Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|4470
Gene name
LocationContig_3:239906..241519
Strand+
Gene length (bp)1613
Transcript length (bp)1497
Coding sequence length (bp)1497
Protein length (aa) 499

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08643 DUF1776 Fungal family of unknown function (DUF1776) 1.2E-103 124 429

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q9URV8|YBL3_SCHPO UPF0744 protein C106.03 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC106.03 PE=1 SV=1 104 428 1.0E-12

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup3146
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2468
Ophiocordyceps australis map64 (Brazil) OphauB2|4470 (this protein)
Ophiocordyceps camponoti-floridani Ophcf2|03334
Ophiocordyceps camponoti-rufipedis Ophun1|6815
Ophiocordyceps kimflemingae Ophio5|5229
Ophiocordyceps subramaniannii Hirsu2|5533

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|4470
MSADGQQFLDSLSSIPLHLRRYTDHVADFVDRNVDYAAHLVRETLATSQWVPETIRPSLPASAAPAGAVSGAASR
VDCIQAWLARHKLLTSLVVVICGTVAVSNYQSNRSFRRARRAKRNRSGGRKEVIVIAGSPTLPLTKSLSLDLDRR
GFIVYVVCNAAEDQRMVQTFSRPDIRPLSIDTTDPPSAGAAIDRFASMLQNPQLPVALPSSANLTLKGVVLIPSL
HYQTSPIATIPPSSFADLFNTHLLQPILTIQAFLPLLTSRLIPIGEKWVPPKVLVFTPSIISSINPPFHAPEATV
CSALTAFTEVLTAELRPLGIPVTHVQLGTFDFSSFVSSQSALTSSSGRQGMLAWPDGARHVYGHNFLAQTSSAIS
GGRIRGLKGSSLRHLHNAVFDVLDGSITSATVRVGLGSSVYGFVGRWVPRCLVSWMMGVRRVDELSTWKSSCNDG
SSRDESEDDDAAAIISSRDFVPDASEQNVWNTDTADSSIWVPSTKEMN*
Coding >OphauB2|4470
ATGTCCGCCGACGGCCAACAGTTTCTAGACTCGCTCTCGAGCATCCCGCTTCACCTCCGCCGCTACACCGATCAC
GTCGCCGACTTTGTCGACCGCAATGTCGACTATGCTGCTCACCTCGTTCGCGAGACGCTTGCCACGTCGCAATGG
GTGCCCGAGACCATCAGACCCAGCTTACCTGCCTCTGCGGCCCCCGCTGGAGCCGTCTCAGGAGCGGCTTCTCGC
GTCGACTGTATTCAAGCATGGCTGGCGCGACACAAGCTCCTGACCAGCCTGGTTGTCGTTATTTGCGGCACCGTG
GCCGTCAGCAACTATCAAAGTAATCGCTCCTTTCGCCGAGCAAGGCGTGCCAAGAGAAATCGCAGTGGCGGCCGC
AAAGAGGTTATCGTCATCGCTGGATCGCCAACGCTTCCTCTGACCAAGTCCTTGTCGCTCGACTTGGATAGGCGC
GGCTTCATCGTCTACGTGGTCTGCAACGCCGCCGAGGACCAAAGAATGGTGCAAACTTTTTCTCGCCCCGATATT
CGGCCCTTGTCAATTGATACGACTGACCCTCCAAGCGCGGGTGCTGCTATAGACCGCTTCGCCTCAATGTTGCAG
AACCCACAGCTTCCTGTGGCCTTGCCATCGTCGGCCAACTTGACGCTCAAGGGCGTGGTGCTCATACCCAGTCTG
CACTACCAGACGTCGCCCATTGCCACTATTCCGCCGTCGAGCTTCGCCGATCTCTTTAATACGCACCTTCTGCAG
CCTATCCTCACCATACAGGCCTTTCTACCTCTCCTCACCTCTCGCCTCATACCAATTGGCGAAAAGTGGGTTCCG
CCCAAGGTCCTCGTCTTCACGCCGTCCATCATTTCATCGATAAACCCGCCTTTCCATGCGCCCGAGGCCACAGTC
TGCTCAGCTTTGACGGCTTTTACCGAGGTCCTGACGGCCGAGCTGCGGCCGCTTGGCATACCCGTCACACATGTG
CAACTAGGCACCTTTGATTTCTCTAGCTTCGTATCCTCTCAAAGCGCCCTGACATCTTCAAGTGGCCGGCAGGGT
ATGCTTGCCTGGCCTGACGGTGCGCGCCACGTCTATGGCCACAACTTCCTGGCCCAGACGAGCTCCGCCATCTCG
GGCGGTCGCATCCGAGGTCTCAAGGGCAGCTCGCTGCGGCATCTACACAATGCCGTATTTGATGTCCTTGACGGC
AGCATTACAAGCGCAACAGTAAGAGTTGGGCTTGGATCCAGTGTCTACGGCTTCGTCGGGCGCTGGGTTCCGCGC
TGCCTCGTCTCGTGGATGATGGGCGTTCGCCGAGTTGACGAGCTGTCGACGTGGAAGTCGAGCTGCAACGACGGG
TCTTCTCGTGACGAGAGTGAGGACGATGACGCTGCCGCCATCATCTCGTCGCGCGACTTTGTCCCAGATGCATCA
GAGCAAAACGTATGGAACACGGATACGGCTGATAGCAGCATCTGGGTGCCGTCCACCAAGGAGATGAACTAG
Transcript >OphauB2|4470
ATGTCCGCCGACGGCCAACAGTTTCTAGACTCGCTCTCGAGCATCCCGCTTCACCTCCGCCGCTACACCGATCAC
GTCGCCGACTTTGTCGACCGCAATGTCGACTATGCTGCTCACCTCGTTCGCGAGACGCTTGCCACGTCGCAATGG
GTGCCCGAGACCATCAGACCCAGCTTACCTGCCTCTGCGGCCCCCGCTGGAGCCGTCTCAGGAGCGGCTTCTCGC
GTCGACTGTATTCAAGCATGGCTGGCGCGACACAAGCTCCTGACCAGCCTGGTTGTCGTTATTTGCGGCACCGTG
GCCGTCAGCAACTATCAAAGTAATCGCTCCTTTCGCCGAGCAAGGCGTGCCAAGAGAAATCGCAGTGGCGGCCGC
AAAGAGGTTATCGTCATCGCTGGATCGCCAACGCTTCCTCTGACCAAGTCCTTGTCGCTCGACTTGGATAGGCGC
GGCTTCATCGTCTACGTGGTCTGCAACGCCGCCGAGGACCAAAGAATGGTGCAAACTTTTTCTCGCCCCGATATT
CGGCCCTTGTCAATTGATACGACTGACCCTCCAAGCGCGGGTGCTGCTATAGACCGCTTCGCCTCAATGTTGCAG
AACCCACAGCTTCCTGTGGCCTTGCCATCGTCGGCCAACTTGACGCTCAAGGGCGTGGTGCTCATACCCAGTCTG
CACTACCAGACGTCGCCCATTGCCACTATTCCGCCGTCGAGCTTCGCCGATCTCTTTAATACGCACCTTCTGCAG
CCTATCCTCACCATACAGGCCTTTCTACCTCTCCTCACCTCTCGCCTCATACCAATTGGCGAAAAGTGGGTTCCG
CCCAAGGTCCTCGTCTTCACGCCGTCCATCATTTCATCGATAAACCCGCCTTTCCATGCGCCCGAGGCCACAGTC
TGCTCAGCTTTGACGGCTTTTACCGAGGTCCTGACGGCCGAGCTGCGGCCGCTTGGCATACCCGTCACACATGTG
CAACTAGGCACCTTTGATTTCTCTAGCTTCGTATCCTCTCAAAGCGCCCTGACATCTTCAAGTGGCCGGCAGGGT
ATGCTTGCCTGGCCTGACGGTGCGCGCCACGTCTATGGCCACAACTTCCTGGCCCAGACGAGCTCCGCCATCTCG
GGCGGTCGCATCCGAGGTCTCAAGGGCAGCTCGCTGCGGCATCTACACAATGCCGTATTTGATGTCCTTGACGGC
AGCATTACAAGCGCAACAGTAAGAGTTGGGCTTGGATCCAGTGTCTACGGCTTCGTCGGGCGCTGGGTTCCGCGC
TGCCTCGTCTCGTGGATGATGGGCGTTCGCCGAGTTGACGAGCTGTCGACGTGGAAGTCGAGCTGCAACGACGGG
TCTTCTCGTGACGAGAGTGAGGACGATGACGCTGCCGCCATCATCTCGTCGCGCGACTTTGTCCCAGATGCATCA
GAGCAAAACGTATGGAACACGGATACGGCTGATAGCAGCATCTGGGTGCCGTCCACCAAGGAGATGAACTAG
Gene >OphauB2|4470
ATGTCCGCCGACGGCCAACAGTTTCTAGACTCGGTGAGGACAACAGCATCAAAGCCCCTGGGCAATGCTAACCAT
GGCTCTTGGCACTGCAAAAGCTCTCGAGCATCCCGCTTCACCTCCGCCGCTACACCGATCACGTCGCCGACTTTG
TCGACCGCAATGTCGACTATGCTGCTCACCTCGTTCGCGAGACGCTTGCCACGTCGCAATGGGTGCCCGAGACCA
TCAGACCCAGCTTACCTGCCTCTGCGGCCCCCGCTGGAGCCGTCTCAGGAGCGGCTTCTCGCGTCGACTGTATTC
AAGCATGGCTGGCGCGACACAAGCTCCTGACCAGCCTGGTTGTCGTTATTTGCGGCACCGTGGCCGTCAGCAACT
ATCAAAGTAATCGCTCCTTTCGCCGAGCAAGGCGTGCCAAGAGAAATCGCAGTGGCGGCCGCAAAGAGGTTATCG
TCATCGCTGGATCGCCAACGCTTCCTCTGACCAAGTCCTTGTCGCTCGACTTGGATAGGCGCGGCTTCATCGTCT
ACGTGGTCTGCAACGCCGCCGAGGACCAAAGAATGGTGCAAACTTTTTCTCGCCCCGATATTCGGCCCTTGTCAA
TTGATACGACTGACGTGAGTCTGCCTGTCCAGCTCGTTGCAGACCCCAGACTGACCAGACACCACCAGCCTCCAA
GCGCGGGTGCTGCTATAGACCGCTTCGCCTCAATGTTGCAGAACCCACAGCTTCCTGTGGCCTTGCCATCGTCGG
CCAACTTGACGCTCAAGGGCGTGGTGCTCATACCCAGTCTGCACTACCAGACGTCGCCCATTGCCACTATTCCGC
CGTCGAGCTTCGCCGATCTCTTTAATACGCACCTTCTGCAGCCTATCCTCACCATACAGGCCTTTCTACCTCTCC
TCACCTCTCGCCTCATACCAATTGGCGAAAAGTGGGTTCCGCCCAAGGTCCTCGTCTTCACGCCGTCCATCATTT
CATCGATAAACCCGCCTTTCCATGCGCCCGAGGCCACAGTCTGCTCAGCTTTGACGGCTTTTACCGAGGTCCTGA
CGGCCGAGCTGCGGCCGCTTGGCATACCCGTCACACATGTGCAACTAGGCACCTTTGATTTCTCTAGCTTCGTAT
CCTCTCAAAGCGCCCTGACATCTTCAAGTGGCCGGCAGGGTATGCTTGCCTGGCCTGACGGTGCGCGCCACGTCT
ATGGCCACAACTTCCTGGCCCAGACGAGCTCCGCCATCTCGGGCGGTCGCATCCGAGGTCTCAAGGGCAGCTCGC
TGCGGCATCTACACAATGCCGTATTTGATGTCCTTGACGGCAGCATTACAAGCGCAACAGTAAGAGTTGGGCTTG
GATCCAGTGTCTACGGCTTCGTCGGGCGCTGGGTTCCGCGCTGCCTCGTCTCGTGGATGATGGGCGTTCGCCGAG
TTGACGAGCTGTCGACGTGGAAGTCGAGCTGCAACGACGGGTCTTCTCGTGACGAGAGTGAGGACGATGACGCTG
CCGCCATCATCTCGTCGCGCGACTTTGTCCCAGATGCATCAGAGCAAAACGTATGGAACACGGATACGGCTGATA
GCAGCATCTGGGTGCCGTCCACCAAGGAGATGAACTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail