Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|4463
Gene name
LocationContig_3:216183..217271
Strand-
Gene length (bp)1088
Transcript length (bp)1008
Coding sequence length (bp)1008
Protein length (aa) 336

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08213 COX24_C Mitochondrial mRNA-processing protein COX24, C-terminal 1.3E-08 303 334

Swissprot hits

(None)

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup4608
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2460
Ophiocordyceps australis map64 (Brazil) OphauB2|4463 (this protein)
Ophiocordyceps camponoti-floridani Ophcf2|03344
Ophiocordyceps camponoti-rufipedis Ophun1|6807
Ophiocordyceps kimflemingae Ophio5|62
Ophiocordyceps subramaniannii Hirsu2|9666

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|4463
MLPTSLHRVAVAAAPQAGFAPLSVPRPAVALVALSHQRRFSSSKPSRSDKNDISAGQSVPASSSSARGSEKRKRK
AKDASDKASLFNKLPSVPSTNHMSQEALGLSSFFSLHRPISVTQTMPRKVSDEHFASIFTPRSKTGKMMDTVSTL
SNSINQLDGPMSQMTISDGDSQMSDSMQKVSLRNPDGSESSIYLQVDAMTGHFLPFCPPPLPEAEAHSSEGEAAA
ETTTEASEAMEERPMSRSYKAIFSIEETMEPDGRIRILAHSPVIVSDQHPRSFLTRMALRQIRFDEARARGRPSM
QALSTKRQRKLKIKKKKYKKLLRRTRGLRRKLDKS*
Coding >OphauB2|4463
ATGCTGCCTACATCGCTTCACCGTGTCGCCGTCGCGGCAGCTCCGCAGGCCGGCTTTGCCCCGCTGTCGGTTCCT
CGCCCTGCCGTCGCTCTCGTCGCTCTCAGCCATCAGCGGAGATTCTCCTCGTCGAAGCCGTCGCGCTCCGACAAG
AATGATATATCGGCCGGCCAGTCGGTTCCCGCCTCGTCGTCTTCGGCCCGCGGCAGCGAAAAGCGCAAGCGAAAG
GCCAAGGATGCCTCGGACAAGGCGTCCCTGTTCAACAAGTTGCCCAGCGTACCCAGCACCAACCACATGTCACAA
GAAGCCCTTGGTCTCTCGAGTTTCTTCTCGCTCCATCGCCCCATCTCGGTGACGCAGACGATGCCGCGCAAAGTG
TCGGATGAGCACTTTGCATCCATTTTTACGCCGCGCTCAAAGACGGGCAAGATGATGGACACGGTGTCCACCCTT
TCAAATTCCATCAACCAGCTCGACGGCCCCATGTCACAAATGACGATTTCGGATGGCGACTCGCAAATGTCGGAC
TCGATGCAAAAAGTGTCGCTGAGAAACCCAGACGGCAGCGAGTCGAGCATCTATCTCCAGGTCGATGCCATGACG
GGCCACTTCTTGCCCTTTTGCCCTCCGCCGCTGCCCGAGGCCGAGGCACATTCGAGCGAGGGCGAGGCTGCAGCC
GAGACGACGACCGAGGCAAGCGAAGCCATGGAGGAGCGGCCCATGTCGCGCAGCTACAAGGCCATATTTTCGATT
GAAGAGACGATGGAGCCCGACGGTCGCATCCGCATCCTTGCCCACAGCCCCGTCATTGTCAGCGACCAGCACCCG
CGCAGCTTCTTGACGCGCATGGCGCTTCGCCAGATTCGGTTTGACGAGGCGCGTGCGCGTGGGCGCCCCAGCATG
CAGGCCCTCAGCACCAAGCGGCAACGGAAGCTCAAGATTAAGAAGAAGAAGTACAAAAAGCTGTTGAGGCGGACG
CGTGGCTTGCGCCGCAAGCTGGACAAGAGCTAG
Transcript >OphauB2|4463
ATGCTGCCTACATCGCTTCACCGTGTCGCCGTCGCGGCAGCTCCGCAGGCCGGCTTTGCCCCGCTGTCGGTTCCT
CGCCCTGCCGTCGCTCTCGTCGCTCTCAGCCATCAGCGGAGATTCTCCTCGTCGAAGCCGTCGCGCTCCGACAAG
AATGATATATCGGCCGGCCAGTCGGTTCCCGCCTCGTCGTCTTCGGCCCGCGGCAGCGAAAAGCGCAAGCGAAAG
GCCAAGGATGCCTCGGACAAGGCGTCCCTGTTCAACAAGTTGCCCAGCGTACCCAGCACCAACCACATGTCACAA
GAAGCCCTTGGTCTCTCGAGTTTCTTCTCGCTCCATCGCCCCATCTCGGTGACGCAGACGATGCCGCGCAAAGTG
TCGGATGAGCACTTTGCATCCATTTTTACGCCGCGCTCAAAGACGGGCAAGATGATGGACACGGTGTCCACCCTT
TCAAATTCCATCAACCAGCTCGACGGCCCCATGTCACAAATGACGATTTCGGATGGCGACTCGCAAATGTCGGAC
TCGATGCAAAAAGTGTCGCTGAGAAACCCAGACGGCAGCGAGTCGAGCATCTATCTCCAGGTCGATGCCATGACG
GGCCACTTCTTGCCCTTTTGCCCTCCGCCGCTGCCCGAGGCCGAGGCACATTCGAGCGAGGGCGAGGCTGCAGCC
GAGACGACGACCGAGGCAAGCGAAGCCATGGAGGAGCGGCCCATGTCGCGCAGCTACAAGGCCATATTTTCGATT
GAAGAGACGATGGAGCCCGACGGTCGCATCCGCATCCTTGCCCACAGCCCCGTCATTGTCAGCGACCAGCACCCG
CGCAGCTTCTTGACGCGCATGGCGCTTCGCCAGATTCGGTTTGACGAGGCGCGTGCGCGTGGGCGCCCCAGCATG
CAGGCCCTCAGCACCAAGCGGCAACGGAAGCTCAAGATTAAGAAGAAGAAGTACAAAAAGCTGTTGAGGCGGACG
CGTGGCTTGCGCCGCAAGCTGGACAAGAGCTAG
Gene >OphauB2|4463
ATGCTGCCTACATCGCTTCACCGTGTCGCCGTCGCGGCAGCTCCGCAGGCCGGCTTTGCCCCGCTGTCGGTTCCT
CGCCCTGCCGTCGCTCTCGTCGCTCTCAGCCATCAGCGGAGATTCTCCTCGTCGAAGCCGTCGCGCTCCGACAAG
AATGATATATCGGCCGGCCAGTCGGTTCCCGCCTCGTCGTCTTCGGCCCGCGGCAGCGAAAAGCGCAAGCGAAAG
GCCAAGGATGCCTCGGACAAGGCGTCCCTGTTCAACAAGTTGCCCAGCGTACCCAGCACCAACCACATGTCACAA
GAAGGTTATTGCCGCCCCTCGCACCTTTTGCCTCGGACTTGCTACTGACTTTTTTCTTCTCCGTCTTGCTCTTGT
TTTTGCTAGCCCTTGGTCTCTCGAGTTTCTTCTCGCTCCATCGCCCCATCTCGGTGACGCAGACGATGCCGCGCA
AAGTGTCGGATGAGCACTTTGCATCCATTTTTACGCCGCGCTCAAAGACGGGCAAGATGATGGACACGGTGTCCA
CCCTTTCAAATTCCATCAACCAGCTCGACGGCCCCATGTCACAAATGACGATTTCGGATGGCGACTCGCAAATGT
CGGACTCGATGCAAAAAGTGTCGCTGAGAAACCCAGACGGCAGCGAGTCGAGCATCTATCTCCAGGTCGATGCCA
TGACGGGCCACTTCTTGCCCTTTTGCCCTCCGCCGCTGCCCGAGGCCGAGGCACATTCGAGCGAGGGCGAGGCTG
CAGCCGAGACGACGACCGAGGCAAGCGAAGCCATGGAGGAGCGGCCCATGTCGCGCAGCTACAAGGCCATATTTT
CGATTGAAGAGACGATGGAGCCCGACGGTCGCATCCGCATCCTTGCCCACAGCCCCGTCATTGTCAGCGACCAGC
ACCCGCGCAGCTTCTTGACGCGCATGGCGCTTCGCCAGATTCGGTTTGACGAGGCGCGTGCGCGTGGGCGCCCCA
GCATGCAGGCCCTCAGCACCAAGCGGCAACGGAAGCTCAAGATTAAGAAGAAGAAGTACAAAAAGCTGTTGAGGC
GGACGCGTGGCTTGCGCCGCAAGCTGGACAAGAGCTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail