Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|4472
Gene name
LocationContig_3:243116..244388
Strand-
Gene length (bp)1272
Transcript length (bp)1098
Coding sequence length (bp)1098
Protein length (aa) 366

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13489 Methyltransf_23 Methyltransferase domain 1.2E-10 122 282

Swissprot hits

(None)

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup116
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1824
Ophiocordyceps australis 1348a (Ghana) OphauG2|2470
Ophiocordyceps australis map64 (Brazil) OphauB2|3061
Ophiocordyceps australis map64 (Brazil) OphauB2|4472 (this protein)
Ophiocordyceps camponoti-floridani Ophcf2|00879
Ophiocordyceps camponoti-floridani Ophcf2|06995
Ophiocordyceps camponoti-rufipedis Ophun1|5295
Ophiocordyceps camponoti-rufipedis Ophun1|6510
Ophiocordyceps kimflemingae Ophio5|4284
Ophiocordyceps kimflemingae Ophio5|5055
Ophiocordyceps kimflemingae Ophio5|6669
Ophiocordyceps subramaniannii Hirsu2|3221
Ophiocordyceps subramaniannii Hirsu2|38
Ophiocordyceps subramaniannii Hirsu2|7756

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|4472
MRQNRFLSDNDSDADVDDEVASSSFSSTAQDIETSLTPSQSACDTSASDLSAIEHEQDDWVSEQSCGDSTSVPPC
VYEDELVHGRRYHGFRQGLYPLPNDRQEQLREELNHAMMLELTGGRLFYADIGDHPQKIIDIGTGIGSWAIDVAD
RYPSATVIGTDLSAIQPRWVPVNVHMFVDDCEQPDWLHGSNYDLVHFRGMAGVLRNLDGVLATAYPRIKNGGWVE
FHEVVPQILCDDSTMAQDDALCIFYEAAVEGLRTFGCDPLRTAHLEEVLDRAGFTNIRCVVKKIPVSTWSHDQQL
KTLGLLMKGVMLDSLDALAAKPLAALGISPQNRGELIQRVQASLEDWTVHRYVNCCFCYGQKKEQ*
Coding >OphauB2|4472
ATGCGACAAAATCGCTTCTTGTCCGACAACGACTCGGATGCAGATGTCGACGACGAAGTGGCATCCTCCTCGTTT
TCGTCCACGGCACAAGACATCGAAACGAGCCTGACACCGAGTCAGAGTGCCTGTGATACCAGCGCCTCCGACTTG
TCCGCTATAGAGCATGAACAAGATGACTGGGTTTCGGAGCAATCATGTGGAGACTCGACATCGGTACCTCCCTGC
GTATACGAAGACGAGCTAGTCCACGGGCGACGCTATCATGGCTTCCGACAAGGCTTGTACCCTTTGCCTAATGAC
CGACAGGAACAGTTGAGAGAAGAGCTGAATCATGCCATGATGCTGGAGCTGACAGGAGGCCGCCTCTTCTATGCT
GACATTGGCGATCACCCTCAAAAAATCATCGACATTGGAACAGGCATAGGAAGCTGGGCCATTGATGTTGCAGAT
CGATATCCCAGTGCCACCGTCATTGGAACCGATTTGTCTGCCATCCAACCCAGATGGGTTCCAGTCAATGTACAC
ATGTTTGTCGACGACTGCGAGCAACCAGACTGGTTGCACGGATCCAACTATGATCTAGTCCACTTTCGAGGCATG
GCTGGCGTTCTTCGGAACCTTGACGGGGTGCTGGCCACAGCCTATCCACGCATAAAAAACGGGGGCTGGGTAGAG
TTCCATGAGGTTGTGCCCCAGATTCTATGCGATGACAGCACCATGGCACAAGATGATGCGCTGTGCATCTTTTAT
GAAGCCGCCGTCGAAGGCTTGCGCACTTTTGGATGCGATCCCCTGAGAACAGCACATCTCGAAGAGGTACTTGAT
CGCGCAGGCTTCACCAATATCCGTTGTGTCGTTAAAAAGATTCCCGTGTCGACGTGGTCGCACGACCAGCAACTG
AAGACGCTGGGCCTTTTAATGAAGGGCGTCATGCTCGACTCGCTCGATGCTCTGGCAGCAAAGCCCCTGGCAGCC
TTAGGAATCTCGCCTCAAAACCGGGGAGAGCTAATCCAGCGGGTTCAAGCCAGTCTCGAAGACTGGACCGTCCAC
CGCTACGTAAACTGCTGCTTCTGCTATGGGCAGAAGAAGGAGCAGTAA
Transcript >OphauB2|4472
ATGCGACAAAATCGCTTCTTGTCCGACAACGACTCGGATGCAGATGTCGACGACGAAGTGGCATCCTCCTCGTTT
TCGTCCACGGCACAAGACATCGAAACGAGCCTGACACCGAGTCAGAGTGCCTGTGATACCAGCGCCTCCGACTTG
TCCGCTATAGAGCATGAACAAGATGACTGGGTTTCGGAGCAATCATGTGGAGACTCGACATCGGTACCTCCCTGC
GTATACGAAGACGAGCTAGTCCACGGGCGACGCTATCATGGCTTCCGACAAGGCTTGTACCCTTTGCCTAATGAC
CGACAGGAACAGTTGAGAGAAGAGCTGAATCATGCCATGATGCTGGAGCTGACAGGAGGCCGCCTCTTCTATGCT
GACATTGGCGATCACCCTCAAAAAATCATCGACATTGGAACAGGCATAGGAAGCTGGGCCATTGATGTTGCAGAT
CGATATCCCAGTGCCACCGTCATTGGAACCGATTTGTCTGCCATCCAACCCAGATGGGTTCCAGTCAATGTACAC
ATGTTTGTCGACGACTGCGAGCAACCAGACTGGTTGCACGGATCCAACTATGATCTAGTCCACTTTCGAGGCATG
GCTGGCGTTCTTCGGAACCTTGACGGGGTGCTGGCCACAGCCTATCCACGCATAAAAAACGGGGGCTGGGTAGAG
TTCCATGAGGTTGTGCCCCAGATTCTATGCGATGACAGCACCATGGCACAAGATGATGCGCTGTGCATCTTTTAT
GAAGCCGCCGTCGAAGGCTTGCGCACTTTTGGATGCGATCCCCTGAGAACAGCACATCTCGAAGAGGTACTTGAT
CGCGCAGGCTTCACCAATATCCGTTGTGTCGTTAAAAAGATTCCCGTGTCGACGTGGTCGCACGACCAGCAACTG
AAGACGCTGGGCCTTTTAATGAAGGGCGTCATGCTCGACTCGCTCGATGCTCTGGCAGCAAAGCCCCTGGCAGCC
TTAGGAATCTCGCCTCAAAACCGGGGAGAGCTAATCCAGCGGGTTCAAGCCAGTCTCGAAGACTGGACCGTCCAC
CGCTACGTAAACTGCTGCTTCTGCTATGGGCAGAAGAAGGAGCAGTAA
Gene >OphauB2|4472
ATGCGACAAAATCGCTTCTTGTCCGACAACGACTCGGATGCAGATGTCGACGACGAAGTGGCATCCTCCTCGTTT
TCGTCCACGGCACAAGACATCGAAACGAGCCTGACACCGAGTCAGAGTGCCTGTGATACCAGCGCCTCCGACTTG
TCCGCTATAGAGCATGAACAAGATGACTGGGTTTCGGAGCAATCATGTGGAGACTCGACATCGGTACCTCCCTGC
GTATACGAAGACGAGCTAGTCCACGGGCGACGCTATCATGGCTTCCGACAAGGCTTGTACCCTTTGCCTAATGAC
CGACAGGAACAGTTGAGAGAAGAGCTGAATCATGCCATGATGCTGGAGCTGACAGTAAGTAAATATTGTTGGAGA
CGATTTGCCTTTGGATGCTGAGCAATATCATAGGGAGGCCGCCTCTTCTATGCTGACATTGGCGATCACCCTCAA
AAAATCATCGACATTGGAACAGGCATAGGAAGCTGGGCCATTGATGGTACTTGAGAGCCCAGTCAGGTCGGTATC
GTTTGCCTCCAGCCTAACATGATGCAGTTGCAGATCGATATCCCAGTGCCACCGTCATTGGAACCGATTTGTCTG
CCATCCAACCCAGATGGGTTCCAGTCAATGTACACATGTTTGTCGACGACTGCGAGCAACCAGACTGGTTGCACG
GATCCAACTATGATCTAGTCCACTTTCGAGGCATGGCTGGCGTTCTTCGGAACCTTGACGGGGTGCTGGCCACAG
CCTATCCGTGCGTCATGTCTCCCGTGTCTGGCTGCTTCATTATTGGAGCTTAGCTGACAGTAGCAAGACAGACGC
ATAAAAAACGGGGGCTGGGTAGAGTTCCATGAGGTTGTGCCCCAGATTCTATGCGATGACAGCACCATGGCACAA
GATGATGCGCTGTGCATCTTTTATGAAGCCGCCGTCGAAGGCTTGCGCACTTTTGGATGCGATCCCCTGAGAACA
GCACATCTCGAAGAGGTACTTGATCGCGCAGGCTTCACCAATATCCGTTGTGTCGTTAAAAAGATTCCCGTGTCG
ACGTGGTCGCACGACCAGCAACTGAAGACGCTGGGCCTTTTAATGAAGGGCGTCATGCTCGACTCGCTCGATGCT
CTGGCAGCAAAGCCCCTGGCAGCCTTAGGAATCTCGCCTCAAAACCGGGGAGAGCTAATCCAGCGGGTTCAAGCC
AGTCTCGAAGACTGGACCGTCCACCGCTACGTAAACTGCTGCTTCTGCTATGGGCAGAAGAAGGAGCAGTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail