Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|4465
Gene name
LocationContig_3:219373..223085
Strand-
Gene length (bp)3712
Transcript length (bp)3558
Coding sequence length (bp)3558
Protein length (aa) 1186

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00168 C2 C2 domain 1.2E-12 547 652
PF00168 C2 C2 domain 1.1E-05 768 878

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9USG8|MU190_SCHPO Meiotically up-regulated gene 190 protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mug190 PE=1 SV=1 197 1080 2.0E-135
sp|Q9BSJ8|ESYT1_HUMAN Extended synaptotagmin-1 OS=Homo sapiens GN=ESYT1 PE=1 SV=1 199 610 1.0E-09
sp|Q3U7R1|ESYT1_MOUSE Extended synaptotagmin-1 OS=Mus musculus GN=Esyt1 PE=1 SV=2 195 610 1.0E-09
sp|Q5M7N9|ESYT3_XENTR Extended synaptotagmin-3 OS=Xenopus tropicalis GN=esyt3 PE=2 SV=1 289 650 5.0E-09
sp|Q5RAG2|ESYT1_PONAB Extended synaptotagmin-1 OS=Pongo abelii GN=ESYT1 PE=2 SV=2 199 610 7.0E-09
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9USG8|MU190_SCHPO Meiotically up-regulated gene 190 protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mug190 PE=1 SV=1 197 1080 2.0E-135
sp|Q9BSJ8|ESYT1_HUMAN Extended synaptotagmin-1 OS=Homo sapiens GN=ESYT1 PE=1 SV=1 199 610 1.0E-09
sp|Q3U7R1|ESYT1_MOUSE Extended synaptotagmin-1 OS=Mus musculus GN=Esyt1 PE=1 SV=2 195 610 1.0E-09
sp|Q5M7N9|ESYT3_XENTR Extended synaptotagmin-3 OS=Xenopus tropicalis GN=esyt3 PE=2 SV=1 289 650 5.0E-09
sp|Q5RAG2|ESYT1_PONAB Extended synaptotagmin-1 OS=Pongo abelii GN=ESYT1 PE=2 SV=2 199 610 7.0E-09
sp|Q9Z1X1|ESYT1_RAT Extended synaptotagmin-1 OS=Rattus norvegicus GN=Esyt1 PE=1 SV=1 195 610 2.0E-08
sp|A0FGR8|ESYT2_HUMAN Extended synaptotagmin-2 OS=Homo sapiens GN=ESYT2 PE=1 SV=1 454 647 6.0E-08
sp|Q3TZZ7|ESYT2_MOUSE Extended synaptotagmin-2 OS=Mus musculus GN=Esyt2 PE=1 SV=1 454 647 5.0E-07
sp|Q7ZWU7|EST2B_XENLA Extended synaptotagmin-2-B OS=Xenopus laevis GN=esyt2-b PE=2 SV=1 289 647 2.0E-06
sp|Q5FWL4|EST2A_XENLA Extended synaptotagmin-2-A OS=Xenopus laevis GN=esyt2-a PE=2 SV=1 456 647 4.0E-06
sp|Q9R0N6|SYT8_MOUSE Synaptotagmin-8 OS=Mus musculus GN=Syt8 PE=1 SV=1 546 651 5.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 54 0.45

Transmembrane Domains

Domain # Start End Length
1 216 235 19
2 240 262 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|4465
MSAKDDADDVKRYQAPYSAQRPIPTISRYREIKAARRREAAFRRQEDGDDDDQTALLPSWAQNNQPLGRSRSQSR
TSLQSQTDVPTADTKSELSTLEDTSQVDAAATDVKQRRKRLKSSSRHKERAQREVTDPVTHLPVTIQDFTDEALE
ALDYNHAAPGSTPETATGRDAKLKTTEQLFTEQQSLQRNHNALRSRFPPPDMAAMGQELVSLHRRIAIVAVSVAA
LVALAASFVVRCSNLTAWLGLAVAAVALIAGVQDYASDQVLSTFKDEIWESQRRQVESRSSSYEVEPTVWLNSLL
GSVWPLINPDLFVSLSDTLEDVMQASLPRLVRMVSVEDIGQGSEAIRILGIRWLPTGAAAKTVTRDGKLSSDESY
DNDVDQEKPRSEEEKDAEKAFAGMRAEEGDFVNMEVAFAYRSRPRSHRIKDRTKSMHLYLAFYLPGNVKIPVWVD
LRGIVGVLRVRLQLTPDPPFFSLCTLTLLGQPKVDLSCIPLSQRGLNIMDVPLISNFVQSAVDAAVADYVAPKSL
TLDLKDMLAGDDFKKDTVSTGVLMVNIKRGYDFKMGDTAIPLIRDGSSDPYVSVGWAKFGKVLWSTRVLECEMEP
YWDETCFVLVTPEELNIDERLRVQLWDSDRFTADDDLGRIEVPLAELLTDHRSRAKMWERVDGFRALSAGDNMPG
KLEWSVGYFAKTALQQCQLDLQTHDCKVRTMQQLQVKVDKSCERKLREIVVKQGHEEDDEAEVERQRALELKTEQ
DAIIISAPPPDGYPSGLLSLQIHNITGLELDKLSKRQVEDEEEASDEEEAGDSLPSAYCTVIINHSKTFKTRIKP
QNAKPFFNAGCERFIRDWRDCEVFVSVRDARLHEENPLLGIVHLPLSHVLRERSQVMGFWPLSGGIGHGRIRLSL
VWRSINLQVPRNMLGWSYGTLDVEPVATSSDCPAQLSSCQLKLKTNISMGKLYAHQGGEGKAEWRTKREQNVSLA
VKKRYSSCMSVSFRNKKGLFGDKVASFCVMWLKDIADEEEQELELPIWKGDFERATACCLKECGERVGTLKLKVT
FLAGMGNAHARWASRNQDLRDVIEVIETARDNLDGDEMEKAAGIGDEDASSDSDSSSGEKDEADGKSLKEKQSTL
EQIRDYRRRDKALHRQHRGIMQWKIPRTAKWVKNKWGRVEDGVTGFFEHGSRQAGIETEV*
Coding >OphauB2|4465
ATGTCGGCCAAGGATGACGCCGACGATGTGAAGCGGTACCAAGCCCCCTACAGTGCCCAGCGGCCCATTCCCACC
ATTTCCCGCTACCGAGAGATCAAGGCAGCACGCCGACGCGAGGCTGCATTCCGGCGGCAAGAGGATGGCGACGAC
GACGACCAAACAGCACTGCTGCCTTCTTGGGCCCAGAATAATCAGCCTCTAGGCCGCTCCCGGAGCCAGTCTCGG
ACAAGTCTGCAATCACAGACGGACGTGCCCACAGCCGACACCAAGAGTGAGCTCTCGACACTTGAGGATACGTCG
CAGGTCGACGCCGCAGCAACAGATGTCAAGCAGAGGCGCAAGCGGCTCAAGTCGAGCTCCAGACACAAGGAGCGT
GCCCAGCGCGAGGTTACCGATCCCGTCACCCATTTGCCCGTCACCATTCAAGACTTCACCGACGAGGCCCTCGAG
GCTCTCGACTATAACCATGCGGCCCCCGGCTCCACGCCAGAAACCGCCACGGGTCGCGATGCCAAGCTCAAGACG
ACTGAGCAACTCTTTACCGAGCAGCAATCCCTACAGCGGAACCACAATGCCTTGCGCAGCCGCTTTCCGCCGCCC
GACATGGCTGCCATGGGCCAGGAGCTTGTTTCTCTGCACAGACGCATCGCCATTGTCGCTGTCTCTGTCGCTGCC
CTTGTAGCCTTGGCCGCCAGCTTTGTCGTTCGCTGCTCCAACCTGACGGCCTGGCTTGGGCTTGCCGTGGCTGCC
GTGGCACTCATTGCTGGTGTTCAAGACTACGCCTCGGATCAAGTCCTTTCTACCTTTAAAGACGAGATTTGGGAG
TCTCAGCGTCGACAGGTAGAGTCAAGGTCGAGCAGCTACGAGGTTGAGCCGACGGTTTGGCTCAATTCCCTCCTT
GGCTCCGTCTGGCCGCTAATCAACCCAGACCTCTTTGTGAGCCTCTCGGACACGCTCGAGGATGTTATGCAGGCC
TCTCTTCCTCGCCTCGTCCGCATGGTTAGCGTCGAGGACATTGGCCAGGGCAGCGAGGCCATTCGCATCCTTGGC
ATTCGCTGGCTGCCCACTGGCGCCGCCGCAAAGACGGTTACGCGCGACGGCAAGCTATCGTCTGACGAGAGCTAC
GACAATGATGTGGACCAGGAAAAGCCCAGGTCAGAAGAGGAAAAGGATGCAGAAAAGGCCTTTGCTGGCATGCGA
GCAGAAGAAGGCGACTTTGTCAATATGGAAGTGGCTTTTGCCTACCGCTCTCGCCCTCGGTCACACCGTATCAAG
GACCGCACCAAGAGCATGCACCTATATCTTGCCTTTTACTTGCCTGGAAACGTCAAGATTCCCGTATGGGTCGAT
CTCAGGGGCATTGTGGGCGTCTTGAGGGTGCGGCTCCAGCTGACGCCCGATCCGCCCTTCTTCTCCCTCTGCACA
TTGACCCTTCTCGGCCAGCCCAAGGTGGATCTGAGCTGCATCCCCCTCAGCCAGCGCGGCCTCAACATCATGGAC
GTGCCCCTGATTAGTAACTTTGTGCAGTCGGCCGTCGATGCCGCTGTTGCCGACTATGTGGCTCCCAAGAGCCTC
ACGCTCGATCTCAAGGACATGCTCGCTGGCGATGACTTCAAAAAGGACACAGTGTCGACGGGCGTCCTCATGGTC
AATATCAAGCGCGGCTACGACTTCAAAATGGGCGACACTGCTATTCCCCTTATTAGAGACGGCAGCTCTGATCCC
TATGTCTCTGTTGGCTGGGCCAAGTTTGGCAAGGTGCTTTGGAGCACGCGGGTGCTGGAATGCGAAATGGAGCCC
TACTGGGACGAAACCTGCTTTGTCCTTGTCACGCCCGAAGAGCTCAACATTGATGAGCGCTTGCGGGTACAGCTC
TGGGATTCGGACCGCTTCACCGCCGACGATGACTTGGGCCGCATCGAGGTGCCCTTGGCTGAGCTCTTGACGGAC
CATCGCTCACGGGCCAAGATGTGGGAGCGTGTGGATGGCTTCCGCGCCCTCAGTGCAGGAGACAATATGCCTGGC
AAGCTGGAGTGGAGTGTTGGCTATTTTGCAAAGACGGCCTTGCAGCAGTGCCAGCTGGACCTTCAGACGCATGAT
TGCAAGGTGCGGACCATGCAACAGCTGCAGGTCAAGGTGGACAAGAGCTGTGAGCGGAAACTACGGGAAATAGTA
GTCAAGCAGGGCCACGAAGAGGATGACGAGGCCGAAGTGGAGCGTCAGAGAGCCCTGGAGCTCAAGACAGAACAA
GACGCCATCATCATTTCTGCGCCGCCGCCGGATGGCTACCCCAGCGGACTGCTTAGTCTGCAGATTCACAACATC
ACGGGGCTCGAGCTTGACAAGTTGAGCAAGCGCCAGGTGGAAGACGAGGAAGAGGCCAGCGACGAAGAGGAGGCC
GGGGACAGTTTGCCGAGTGCATACTGCACCGTGATTATCAACCACAGCAAGACGTTCAAGACTCGCATCAAGCCG
CAGAATGCCAAGCCCTTTTTCAATGCTGGCTGCGAACGCTTCATCCGCGACTGGCGTGACTGCGAGGTGTTTGTC
TCGGTGCGGGATGCCAGGCTGCATGAGGAGAATCCCTTGCTTGGCATTGTGCATCTACCGCTGAGCCACGTGCTC
CGGGAGCGCTCACAGGTGATGGGGTTTTGGCCCCTGTCGGGCGGCATCGGGCACGGGCGCATCAGGCTGTCCCTG
GTGTGGCGCAGCATCAATCTACAGGTGCCGCGCAACATGCTGGGCTGGAGTTATGGGACTTTGGACGTGGAGCCT
GTGGCGACGAGCTCCGACTGCCCAGCGCAGCTCTCGTCGTGCCAGCTTAAGCTCAAGACGAATATCAGCATGGGC
AAACTTTACGCGCACCAAGGCGGCGAGGGCAAGGCGGAGTGGAGGACCAAGCGGGAGCAGAATGTCAGTCTGGCT
GTCAAGAAGCGCTATAGCAGCTGCATGTCTGTGTCGTTTCGGAACAAGAAGGGGCTTTTTGGAGACAAGGTTGCG
TCGTTTTGCGTCATGTGGCTCAAGGACATTGCGGATGAGGAAGAGCAGGAGCTTGAGCTACCCATTTGGAAGGGA
GATTTTGAGCGGGCCACGGCTTGCTGTCTGAAGGAGTGTGGCGAGCGAGTGGGCACACTGAAGCTCAAGGTGACC
TTTTTGGCTGGCATGGGAAATGCCCACGCACGCTGGGCCTCTCGCAACCAAGACTTGCGCGATGTGATTGAGGTG
ATTGAAACGGCACGAGACAACCTAGACGGAGACGAGATGGAAAAAGCGGCGGGCATTGGCGATGAGGATGCTTCG
AGCGACAGCGACAGCTCGAGCGGCGAAAAGGACGAGGCGGATGGCAAGAGCCTCAAGGAAAAGCAGAGCACATTG
GAGCAGATTCGCGACTATCGTCGCCGAGACAAGGCGCTGCATCGGCAACATCGGGGCATTATGCAGTGGAAGATT
CCTCGAACAGCCAAATGGGTCAAGAACAAGTGGGGGCGGGTAGAAGACGGCGTGACGGGATTTTTCGAGCATGGC
TCCCGACAGGCGGGCATTGAGACGGAGGTGTAG
Transcript >OphauB2|4465
ATGTCGGCCAAGGATGACGCCGACGATGTGAAGCGGTACCAAGCCCCCTACAGTGCCCAGCGGCCCATTCCCACC
ATTTCCCGCTACCGAGAGATCAAGGCAGCACGCCGACGCGAGGCTGCATTCCGGCGGCAAGAGGATGGCGACGAC
GACGACCAAACAGCACTGCTGCCTTCTTGGGCCCAGAATAATCAGCCTCTAGGCCGCTCCCGGAGCCAGTCTCGG
ACAAGTCTGCAATCACAGACGGACGTGCCCACAGCCGACACCAAGAGTGAGCTCTCGACACTTGAGGATACGTCG
CAGGTCGACGCCGCAGCAACAGATGTCAAGCAGAGGCGCAAGCGGCTCAAGTCGAGCTCCAGACACAAGGAGCGT
GCCCAGCGCGAGGTTACCGATCCCGTCACCCATTTGCCCGTCACCATTCAAGACTTCACCGACGAGGCCCTCGAG
GCTCTCGACTATAACCATGCGGCCCCCGGCTCCACGCCAGAAACCGCCACGGGTCGCGATGCCAAGCTCAAGACG
ACTGAGCAACTCTTTACCGAGCAGCAATCCCTACAGCGGAACCACAATGCCTTGCGCAGCCGCTTTCCGCCGCCC
GACATGGCTGCCATGGGCCAGGAGCTTGTTTCTCTGCACAGACGCATCGCCATTGTCGCTGTCTCTGTCGCTGCC
CTTGTAGCCTTGGCCGCCAGCTTTGTCGTTCGCTGCTCCAACCTGACGGCCTGGCTTGGGCTTGCCGTGGCTGCC
GTGGCACTCATTGCTGGTGTTCAAGACTACGCCTCGGATCAAGTCCTTTCTACCTTTAAAGACGAGATTTGGGAG
TCTCAGCGTCGACAGGTAGAGTCAAGGTCGAGCAGCTACGAGGTTGAGCCGACGGTTTGGCTCAATTCCCTCCTT
GGCTCCGTCTGGCCGCTAATCAACCCAGACCTCTTTGTGAGCCTCTCGGACACGCTCGAGGATGTTATGCAGGCC
TCTCTTCCTCGCCTCGTCCGCATGGTTAGCGTCGAGGACATTGGCCAGGGCAGCGAGGCCATTCGCATCCTTGGC
ATTCGCTGGCTGCCCACTGGCGCCGCCGCAAAGACGGTTACGCGCGACGGCAAGCTATCGTCTGACGAGAGCTAC
GACAATGATGTGGACCAGGAAAAGCCCAGGTCAGAAGAGGAAAAGGATGCAGAAAAGGCCTTTGCTGGCATGCGA
GCAGAAGAAGGCGACTTTGTCAATATGGAAGTGGCTTTTGCCTACCGCTCTCGCCCTCGGTCACACCGTATCAAG
GACCGCACCAAGAGCATGCACCTATATCTTGCCTTTTACTTGCCTGGAAACGTCAAGATTCCCGTATGGGTCGAT
CTCAGGGGCATTGTGGGCGTCTTGAGGGTGCGGCTCCAGCTGACGCCCGATCCGCCCTTCTTCTCCCTCTGCACA
TTGACCCTTCTCGGCCAGCCCAAGGTGGATCTGAGCTGCATCCCCCTCAGCCAGCGCGGCCTCAACATCATGGAC
GTGCCCCTGATTAGTAACTTTGTGCAGTCGGCCGTCGATGCCGCTGTTGCCGACTATGTGGCTCCCAAGAGCCTC
ACGCTCGATCTCAAGGACATGCTCGCTGGCGATGACTTCAAAAAGGACACAGTGTCGACGGGCGTCCTCATGGTC
AATATCAAGCGCGGCTACGACTTCAAAATGGGCGACACTGCTATTCCCCTTATTAGAGACGGCAGCTCTGATCCC
TATGTCTCTGTTGGCTGGGCCAAGTTTGGCAAGGTGCTTTGGAGCACGCGGGTGCTGGAATGCGAAATGGAGCCC
TACTGGGACGAAACCTGCTTTGTCCTTGTCACGCCCGAAGAGCTCAACATTGATGAGCGCTTGCGGGTACAGCTC
TGGGATTCGGACCGCTTCACCGCCGACGATGACTTGGGCCGCATCGAGGTGCCCTTGGCTGAGCTCTTGACGGAC
CATCGCTCACGGGCCAAGATGTGGGAGCGTGTGGATGGCTTCCGCGCCCTCAGTGCAGGAGACAATATGCCTGGC
AAGCTGGAGTGGAGTGTTGGCTATTTTGCAAAGACGGCCTTGCAGCAGTGCCAGCTGGACCTTCAGACGCATGAT
TGCAAGGTGCGGACCATGCAACAGCTGCAGGTCAAGGTGGACAAGAGCTGTGAGCGGAAACTACGGGAAATAGTA
GTCAAGCAGGGCCACGAAGAGGATGACGAGGCCGAAGTGGAGCGTCAGAGAGCCCTGGAGCTCAAGACAGAACAA
GACGCCATCATCATTTCTGCGCCGCCGCCGGATGGCTACCCCAGCGGACTGCTTAGTCTGCAGATTCACAACATC
ACGGGGCTCGAGCTTGACAAGTTGAGCAAGCGCCAGGTGGAAGACGAGGAAGAGGCCAGCGACGAAGAGGAGGCC
GGGGACAGTTTGCCGAGTGCATACTGCACCGTGATTATCAACCACAGCAAGACGTTCAAGACTCGCATCAAGCCG
CAGAATGCCAAGCCCTTTTTCAATGCTGGCTGCGAACGCTTCATCCGCGACTGGCGTGACTGCGAGGTGTTTGTC
TCGGTGCGGGATGCCAGGCTGCATGAGGAGAATCCCTTGCTTGGCATTGTGCATCTACCGCTGAGCCACGTGCTC
CGGGAGCGCTCACAGGTGATGGGGTTTTGGCCCCTGTCGGGCGGCATCGGGCACGGGCGCATCAGGCTGTCCCTG
GTGTGGCGCAGCATCAATCTACAGGTGCCGCGCAACATGCTGGGCTGGAGTTATGGGACTTTGGACGTGGAGCCT
GTGGCGACGAGCTCCGACTGCCCAGCGCAGCTCTCGTCGTGCCAGCTTAAGCTCAAGACGAATATCAGCATGGGC
AAACTTTACGCGCACCAAGGCGGCGAGGGCAAGGCGGAGTGGAGGACCAAGCGGGAGCAGAATGTCAGTCTGGCT
GTCAAGAAGCGCTATAGCAGCTGCATGTCTGTGTCGTTTCGGAACAAGAAGGGGCTTTTTGGAGACAAGGTTGCG
TCGTTTTGCGTCATGTGGCTCAAGGACATTGCGGATGAGGAAGAGCAGGAGCTTGAGCTACCCATTTGGAAGGGA
GATTTTGAGCGGGCCACGGCTTGCTGTCTGAAGGAGTGTGGCGAGCGAGTGGGCACACTGAAGCTCAAGGTGACC
TTTTTGGCTGGCATGGGAAATGCCCACGCACGCTGGGCCTCTCGCAACCAAGACTTGCGCGATGTGATTGAGGTG
ATTGAAACGGCACGAGACAACCTAGACGGAGACGAGATGGAAAAAGCGGCGGGCATTGGCGATGAGGATGCTTCG
AGCGACAGCGACAGCTCGAGCGGCGAAAAGGACGAGGCGGATGGCAAGAGCCTCAAGGAAAAGCAGAGCACATTG
GAGCAGATTCGCGACTATCGTCGCCGAGACAAGGCGCTGCATCGGCAACATCGGGGCATTATGCAGTGGAAGATT
CCTCGAACAGCCAAATGGGTCAAGAACAAGTGGGGGCGGGTAGAAGACGGCGTGACGGGATTTTTCGAGCATGGC
TCCCGACAGGCGGGCATTGAGACGGAGGTGTAG
Gene >OphauB2|4465
ATGTCGGCCAAGGATGACGCCGACGATGTGAAGCGGTACCAAGCCCCCTACAGTGCCCAGCGGCCCATTCCCACC
ATTTCCCGCTACCGAGAGATCAAGGCAGCACGCCGACGCGAGGCTGCATTCCGGCGGCAAGAGGATGGCGACGAC
GACGACCAAACAGCACTGCTGCCTTCTTGGGCCCAGAATAATCAGCCTCTAGGCCGCTCCCGGAGCCAGTCTCGG
ACAAGTCTGCAATCACAGACGGACGTGCCCACAGCCGACACCAAGAGTGAGCTCTCGACACTTGAGGATACGTCG
CAGGTCGACGCCGCAGCAACAGATGTCAAGCAGAGGCGCAAGCGGCTCAAGTCGAGCTCCAGACACAAGGAGCGT
GCCCAGCGCGAGGTTACCGATCCCGTCACCCATTTGCCCGTCACCATTCAAGACTTCACCGACGAGGCCCTCGAG
GCTCTCGACTATAACCATGCGGCCCCCGGCTCCACGCCAGAAACCGCCACGGGTCGCGATGCCAAGCTCAAGACG
ACTGAGCAACTCTTTACCGAGCAGCAATCCCTACAGCGGAACCACAATGCCTTGCGCAGCCGCTTTCCGCCGCCC
GACATGGCTGCCATGGGCCAGGAGCTTGTTTCTCTGCACAGACGCATCGCCATTGTCGCTGTCTCTGTCGCTGCC
CTTGTAGCCTTGGCCGCCAGCTTTGTCGTTCGCTGCTCCAACCTGACGGCCTGGCTTGGGCTTGCCGTGGCTGCC
GTGGCACTCATTGCTGGTGTTCAAGACTACGCCTCGGATCAAGTCCTTTCTACCTTTAAAGACGAGATTTGGGAG
TCTCAGCGTCGACAGGTAGAGTCAAGGTCGAGCAGCTACGAGGTTGAGCCGACGGTTTGGCTCAATTCCCTCCTT
GGCTCCGTCTGGCCGCTAATCAACCCAGACCTCTTTGTGAGCCTCTCGGACACGCTCGAGGATGTTATGCAGGCC
TCTCTTCCTCGCCTCGTCCGCATGGTTAGCGTCGAGGACATTGGCCAGGGCAGCGAGGCCATTCGCATCCTTGGC
ATTCGCTGGCTGCCCACTGGCGCCGCCGCAAAGACGGTTACGCGCGACGGCAAGCTATCGTCTGACGAGAGCTAC
GACAATGATGTGGACCAGGAAAAGCCCAGGTCAGAAGAGGAAAAGGATGCAGAAAAGGCCTTTGCTGGCATGCGA
GCAGAAGAAGGCGACTTTGTCAATATGGAAGTGGCTTTTGCCTACCGCTCTCGCCCTCGGTCACACCGTATCAAG
GACCGCACCAAGAGCATGCACCTATATCTTGCCTTTTACTTGCCTGGAAACGTCAAGATTCCCGTATGGGTCGAT
CTCAGGGGCATTGTGGGCGTCTTGAGGGTGCGGCTCCAGCTGACGCCCGATCCGCCCTTCTTCTCCCTCTGCACA
TTGACCCTTCTCGGCCAGCCCAAGGTGGATCTGAGCTGCATCCCCCTCAGCCAGCGCGGCCTCAACATCATGGAC
GTGCCCCTGATTAGTAACTTTGTGCAGTCGGCCGTCGATGCCGCTGTTGCCGACTATGTGGCTCCCAAGAGCCTC
ACGCTCGATCTCAAGGACATGCTCGCTGGCGATGACTTCAAAAAGGACACAGTGTCGACGGGCGTCCTCATGGTC
AATATCAAGCGCGGCTACGACTTCAAAATGGGCGACACTGCTATTCCCCTTATTAGAGACGGCAGCTCTGATCCC
TATGTCTCTGTTGGCTGGGCCAAGTTTGGCAAGGTGCTTTGGAGCACGCGGGTGCTGGAATGCGAAATGGAGCCC
TACTGGGACGAAACCTGCTTTGTCCTTGTCACGCCCGAAGAGCTCAACATTGATGAGCGCTTGCGGGTACAGCTC
TGGGATTCGGACCGCTTCACCGCCGACGATGACTTGGGCCGCATCGAGGTGCCCTTGGCTGAGCTCTTGACGGAC
CATCGCTCACGGGCCAAGATGTGGGAGCGTGTGGATGGCTTCCGCGCCCTCAGTGCAGGAGACAATATGCCTGGC
AAGCTGGAGTGGAGTGTTGGCTATTTTGCAAAGACGGCCTTGCAGCAGTGCCAGCTGGACCTTCAGACGCATGAT
TGCAAGGTGCGGACCATGCAACAGCTGCAGGTCAAGGTGGACAAGAGCTGTGAGCGGAAACTACGGGAAATAGTA
GTCAAGCAGGGCCACGAAGAGGATGACGAGGCCGAAGTGGAGCGTCAGAGAGCCCTGGAGCTCAAGACAGAACAA
GACGCCATCATCATTTCTGCGCCGCCGCCGGATGGCTACCCCAGCGGACTGCTTAGTCTGCAGATTCACAACATC
ACGGGGCTCGAGCTTGACAAGTTGAGCAAGCGCCAGGTGGAAGACGAGGAAGAGGCCAGCGACGAAGAGGAGGCC
GGGGACAGTTTGCCGAGTGCATACTGCACCGTGATTATCAACCACAGCAAGACGTTCAAGACTCGCATCAAGCCG
CAGAATGCCAAGCCCTTTTTCAATGCTGGCTGCGAACGCTTCATCCGCGACTGGCGTGACTGCGAGGTGTTTGTC
TCGGTGCGGGATGCCAGGCTGCATGAGGAGAATCCCTTGCTTGGCATTGTGCATCTACCGCTGAGCCACGTGCTC
CGGGAGCGCTCACAGGTGATGGGGTTTTGGCCCCTGTCGGGCGGCATCGGGCACGGGCGCATCAGGCTGTCCCTG
GTGTGGCGCAGCATCAATCTACAGGTGCCGCGCAACATGCTGGGCTGGAGTTATGGGACTTTGGACGTGGAGCCT
GTGGCGACGAGCTCCGACTGCCCAGCGCAGCTCTCGTCGTGCCAGCTTAAGCTCAAGACGAATATCAGCATGGGC
AAACTTTACGCGCACCAAGGCGGCGAGGGCAAGGCGGAGTGGAGGACCAAGCGGGAGCAGAATGTCAGTCTGGCT
GTCAAGAAGCGCTATAGCAGCTGCATGTCTGTGTCGTTTCGGAACAAGAAGGGGCTTTTTGGAGACAAGGTTGCG
TCGTTTTGCGTCATGTGGCTCAAGGACATTGCGGATGAGGAAGAGCAGGAGCTTGAGCTACCCATTTGGAAGGGA
GATTTTGAGCGGGCCACGGCTTGCTGTCTGAAGGAGTGTGGCGAGCGAGTGGGCACACTGAAGCTCAAGGTGACC
TTTTTGGCTGGCATGGTGAGTTTTGTGTGTAGTCTTGACGAGGGTGCAGGCAACATGGCAAGCGGGCTAACGAGG
GCTTTGTGTTTTTTGTGCAAAGGGAAATGCCCACGCACGCTGGGCCTCTCGCAACCAAGACTTGCGCGATGTGAT
TGAGGTGATTGAAACGGCACGAGACAACCTAGACGGAGACGAGATGGAAAAAGCGGCGGGCATTGGCGATGAGGA
TGCTTCGAGCGACAGCGACAGCTCGAGCGGCGAAAAGGACGAGGCGGATGGCAAGAGCCTCAAGGAAAAGCAGAG
CACATTGGAGCAGATTCGCGACTATCGTCGCCGAGACAAGGCGCTGCATCGGCAACATCGGGGCATTATGCAGTG
GAAGGTGAGGGAGAAGCATTTTTGATTGGGAGCTGTTTTGTCTCGACAAGGCGTCTCGACTGACGCATTGCTGCA
GATTCCTCGAACAGCCAAATGGGTCAAGAACAAGTGGGGGCGGGTAGAAGACGGCGTGACGGGATTTTTCGAGCA
TGGCTCCCGACAGGCGGGCATTGAGACGGAGGTGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail