Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|4471
Gene name
LocationContig_3:241789..242584
Strand-
Gene length (bp)795
Transcript length (bp)795
Coding sequence length (bp)795
Protein length (aa) 265

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00642 zf-CCCH Zinc finger C-x8-C-x5-C-x3-H type (and similar) 2.3E-04 89 108
PF00642 zf-CCCH Zinc finger C-x8-C-x5-C-x3-H type (and similar) 2.7E-08 114 138
PF14608 zf-CCCH_2 RNA-binding, Nab2-type zinc finger 1.3E+00 53 68
PF14608 zf-CCCH_2 RNA-binding, Nab2-type zinc finger 5.7E-01 90 108
PF14608 zf-CCCH_2 RNA-binding, Nab2-type zinc finger 3.5E-02 118 137
PF14608 zf-CCCH_2 RNA-binding, Nab2-type zinc finger 3.5E+00 146 165
PF14608 zf-CCCH_2 RNA-binding, Nab2-type zinc finger 1.2E+00 171 186

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q4IPA4|YTH1_GIBZE mRNA 3'-end-processing protein YTH1 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=YTH1 PE=3 SV=2 14 211 9.0E-123
sp|Q7SGR2|YTH1_NEUCR mRNA 3'-end-processing protein yth-1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=yth-1 PE=3 SV=1 6 205 4.0E-90
sp|Q5BGN2|YTH1_EMENI mRNA 3'-end-processing protein yth1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=yth1 PE=3 SV=1 23 203 2.0E-68
sp|Q4WKD9|YTH1_ASPFU mRNA 3'-end-processing protein yth1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=yth1 PE=3 SV=1 11 203 4.0E-67
sp|Q2URI6|YTH1_ASPOR mRNA 3'-end-processing protein yth1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=yth1 PE=3 SV=1 19 206 5.0E-66
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q4IPA4|YTH1_GIBZE mRNA 3'-end-processing protein YTH1 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=YTH1 PE=3 SV=2 14 211 9.0E-123
sp|Q7SGR2|YTH1_NEUCR mRNA 3'-end-processing protein yth-1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=yth-1 PE=3 SV=1 6 205 4.0E-90
sp|Q5BGN2|YTH1_EMENI mRNA 3'-end-processing protein yth1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=yth1 PE=3 SV=1 23 203 2.0E-68
sp|Q4WKD9|YTH1_ASPFU mRNA 3'-end-processing protein yth1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=yth1 PE=3 SV=1 11 203 4.0E-67
sp|Q2URI6|YTH1_ASPOR mRNA 3'-end-processing protein yth1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=yth1 PE=3 SV=1 19 206 5.0E-66
sp|Q59T36|YTH1_CANAL mRNA 3'-end-processing protein YTH1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=YTH1 PE=3 SV=1 18 239 2.0E-61
sp|Q6BTT1|YTH1_DEBHA mRNA 3'-end-processing protein YTH1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=YTH1 PE=3 SV=2 33 236 8.0E-61
sp|Q6CKU1|YTH1_KLULA mRNA 3'-end-processing protein YTH1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=YTH1 PE=3 SV=1 23 206 3.0E-57
sp|Q6C922|YTH1_YARLI mRNA 3'-end-processing protein YTH1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YTH1 PE=3 SV=1 33 226 4.0E-57
sp|Q758T3|YTH1_ASHGO mRNA 3'-end-processing protein YTH1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=YTH1 PE=3 SV=1 23 213 1.0E-55
sp|Q6FTL0|YTH1_CANGA mRNA 3'-end-processing protein YTH1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=YTH1 PE=3 SV=1 23 214 3.0E-55
sp|Q06102|YTH1_YEAST mRNA 3'-end-processing protein YTH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YTH1 PE=1 SV=1 23 236 1.0E-52
sp|Q4P384|YTH1_USTMA mRNA 3'-end-processing protein YTH1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=YTH1 PE=3 SV=1 4 188 2.0E-44
sp|Q9UTD1|YTH1_SCHPO mRNA 3'-end-processing protein yth1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=yth1 PE=3 SV=1 73 205 1.0E-43
sp|O95639|CPSF4_HUMAN Cleavage and polyadenylation specificity factor subunit 4 OS=Homo sapiens GN=CPSF4 PE=1 SV=1 53 193 4.0E-43
sp|O19137|CPSF4_BOVIN Cleavage and polyadenylation specificity factor subunit 4 OS=Bos taurus GN=CPSF4 PE=1 SV=1 53 193 5.0E-43
sp|Q5FVR7|CPSF4_RAT Cleavage and polyadenylation specificity factor subunit 4 OS=Rattus norvegicus GN=Cpsf4 PE=2 SV=1 53 193 6.0E-43
sp|Q66KE3|CPSF4_XENTR Cleavage and polyadenylation specificity factor subunit 4 OS=Xenopus tropicalis GN=cpsf4 PE=2 SV=1 53 193 1.0E-41
sp|Q6DJP7|CPSF4_XENLA Cleavage and polyadenylation specificity factor subunit 4 OS=Xenopus laevis GN=cpsf4 PE=2 SV=1 53 193 2.0E-41
sp|A6NMK7|CPS4L_HUMAN Putative cleavage and polyadenylation specificity factor subunit 4-like protein OS=Homo sapiens GN=CPSF4L PE=2 SV=3 53 197 2.0E-38
sp|Q9VPT8|CPSF4_DROME Cleavage and polyadenylation specificity factor subunit 4 OS=Drosophila melanogaster GN=Clp PE=1 SV=1 62 186 2.0E-36
sp|P0CS64|YTH1_CRYNJ mRNA 3'-end-processing protein YTH1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=YTH1 PE=3 SV=1 89 191 6.0E-32
sp|P0CS65|YTH1_CRYNB mRNA 3'-end-processing protein YTH1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=YTH1 PE=3 SV=1 89 191 6.0E-32
sp|Q8BQZ5|CPSF4_MOUSE Cleavage and polyadenylation specificity factor subunit 4 OS=Mus musculus GN=Cpsf4 PE=2 SV=1 53 193 3.0E-25
sp|Q0DA50|C3H45_ORYSJ Zinc finger CCCH domain-containing protein 45 OS=Oryza sativa subsp. japonica GN=Os06g0677700 PE=3 SV=1 89 167 1.0E-15
sp|A9LNK9|CPSF_ARATH 30-kDa cleavage and polyadenylation specificity factor 30 OS=Arabidopsis thaliana GN=CPSF30 PE=1 SV=1 89 167 1.0E-14
sp|Q8CHP0|ZC3H3_MOUSE Zinc finger CCCH domain-containing protein 3 OS=Mus musculus GN=Zc3h3 PE=1 SV=1 89 187 9.0E-13
sp|Q8IXZ2|ZC3H3_HUMAN Zinc finger CCCH domain-containing protein 3 OS=Homo sapiens GN=ZC3H3 PE=1 SV=3 60 187 1.0E-12
sp|O74823|YBJC_SCHPO Zinc finger CCCH domain-containing protein C337.12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC337.12 PE=3 SV=3 44 187 3.0E-09
sp|Q3ED78|C3H7_ARATH Zinc finger CCCH domain-containing protein 7 OS=Arabidopsis thaliana GN=At1g21570 PE=1 SV=1 89 192 3.0E-09
sp|Q9VSK8|ZC3H3_DROME Zinc finger CCCH domain-containing protein 3 OS=Drosophila melanogaster GN=ZC3H3 PE=1 SV=2 89 206 3.0E-09
sp|Q657B3|C3H7_ORYSJ Zinc finger CCCH domain-containing protein 7 OS=Oryza sativa subsp. japonica GN=Os01g0572100 PE=2 SV=1 53 174 3.0E-08
sp|Q8BYK8|ZC3H6_MOUSE Zinc finger CCCH domain-containing protein 6 OS=Mus musculus GN=Zc3h6 PE=2 SV=2 89 139 4.0E-08
sp|Q8N5P1|ZC3H8_HUMAN Zinc finger CCCH domain-containing protein 8 OS=Homo sapiens GN=ZC3H8 PE=1 SV=2 89 166 1.0E-07
sp|P61129|ZC3H6_HUMAN Zinc finger CCCH domain-containing protein 6 OS=Homo sapiens GN=ZC3H6 PE=2 SV=2 89 137 1.0E-07
sp|Q9JJ48|ZC3H8_MOUSE Zinc finger CCCH domain-containing protein 8 OS=Mus musculus GN=Zc3h8 PE=1 SV=2 89 166 2.0E-07
sp|Q9UPT8|ZC3H4_HUMAN Zinc finger CCCH domain-containing protein 4 OS=Homo sapiens GN=ZC3H4 PE=1 SV=3 88 139 9.0E-06
sp|Q6ZPZ3|ZC3H4_MOUSE Zinc finger CCCH domain-containing protein 4 OS=Mus musculus GN=Zc3h4 PE=1 SV=2 88 139 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0046872 metal ion binding Yes
GO:0003674 molecular_function No
GO:0005488 binding No
GO:0043167 ion binding No
GO:0043169 cation binding No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup6400
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2469
Ophiocordyceps australis map64 (Brazil) OphauB2|4471 (this protein)
Ophiocordyceps camponoti-floridani Ophcf2|03335
Ophiocordyceps camponoti-rufipedis Ophun1|6814

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|4471
MEANSTSSTSTALAKESLASAILGHSAPQIYNFRFSPFLRKAHQVGLAADRPACRAFQTGNCPNGTRCSERHVSD
GKASQPTGGLNSLVCKHWLRGLCKKGEHCEFLHEYNLRKMPECNFFMRNGYCSNGEECLYLHVDPLSRLPPCPHY
DMGFCPLGPLCSKKHVRRKLCVFYLAGFCPDGPDCKLGSHPKWLKDLEKPTVKSDEKKDDDGLRSDLAAQRTEED
GDRGRDSHRDREDGGRFGRHARGAGKWRGGRDRRFRNRH*
Coding >OphauB2|4471
ATGGAGGCAAATTCGACATCAAGCACAAGCACAGCCCTCGCCAAAGAATCACTCGCGTCGGCGATCCTGGGACAC
TCGGCACCACAGATCTACAACTTTCGCTTCTCTCCCTTTCTCCGAAAAGCGCATCAGGTTGGACTGGCAGCAGAC
CGACCGGCATGTCGAGCCTTCCAGACGGGCAATTGTCCCAACGGCACGCGCTGCTCTGAGCGGCACGTGTCGGAT
GGCAAAGCGTCCCAGCCCACAGGAGGACTCAACTCGCTCGTCTGCAAGCACTGGCTTCGCGGTCTATGCAAAAAG
GGCGAGCATTGCGAGTTTTTACACGAGTACAACTTGCGCAAAATGCCCGAGTGCAACTTCTTCATGCGCAATGGC
TACTGCTCCAACGGCGAGGAGTGTTTGTACCTCCACGTCGATCCGCTCTCTCGCTTGCCGCCTTGCCCACACTAC
GACATGGGCTTCTGTCCCCTCGGTCCTCTATGCTCCAAGAAGCATGTCCGCCGAAAGCTGTGCGTCTTTTATCTT
GCCGGCTTCTGCCCTGATGGACCCGACTGCAAGCTGGGCTCACATCCCAAGTGGCTGAAAGACCTTGAGAAGCCT
ACAGTCAAGTCGGATGAGAAGAAGGATGATGATGGCCTGAGAAGTGATCTAGCAGCCCAACGGACAGAAGAAGAC
GGTGATCGTGGCAGGGATAGCCACAGAGATCGCGAGGATGGTGGCAGATTCGGGCGGCACGCAAGAGGCGCTGGA
AAGTGGAGGGGAGGCAGAGACAGACGTTTCAGAAATCGTCACTAG
Transcript >OphauB2|4471
ATGGAGGCAAATTCGACATCAAGCACAAGCACAGCCCTCGCCAAAGAATCACTCGCGTCGGCGATCCTGGGACAC
TCGGCACCACAGATCTACAACTTTCGCTTCTCTCCCTTTCTCCGAAAAGCGCATCAGGTTGGACTGGCAGCAGAC
CGACCGGCATGTCGAGCCTTCCAGACGGGCAATTGTCCCAACGGCACGCGCTGCTCTGAGCGGCACGTGTCGGAT
GGCAAAGCGTCCCAGCCCACAGGAGGACTCAACTCGCTCGTCTGCAAGCACTGGCTTCGCGGTCTATGCAAAAAG
GGCGAGCATTGCGAGTTTTTACACGAGTACAACTTGCGCAAAATGCCCGAGTGCAACTTCTTCATGCGCAATGGC
TACTGCTCCAACGGCGAGGAGTGTTTGTACCTCCACGTCGATCCGCTCTCTCGCTTGCCGCCTTGCCCACACTAC
GACATGGGCTTCTGTCCCCTCGGTCCTCTATGCTCCAAGAAGCATGTCCGCCGAAAGCTGTGCGTCTTTTATCTT
GCCGGCTTCTGCCCTGATGGACCCGACTGCAAGCTGGGCTCACATCCCAAGTGGCTGAAAGACCTTGAGAAGCCT
ACAGTCAAGTCGGATGAGAAGAAGGATGATGATGGCCTGAGAAGTGATCTAGCAGCCCAACGGACAGAAGAAGAC
GGTGATCGTGGCAGGGATAGCCACAGAGATCGCGAGGATGGTGGCAGATTCGGGCGGCACGCAAGAGGCGCTGGA
AAGTGGAGGGGAGGCAGAGACAGACGTTTCAGAAATCGTCACTAG
Gene >OphauB2|4471
ATGGAGGCAAATTCGACATCAAGCACAAGCACAGCCCTCGCCAAAGAATCACTCGCGTCGGCGATCCTGGGACAC
TCGGCACCACAGATCTACAACTTTCGCTTCTCTCCCTTTCTCCGAAAAGCGCATCAGGTTGGACTGGCAGCAGAC
CGACCGGCATGTCGAGCCTTCCAGACGGGCAATTGTCCCAACGGCACGCGCTGCTCTGAGCGGCACGTGTCGGAT
GGCAAAGCGTCCCAGCCCACAGGAGGACTCAACTCGCTCGTCTGCAAGCACTGGCTTCGCGGTCTATGCAAAAAG
GGCGAGCATTGCGAGTTTTTACACGAGTACAACTTGCGCAAAATGCCCGAGTGCAACTTCTTCATGCGCAATGGC
TACTGCTCCAACGGCGAGGAGTGTTTGTACCTCCACGTCGATCCGCTCTCTCGCTTGCCGCCTTGCCCACACTAC
GACATGGGCTTCTGTCCCCTCGGTCCTCTATGCTCCAAGAAGCATGTCCGCCGAAAGCTGTGCGTCTTTTATCTT
GCCGGCTTCTGCCCTGATGGACCCGACTGCAAGCTGGGCTCACATCCCAAGTGGCTGAAAGACCTTGAGAAGCCT
ACAGTCAAGTCGGATGAGAAGAAGGATGATGATGGCCTGAGAAGTGATCTAGCAGCCCAACGGACAGAAGAAGAC
GGTGATCGTGGCAGGGATAGCCACAGAGATCGCGAGGATGGTGGCAGATTCGGGCGGCACGCAAGAGGCGCTGGA
AAGTGGAGGGGAGGCAGAGACAGACGTTTCAGAAATCGTCACTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail