-10
sp|Q9ZT63|MTP1_ARATH Metal tolerance protein 1 OS=Arabidopsis thaliana GN=MTP1 PE=1 SV=2 352 500 4.0E-10
sp|O14863|ZNT4_HUMAN Zinc transporter 4 OS=Homo sapiens GN=SLC30A4 PE=2 SV=2 347 512 6.0E-10
sp|P97441|ZNT3_MOUSE Zinc transporter 3 OS=Mus musculus GN=Slc30a3 PE=1 SV=1 352 500 7.0E-10
sp|Q8TAD4|ZNT5_HUMAN Zinc transporter 5 OS=Homo sapiens GN=SLC30A5 PE=1 SV=1 355 500 2.0E-09
sp|Q6DG36|ZNT5_DANRE Zinc transporter 5 OS=Danio rerio GN=slc30a5 PE=2 SV=1 355 500 2.0E-09
sp|Q5MNV6|ZNT7_CHICK Zinc transporter 7 OS=Gallus gallus GN=SLC30A7 PE=2 SV=1 355 465 2.0E-09
sp|Q6NRI1|ZNT7B_XENLA Zinc transporter 7-B OS=Xenopus laevis GN=slc30a7-b PE=2 SV=1 355 464 3.0E-09
sp|Q6D7E5|ZITB_PECAS Zinc transporter ZitB OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=zitB PE=3 SV=1 12 138 3.0E-09
sp|Q6ICY4|MTPC2_ARATH Metal tolerance protein C2 OS=Arabidopsis thaliana GN=MTPC2 PE=2 SV=1 15 160 3.0E-09
sp|Q6P3N9|ZNT7_XENTR Zinc transporter 7 OS=Xenopus tropicalis GN=slc30a7 PE=2 SV=1 355 464 5.0E-09
sp|Q8NEW0|ZNT7_HUMAN Zinc transporter 7 OS=Homo sapiens GN=SLC30A7 PE=2 SV=1 355 465 8.0E-09
sp|Q99726|ZNT3_HUMAN Zinc transporter 3 OS=Homo sapiens GN=SLC30A3 PE=1 SV=2 30 147 9.0E-09
sp|Q5R617|ZNT3_PONAB Zinc transporter 3 OS=Pongo abelii GN=SLC30A3 PE=2 SV=1 30 148 9.0E-09
sp|Q9LXS1|MTPA2_ARATH Metal tolerance protein A2 OS=Arabidopsis thaliana GN=MTPA2 PE=2 SV=2 360 500 9.0E-09
sp|Q5ZLF4|ZNT5_CHICK Zinc transporter 5 OS=Gallus gallus GN=SLC30A5 PE=2 SV=1 355 500 1.0E-08
sp|A4IFD7|ZNT7_BOVIN Zinc transporter 7 OS=Bos taurus GN=SLC30A7 PE=2 SV=1 355 465 1.0E-08
sp|Q08E25|ZNT3_BOVIN Zinc transporter 3 OS=Bos taurus GN=SLC30A3 PE=2 SV=1 30 147 1.0E-08
sp|Q688R1|MTP1_ORYSJ Metal tolerance protein 1 OS=Oryza sativa subsp. japonica GN=MTP1 PE=2 SV=1 15 138 2.0E-08
sp|Q9JKN1|ZNT7_MOUSE Zinc transporter 7 OS=Mus musculus GN=Slc30a7 PE=1 SV=1 355 465 3.0E-08
sp|Q28CE7|ZNT5_XENTR Zinc transporter 5 OS=Xenopus tropicalis GN=slc30a5 PE=2 SV=1 351 500 4.0E-08
sp|Q52KD7|ZNT7A_XENLA Zinc transporter 7-A OS=Xenopus laevis GN=slc30a7-a PE=2 SV=1 355 464 4.0E-08
sp|Q5BJM8|ZNT7_RAT Zinc transporter 7 OS=Rattus norvegicus GN=Slc30a7 PE=2 SV=2 355 465 5.0E-08
sp|P13512|CZCD_CUPMC Metal cation efflux system protein CzcD OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) GN=czcD PE=1 SV=2 16 138 8.0E-08
sp|P94178|CZCD_ALCSC Cation efflux system protein CzcD OS=Alcaligenes sp. (strain CT14) GN=czcD PE=3 SV=1 16 138 9.0E-08
sp|A5PMX1|ZNT7_DANRE Zinc transporter 7 OS=Danio rerio GN=slc30a7 PE=2 SV=1 355 465 1.0E-07
sp|Q8X400|ZITB_ECO57 Zinc transporter ZitB OS=Escherichia coli O157:H7 GN=zitB PE=3 SV=1 347 501 1.0E-07
sp|P75757|ZITB_ECOLI Zinc transporter ZitB OS=Escherichia coli (strain K12) GN=zitB PE=1 SV=1 347 501 1.0E-07
sp|Q83SA2|ZITB_SHIFL Zinc transporter ZitB OS=Shigella flexneri GN=zitB PE=3 SV=1 347 510 3.0E-07
sp|Q6QIX3|ZNT3_RAT Zinc transporter 3 OS=Rattus norvegicus GN=Slc30a3 PE=1 SV=1 21 161 3.0E-07
sp|Q9HGQ3|CIS4_SCHPO Probable zinc transporter cis4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cis4 PE=1 SV=1 358 465 6.0E-07
sp|Q6P0D1|ZNT6_DANRE Zinc transporter 6 OS=Danio rerio GN=slc30a6 PE=2 SV=1 38 133 9.0E-07
sp|Q9M271|MTPA1_ARATH Metal tolerance protein A1 OS=Arabidopsis thaliana GN=MTPA1 PE=2 SV=1 19 138 1.0E-06
sp|P97441|ZNT3_MOUSE Zinc transporter 3 OS=Mus musculus GN=Slc30a3 PE=1 SV=1 30 161 1.0E-06
sp|P0CE46|ZNT8_RAT Zinc transporter 8 OS=Rattus norvegicus GN=Slc30a8 PE=1 SV=1 26 147 2.0E-06
sp|Q8BGG0|ZNT8_MOUSE Zinc transporter 8 OS=Mus musculus GN=Slc30a8 PE=2 SV=1 26 153 4.0E-06
sp|Q8IWU4|ZNT8_HUMAN Zinc transporter 8 OS=Homo sapiens GN=SLC30A8 PE=1 SV=2 26 145 5.0E-06
sp|Q6AZN8|ZNT6A_XENLA Zinc transporter 6-A OS=Xenopus laevis GN=slc30a6-a PE=2 SV=1 21 148 6.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0055085 transmembrane transport Yes
GO:0008324 cation transmembrane transporter activity Yes
GO:0006812 cation transport Yes
GO:0008150 biological_process No
GO:0006811 ion transport No
GO:0006810 transport No
GO:0005575 cellular_component No
GO:0051234 establishment of localization No
GO:0031224 intrinsic component of membrane No
GO:0110165 cellular anatomical entity No
GO:0015075 ion transmembrane transporter activity No
GO:0005215 transporter activity No
GO:0051179 localization No
GO:0003674 molecular_function No
GO:0009987 cellular process No
GO:0022857 transmembrane transporter activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 38 0.5

Transmembrane Domains

Domain # Start End Length
1 20 42 22
2 47 66 19
3 87 109 22
4 119 141 22
5 359 381 22
6 396 418 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|4477
MAGSSNKWTWSKSTRIKVMLVIDTAFFLLELISGLLAHSLALTADAFHMLNDIISLVIGLWAVVAAQKETTDAFT
FGWVRAEILGAFFNAVFLIALCVSILLEALTRFIEPPEINNPRLILIVGCAGLVSNLLGFVVLGGHGHSHGNDDD
HAGHDHGGHSHSNQEADLEQGRPSRPQAGHTAGTSDAANDVSTEGSEATRRIRFQGDAAQQDASAAKGSRSSGKG
RRRRQSSKSGHSRFASIEDMSIHPASFRQDIIAASLAASSNTPGQASDTSDDSAVAESDAEAGENSPLLKGSKGP
SHGATDSKSRGPCSGFISKKRRSRRDSSVHDGHHHTLPRQPGSKASGHSHADMGMNAMVLHVIGDALGNVGVIIT
GLIIWLTNWPGKIYADPAVSLIITAIILKTSVPLTLATARVLLQATPDHISIREIRQDIERLPGVVSCHHIHVWQ
LSDTKVVASLHLQVSFPINSHSGEKYMQLAKRARKCLHGYGIHSATIQPEFCLDKNHRHDQDTAALALDGPATNI
GDNACLLACIDDCKAPACCPGQDASSKASSTRRGSESSLEGGSHAGHRHS*
Coding >OphauB2|4477
ATGGCCGGCTCTTCCAACAAGTGGACGTGGTCCAAGAGCACGCGCATCAAGGTTATGCTCGTCATTGATACCGCC
TTTTTCTTACTCGAGCTTATCTCTGGATTACTTGCCCATTCGCTCGCTCTGACGGCCGATGCCTTTCATATGCTC
AACGACATCATATCTCTTGTCATTGGTCTCTGGGCTGTTGTGGCTGCACAAAAGGAAACGACGGATGCCTTCACC
TTTGGGTGGGTGCGCGCTGAAATCCTCGGTGCCTTCTTCAATGCCGTCTTCCTGATTGCTCTTTGCGTTTCAATT
CTTCTCGAGGCGCTCACCCGCTTCATCGAACCCCCCGAGATTAACAATCCGAGACTCATTCTAATTGTCGGATGC
GCCGGCCTCGTCTCCAACCTGCTAGGCTTCGTCGTTCTCGGCGGCCACGGTCACTCGCATGGAAACGACGATGAC
CACGCCGGCCATGACCATGGCGGTCACTCGCATTCTAATCAAGAGGCTGATCTTGAGCAAGGCCGACCCAGCAGA
CCTCAAGCTGGCCACACGGCTGGCACTTCTGATGCCGCTAATGACGTGTCGACAGAAGGCTCCGAGGCGACTCGC
CGCATTCGCTTCCAGGGTGACGCTGCCCAGCAAGACGCATCGGCCGCCAAGGGCAGTCGCTCGTCTGGCAAGGGC
CGGCGTCGGCGCCAGTCTAGTAAGAGTGGACACTCGCGCTTCGCTAGCATTGAAGACATGAGCATTCACCCAGCG
AGCTTCCGGCAGGATATTATTGCTGCCAGCCTTGCCGCCTCGTCTAACACTCCGGGCCAGGCTAGTGATACTAGC
GACGACTCAGCCGTGGCCGAGTCGGATGCTGAGGCTGGAGAGAATTCGCCCCTCCTCAAGGGCTCCAAAGGCCCA
AGCCATGGCGCCACGGATAGCAAGTCTCGCGGCCCCTGCTCGGGCTTCATTTCCAAGAAGCGTCGGTCCCGCAGA
GACTCTAGCGTTCACGACGGACATCATCATACGCTGCCTCGCCAGCCCGGTTCCAAAGCTAGTGGCCATAGCCAT
GCCGACATGGGCATGAATGCCATGGTGCTCCATGTCATTGGCGATGCTTTGGGCAACGTGGGCGTCATCATTACC
GGCCTCATTATCTGGCTCACCAATTGGCCCGGCAAGATCTATGCTGACCCTGCTGTCTCGCTCATCATTACGGCC
ATTATTCTCAAGACGTCTGTTCCCCTTACCCTTGCCACTGCCAGGGTCCTACTCCAGGCCACTCCCGATCACATC
AGCATTCGGGAGATTCGACAGGACATTGAGAGACTGCCTGGAGTCGTTAGCTGCCACCATATCCATGTATGGCAG
CTGTCTGACACAAAGGTGGTGGCCAGTCTTCATCTTCAAGTATCATTTCCCATCAATTCTCATAGCGGCGAAAAA
TACATGCAGCTTGCCAAGCGGGCTAGGAAGTGCCTCCATGGCTACGGCATTCATAGCGCCACGATTCAGCCGGAA
TTTTGTCTGGATAAGAATCACCGGCACGACCAAGACACAGCGGCTCTTGCACTAGATGGACCAGCCACCAATATT
GGCGACAATGCCTGCTTGCTGGCATGTATTGACGACTGCAAGGCGCCCGCCTGCTGTCCTGGCCAGGATGCATCC
TCCAAGGCGTCGTCGACTCGCAGAGGTAGCGAATCTTCGCTCGAAGGCGGCTCCCATGCAGGCCATCGACACTCG
TAG
Transcript >OphauB2|4477
ATGGCCGGCTCTTCCAACAAGTGGACGTGGTCCAAGAGCACGCGCATCAAGGTTATGCTCGTCATTGATACCGCC
TTTTTCTTACTCGAGCTTATCTCTGGATTACTTGCCCATTCGCTCGCTCTGACGGCCGATGCCTTTCATATGCTC
AACGACATCATATCTCTTGTCATTGGTCTCTGGGCTGTTGTGGCTGCACAAAAGGAAACGACGGATGCCTTCACC
TTTGGGTGGGTGCGCGCTGAAATCCTCGGTGCCTTCTTCAATGCCGTCTTCCTGATTGCTCTTTGCGTTTCAATT
CTTCTCGAGGCGCTCACCCGCTTCATCGAACCCCCCGAGATTAACAATCCGAGACTCATTCTAATTGTCGGATGC
GCCGGCCTCGTCTCCAACCTGCTAGGCTTCGTCGTTCTCGGCGGCCACGGTCACTCGCATGGAAACGACGATGAC
CACGCCGGCCATGACCATGGCGGTCACTCGCATTCTAATCAAGAGGCTGATCTTGAGCAAGGCCGACCCAGCAGA
CCTCAAGCTGGCCACACGGCTGGCACTTCTGATGCCGCTAATGACGTGTCGACAGAAGGCTCCGAGGCGACTCGC
CGCATTCGCTTCCAGGGTGACGCTGCCCAGCAAGACGCATCGGCCGCCAAGGGCAGTCGCTCGTCTGGCAAGGGC
CGGCGTCGGCGCCAGTCTAGTAAGAGTGGACACTCGCGCTTCGCTAGCATTGAAGACATGAGCATTCACCCAGCG
AGCTTCCGGCAGGATATTATTGCTGCCAGCCTTGCCGCCTCGTCTAACACTCCGGGCCAGGCTAGTGATACTAGC
GACGACTCAGCCGTGGCCGAGTCGGATGCTGAGGCTGGAGAGAATTCGCCCCTCCTCAAGGGCTCCAAAGGCCCA
AGCCATGGCGCCACGGATAGCAAGTCTCGCGGCCCCTGCTCGGGCTTCATTTCCAAGAAGCGTCGGTCCCGCAGA
GACTCTAGCGTTCACGACGGACATCATCATACGCTGCCTCGCCAGCCCGGTTCCAAAGCTAGTGGCCATAGCCAT
GCCGACATGGGCATGAATGCCATGGTGCTCCATGTCATTGGCGATGCTTTGGGCAACGTGGGCGTCATCATTACC
GGCCTCATTATCTGGCTCACCAATTGGCCCGGCAAGATCTATGCTGACCCTGCTGTCTCGCTCATCATTACGGCC
ATTATTCTCAAGACGTCTGTTCCCCTTACCCTTGCCACTGCCAGGGTCCTACTCCAGGCCACTCCCGATCACATC
AGCATTCGGGAGATTCGACAGGACATTGAGAGACTGCCTGGAGTCGTTAGCTGCCACCATATCCATGTATGGCAG
CTGTCTGACACAAAGGTGGTGGCCAGTCTTCATCTTCAAGTATCATTTCCCATCAATTCTCATAGCGGCGAAAAA
TACATGCAGCTTGCCAAGCGGGCTAGGAAGTGCCTCCATGGCTACGGCATTCATAGCGCCACGATTCAGCCGGAA
TTTTGTCTGGATAAGAATCACCGGCACGACCAAGACACAGCGGCTCTTGCACTAGATGGACCAGCCACCAATATT
GGCGACAATGCCTGCTTGCTGGCATGTATTGACGACTGCAAGGCGCCCGCCTGCTGTCCTGGCCAGGATGCATCC
TCCAAGGCGTCGTCGACTCGCAGAGGTAGCGAATCTTCGCTCGAAGGCGGCTCCCATGCAGGCCATCGACACTCG
TAG
Gene >OphauB2|4477
ATGGCCGGCTCTTCCAACAAGTGGACGTGGTCCAAGAGCACGCGCATCAAGGTTATGCTCGTCATTGATACCGCC
TTTTTCTTACTCGAGCTTATCTCTGGATTACTTGCCCATTCGCTCGCTCTGACGGCCGATGCCTTTCATATGGTG
CGCCTCCCTCGCTTCGCCTTTTGTTTCATTTGCCCTGCTGACTGTCGTCTGCTCCCTCGCCTCGCAGCTCAACGA
CATCATATCTCTTGTCATTGGTCTCTGGGCTGTTGTGGCTGCACAAAAGGAAACGACGGATGCCTTCACCTTTGG
GGTAAGTTGCACCCAAACCCGCTGTCAGGCAACCTTGAGCTAATTGTTCTTGTCGCAGTGGGTGCGCGCTGAAAT
CCTCGGTGCCTTCTTCAATGCCGTCTTCCTGATTGCTCTTTGCGTTTCAATTCTTCTCGAGGCGCTCACCCGCTT
CATCGAACCCCCCGAGATTAACAATCCGAGACTCATTCTAATTGTCGGATGCGCCGGCCTCGTCTCCAACCTGCT
AGGCTTCGTCGTTCTCGGCGGCCACGGTCACTCGCATGGAAACGACGATGACCACGCCGGCCATGACCATGGCGG
TCACTCGCATTCTAATCAAGAGGCTGATCTTGAGCAAGGCCGACCCAGCAGACCTCAAGCTGGCCACACGGCTGG
CACTTCTGATGCCGCTAATGACGTGTCGACAGAAGGCTCCGAGGCGACTCGCCGCATTCGCTTCCAGGGTGACGC
TGCCCAGCAAGACGCATCGGCCGCCAAGGGCAGTCGCTCGTCTGGCAAGGGCCGGCGTCGGCGCCAGTCTAGTAA
GAGTGGACACTCGCGCTTCGCTAGCATTGAAGACATGAGCATTCACCCAGCGAGCTTCCGGCAGGATATTATTGC
TGCCAGCCTTGCCGCCTCGTCTAACACTCCGGGCCAGGCTAGTGATACTAGCGACGACTCAGCCGTGGCCGAGTC
GGATGCTGAGGCTGGAGAGAATTCGCCCCTCCTCAAGGGCTCCAAAGGCCCAAGCCATGGCGCCACGGATAGCAA
GTCTCGCGGCCCCTGCTCGGGCTTCATTTCCAAGAAGCGTCGGTCCCGCAGAGACTCTAGCGTTCACGACGGACA
TCATCATACGCTGCCTCGCCAGCCCGGTTCCAAAGCTAGTGGCCATAGCCATGCCGACATGGGCATGAATGCCAT
GGTGCTCCATGTCATTGGCGATGCTTTGGGCAACGTGGGCGTCATCATTACCGGCCTCATTATCTGGCTCACCAA
TTGGCCCGGCAAGATCTATGCTGACCCTGCTGTCTCGCTCATCATTACGGCCATTATTCTCAAGACGTCTGTTCC
CCTTACCCTTGCCACTGCCAGGGTCCTACTCCAGGCCACTCCCGATCACATCAGCATTCGGGAGATTCGACAGGA
CATTGAGAGACTGCCTGGAGTCGTTAGCTGCCACCATATCCATGTATGGCAGCTGTCTGACACAAAGGTGGTGGC
CAGTCTTCATCTTCAAGTATCATTTCCCATCAATTCTCATAGCGGCGAAAAATACATGCAGCTTGCCAAGCGGGC
TAGGAAGTGCCTCCATGGCTACGGCATTCATAGCGCCACGATTCAGCCGGAATTTTGTCTGGATAAGAATCACCG
GCACGACCAAGACACAGCGGCTCTTGCACTAGATGGACCAGCCACCAATATTGGCGACAATGCCTGCTTGCTGGC
ATGTATTGACGACTGCAAGGCGCCCGCCTGCTGTCCTGGCCAGGATGCATCCTCCAAGGCGTCGTCGACTCGCAG
AGGTAGCGAATCTTCGCTCGAAGGCGGCTCCCATGCAGGCCATCGACACTCGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail