Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|4471
Gene name
LocationContig_3:241789..242584
Strand-
Gene length (bp)795
Transcript length (bp)795
Coding sequence length (bp)795
Protein length (aa) 265

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00642 zf-CCCH Zinc finger C-x8-C-x5-C-x3-H type (and similar) 2.3E-04 89 108
PF00642 zf-CCCH Zinc finger C-x8-C-x5-C-x3-H type (and similar) 2.7E-08 114 138
PF14608 zf-CCCH_2 RNA-binding, Nab2-type zinc finger 1.3E+00 53 68
PF14608 zf-CCCH_2 RNA-binding, Nab2-type zinc finger 5.7E-01 90 108
PF14608 zf-CCCH_2 RNA-binding, Nab2-type zinc finger 3.5E-02 118 137
PF14608 zf-CCCH_2 RNA-binding, Nab2-type zinc finger 3.5E+00 146 165
PF14608 zf-CCCH_2 RNA-binding, Nab2-type zinc finger 1.2E+00 171 186

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q4IPA4|YTH1_GIBZE mRNA 3'-end-processing protein YTH1 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=YTH1 PE=3 SV=2 14 211 9.0E-123
sp|Q7SGR2|YTH1_NEUCR mRNA 3'-end-processing protein yth-1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=yth-1 PE=3 SV=1 6 205 4.0E-90
sp|Q5BGN2|YTH1_EMENI mRNA 3'-end-processing protein yth1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=yth1 PE=3 SV=1 23 203 2.0E-68
sp|Q4WKD9|YTH1_ASPFU mRNA 3'-end-processing protein yth1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=yth1 PE=3 SV=1 11 203 4.0E-67
sp|Q2URI6|YTH1_ASPOR mRNA 3'-end-processing protein yth1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=yth1 PE=3 SV=1 19 206 5.0E-66
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q4IPA4|YTH1_GIBZE mRNA 3'-end-processing protein YTH1 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=YTH1 PE=3 SV=2 14 211 9.0E-123
sp|Q7SGR2|YTH1_NEUCR mRNA 3'-end-processing protein yth-1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=yth-1 PE=3 SV=1 6 205 4.0E-90
sp|Q5BGN2|YTH1_EMENI mRNA 3'-end-processing protein yth1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=yth1 PE=3 SV=1 23 203 2.0E-68
sp|Q4WKD9|YTH1_ASPFU mRNA 3'-end-processing protein yth1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=yth1 PE=3 SV=1 11 203 4.0E-67
sp|Q2URI6|YTH1_ASPOR mRNA 3'-end-processing protein yth1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=yth1 PE=3 SV=1 19 206 5.0E-66
sp|Q59T36|YTH1_CANAL mRNA 3'-end-processing protein YTH1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=YTH1 PE=3 SV=1 18 239 2.0E-61
sp|Q6BTT1|YTH1_DEBHA mRNA 3'-end-processing protein YTH1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=YTH1 PE=3 SV=2 33 236 8.0E-61
sp|Q6CKU1|YTH1_KLULA mRNA 3'-end-processing protein YTH1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=YTH1 PE=3 SV=1 23 206 3.0E-57
sp|Q6C922|YTH1_YARLI mRNA 3'-end-processing protein YTH1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YTH1 PE=3 SV=1 33 226 4.0E-57
sp|Q758T3|YTH1_ASHGO mRNA 3'-end-processing protein YTH1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=YTH1 PE=3 SV=1 23 213 1.0E-55
sp|Q6FTL0|YTH1_CANGA mRNA 3'-end-processing protein YTH1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=YTH1 PE=3 SV=1 23 214 3.0E-55
sp|Q06102|YTH1_YEAST mRNA 3'-end-processing protein YTH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YTH1 PE=1 SV=1 23 236 1.0E-52
sp|Q4P384|YTH1_USTMA mRNA 3'-end-processing protein YTH1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=YTH1 PE=3 SV=1 4 188 2.0E-44
sp|Q9UTD1|YTH1_SCHPO mRNA 3'-end-processing protein yth1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=yth1 PE=3 SV=1 73 205 1.0E-43
sp|O95639|CPSF4_HUMAN Cleavage and polyadenylation specificity factor subunit 4 OS=Homo sapiens GN=CPSF4 PE=1 SV=1 53 193 4.0E-43
sp|O19137|CPSF4_BOVIN Cleavage and polyadenylation specificity factor subunit 4 OS=Bos taurus GN=CPSF4 PE=1 SV=1 53 193 5.0E-43
sp|Q5FVR7|CPSF4_RAT Cleavage and polyadenylation specificity factor subunit 4 OS=Rattus norvegicus GN=Cpsf4 PE=2 SV=1 53 193 6.0E-43
sp|Q66KE3|CPSF4_XENTR Cleavage and polyadenylation specificity factor subunit 4 OS=Xenopus tropicalis GN=cpsf4 PE=2 SV=1 53 193 1.0E-41
sp|Q6DJP7|CPSF4_XENLA Cleavage and polyadenylation specificity factor subunit 4 OS=Xenopus laevis GN=cpsf4 PE=2 SV=1 53 193 2.0E-41
sp|A6NMK7|CPS4L_HUMAN Putative cleavage and polyadenylation specificity factor subunit 4-like protein OS=Homo sapiens GN=CPSF4L PE=2 SV=3 53 197 2.0E-38
sp|Q9VPT8|CPSF4_DROME Cleavage and polyadenylation specificity factor subunit 4 OS=Drosophila melanogaster GN=Clp PE=1 SV=1 62 186 2.0E-36
sp|P0CS64|YTH1_CRYNJ mRNA 3'-end-processing protein YTH1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=YTH1 PE=3 SV=1 89 191 6.0E-32
sp|P0CS65|YTH1_CRYNB mRNA 3'-end-processing protein YTH1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=YTH1 PE=3 SV=1 89 191 6.0E-32
sp|Q8BQZ5|CPSF4_MOUSE Cleavage and polyadenylation specificity factor subunit 4 OS=Mus musculus GN=Cpsf4 PE=2 SV=1 53 193 3.0E-25
sp|Q0DA50|C3H45_ORYSJ Zinc finger CCCH domain-containing protein 45 OS=Oryza sativa subsp. japonica GN=Os06g0677700 PE=3 SV=1 89 167 1.0E-15
sp|A9LNK9|CPSF_ARATH 30-kDa cleavage and polyadenylation specificity factor 30 OS=Arabidopsis thaliana GN=CPSF30 PE=1 SV=1 89 167 1.0E-14
sp|Q8CHP0|ZC3H3_MOUSE Zinc finger CCCH domain-containing protein 3 OS=Mus musculus GN=Zc3h3 PE=1 SV=1 89 187 9.0E-13
sp|Q8IXZ2|ZC3H3_HUMAN Zinc finger CCCH domain-containing protein 3 OS=Homo sapiens GN=ZC3H3 PE=1 SV=3 60 187 1.0E-12
sp|O74823|YBJC_SCHPO Zinc finger CCCH domain-containing protein C337.12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC337.12 PE=3 SV=3 44 187 3.0E-09
sp|Q3ED78|C3H7_ARATH Zinc finger CCCH domain-containing protein 7 OS=Arabidopsis thaliana GN=At1g21570 PE=1 SV=1 89 192 3.0E-09
sp|Q9VSK8|ZC3H3_DROME Zinc finger CCCH domain-containing protein 3 OS=Drosophila melanogaster GN=ZC3H3 PE=1 SV=2 89 206 3.0E-09
sp|Q657B3|C3H7_ORYSJ Zinc finger CCCH domain-containing protein 7 OS=Oryza sativa subsp. japonica GN=Os01g0572100 PE=2 SV=1 53 174 3.0E-08
sp|Q8BYK8|ZC3H6_MOUSE Zinc finger CCCH domain-containing protein 6 OS=Mus musculus GN=Zc3h6 PE=2 SV=2 89 139 4.0E-08
sp|Q8N5P1|ZC3H8_HUMAN Zinc finger CCCH domain-containing protein 8 OS=Homo sapiens GN=ZC3H8 PE=1 SV=2 89 166 1.0E-07
sp|P61129|ZC3H6_HUMAN Zinc finger CCCH domain-containing protein 6 OS=Homo sapiens GN=ZC3H6 PE=2 SV=2 89 137 1.0E-07
sp|Q9JJ48|ZC3H8_MOUSE Zinc finger CCCH domain-containing protein 8 OS=Mus musculus GN=Zc3h8 PE=1 SV=2 89 166 2.0E-07
sp|Q9UPT8|ZC3H4_HUMAN Zinc finger CCCH domain-containing protein 4 OS=Homo sapiens GN=ZC3H4 PE=1 SV=3 88 139 9.0E-06
sp|Q6ZPZ3|ZC3H4_MOUSE Zinc finger CCCH domain-containing protein 4 OS=Mus musculus GN=Zc3h4 PE=1 SV=2 88 139 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0046872 metal ion binding Yes
GO:0003674 molecular_function No
GO:0005488 binding No
GO:0043167 ion binding No
GO:0043169 cation binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 25 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|4471
MEANSTSSTSTALAKESLASAILGHSAPQIYNFRFSPFLRKAHQVGLAADRPACRAFQTGNCPNGTRCSERHVSD
GKASQPTGGLNSLVCKHWLRGLCKKGEHCEFLHEYNLRKMPECNFFMRNGYCSNGEECLYLHVDPLSRLPPCPHY
DMGFCPLGPLCSKKHVRRKLCVFYLAGFCPDGPDCKLGSHPKWLKDLEKPTVKSDEKKDDDGLRSDLAAQRTEED
GDRGRDSHRDREDGGRFGRHARGAGKWRGGRDRRFRNRH*
Coding >OphauB2|4471
ATGGAGGCAAATTCGACATCAAGCACAAGCACAGCCCTCGCCAAAGAATCACTCGCGTCGGCGATCCTGGGACAC
TCGGCACCACAGATCTACAACTTTCGCTTCTCTCCCTTTCTCCGAAAAGCGCATCAGGTTGGACTGGCAGCAGAC
CGACCGGCATGTCGAGCCTTCCAGACGGGCAATTGTCCCAACGGCACGCGCTGCTCTGAGCGGCACGTGTCGGAT
GGCAAAGCGTCCCAGCCCACAGGAGGACTCAACTCGCTCGTCTGCAAGCACTGGCTTCGCGGTCTATGCAAAAAG
GGCGAGCATTGCGAGTTTTTACACGAGTACAACTTGCGCAAAATGCCCGAGTGCAACTTCTTCATGCGCAATGGC
TACTGCTCCAACGGCGAGGAGTGTTTGTACCTCCACGTCGATCCGCTCTCTCGCTTGCCGCCTTGCCCACACTAC
GACATGGGCTTCTGTCCCCTCGGTCCTCTATGCTCCAAGAAGCATGTCCGCCGAAAGCTGTGCGTCTTTTATCTT
GCCGGCTTCTGCCCTGATGGACCCGACTGCAAGCTGGGCTCACATCCCAAGTGGCTGAAAGACCTTGAGAAGCCT
ACAGTCAAGTCGGATGAGAAGAAGGATGATGATGGCCTGAGAAGTGATCTAGCAGCCCAACGGACAGAAGAAGAC
GGTGATCGTGGCAGGGATAGCCACAGAGATCGCGAGGATGGTGGCAGATTCGGGCGGCACGCAAGAGGCGCTGGA
AAGTGGAGGGGAGGCAGAGACAGACGTTTCAGAAATCGTCACTAG
Transcript >OphauB2|4471
ATGGAGGCAAATTCGACATCAAGCACAAGCACAGCCCTCGCCAAAGAATCACTCGCGTCGGCGATCCTGGGACAC
TCGGCACCACAGATCTACAACTTTCGCTTCTCTCCCTTTCTCCGAAAAGCGCATCAGGTTGGACTGGCAGCAGAC
CGACCGGCATGTCGAGCCTTCCAGACGGGCAATTGTCCCAACGGCACGCGCTGCTCTGAGCGGCACGTGTCGGAT
GGCAAAGCGTCCCAGCCCACAGGAGGACTCAACTCGCTCGTCTGCAAGCACTGGCTTCGCGGTCTATGCAAAAAG
GGCGAGCATTGCGAGTTTTTACACGAGTACAACTTGCGCAAAATGCCCGAGTGCAACTTCTTCATGCGCAATGGC
TACTGCTCCAACGGCGAGGAGTGTTTGTACCTCCACGTCGATCCGCTCTCTCGCTTGCCGCCTTGCCCACACTAC
GACATGGGCTTCTGTCCCCTCGGTCCTCTATGCTCCAAGAAGCATGTCCGCCGAAAGCTGTGCGTCTTTTATCTT
GCCGGCTTCTGCCCTGATGGACCCGACTGCAAGCTGGGCTCACATCCCAAGTGGCTGAAAGACCTTGAGAAGCCT
ACAGTCAAGTCGGATGAGAAGAAGGATGATGATGGCCTGAGAAGTGATCTAGCAGCCCAACGGACAGAAGAAGAC
GGTGATCGTGGCAGGGATAGCCACAGAGATCGCGAGGATGGTGGCAGATTCGGGCGGCACGCAAGAGGCGCTGGA
AAGTGGAGGGGAGGCAGAGACAGACGTTTCAGAAATCGTCACTAG
Gene >OphauB2|4471
ATGGAGGCAAATTCGACATCAAGCACAAGCACAGCCCTCGCCAAAGAATCACTCGCGTCGGCGATCCTGGGACAC
TCGGCACCACAGATCTACAACTTTCGCTTCTCTCCCTTTCTCCGAAAAGCGCATCAGGTTGGACTGGCAGCAGAC
CGACCGGCATGTCGAGCCTTCCAGACGGGCAATTGTCCCAACGGCACGCGCTGCTCTGAGCGGCACGTGTCGGAT
GGCAAAGCGTCCCAGCCCACAGGAGGACTCAACTCGCTCGTCTGCAAGCACTGGCTTCGCGGTCTATGCAAAAAG
GGCGAGCATTGCGAGTTTTTACACGAGTACAACTTGCGCAAAATGCCCGAGTGCAACTTCTTCATGCGCAATGGC
TACTGCTCCAACGGCGAGGAGTGTTTGTACCTCCACGTCGATCCGCTCTCTCGCTTGCCGCCTTGCCCACACTAC
GACATGGGCTTCTGTCCCCTCGGTCCTCTATGCTCCAAGAAGCATGTCCGCCGAAAGCTGTGCGTCTTTTATCTT
GCCGGCTTCTGCCCTGATGGACCCGACTGCAAGCTGGGCTCACATCCCAAGTGGCTGAAAGACCTTGAGAAGCCT
ACAGTCAAGTCGGATGAGAAGAAGGATGATGATGGCCTGAGAAGTGATCTAGCAGCCCAACGGACAGAAGAAGAC
GGTGATCGTGGCAGGGATAGCCACAGAGATCGCGAGGATGGTGGCAGATTCGGGCGGCACGCAAGAGGCGCTGGA
AAGTGGAGGGGAGGCAGAGACAGACGTTTCAGAAATCGTCACTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail