Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|4459
Gene name
LocationContig_3:210466..211065
Strand+
Gene length (bp)599
Transcript length (bp)450
Coding sequence length (bp)450
Protein length (aa) 150

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00698 Acyl_transf_1 Acyl transferase domain 4.0E-18 27 120

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P19096|FAS_MOUSE Fatty acid synthase OS=Mus musculus GN=Fasn PE=1 SV=2 17 121 8.0E-15
sp|P12785|FAS_RAT Fatty acid synthase OS=Rattus norvegicus GN=Fasn PE=1 SV=3 17 121 1.0E-14
sp|P49327|FAS_HUMAN Fatty acid synthase OS=Homo sapiens GN=FASN PE=1 SV=3 18 121 1.0E-14
sp|P12276|FAS_CHICK Fatty acid synthase OS=Gallus gallus GN=FASN PE=1 SV=5 19 115 4.0E-13
sp|A1CLY8|CCSA_ASPCL Polyketide synthase-nonribosomal peptide synthetase OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=ccsA PE=3 SV=1 18 114 4.0E-13
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P19096|FAS_MOUSE Fatty acid synthase OS=Mus musculus GN=Fasn PE=1 SV=2 17 121 8.0E-15
sp|P12785|FAS_RAT Fatty acid synthase OS=Rattus norvegicus GN=Fasn PE=1 SV=3 17 121 1.0E-14
sp|P49327|FAS_HUMAN Fatty acid synthase OS=Homo sapiens GN=FASN PE=1 SV=3 18 121 1.0E-14
sp|P12276|FAS_CHICK Fatty acid synthase OS=Gallus gallus GN=FASN PE=1 SV=5 19 115 4.0E-13
sp|A1CLY8|CCSA_ASPCL Polyketide synthase-nonribosomal peptide synthetase OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=ccsA PE=3 SV=1 18 114 4.0E-13
sp|Q71SP7|FAS_BOVIN Fatty acid synthase OS=Bos taurus GN=FASN PE=2 SV=1 17 111 4.0E-13
sp|Q0C8M3|LNKS_ASPTN Lovastatin nonaketide synthase OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=lovB PE=3 SV=2 18 116 1.0E-11
sp|Q9Y8A5|LNKS_ASPTE Lovastatin nonaketide synthase OS=Aspergillus terreus GN=lovB PE=1 SV=1 18 116 1.0E-11
sp|Q4WAZ9|NRP14_ASPFU Nonribosomal peptide synthetase 14 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS14 PE=2 SV=2 18 121 3.0E-10
sp|Q9Y7D5|LOVF_ASPTE Lovastatin diketide synthase LovF OS=Aspergillus terreus GN=lovF PE=1 SV=1 17 116 6.0E-10
sp|Q869W9|PKS16_DICDI Probable polyketide synthase 16 OS=Dictyostelium discoideum GN=pks16 PE=2 SV=1 27 136 3.0E-09
sp|Q869X2|PKS17_DICDI Probable polyketide synthase 17 OS=Dictyostelium discoideum GN=pks17 PE=3 SV=1 27 136 3.0E-08
sp|Q12053|PKSL1_ASPPA Noranthrone synthase OS=Aspergillus parasiticus GN=pksL1 PE=1 SV=1 17 122 2.0E-07
sp|P22367|MSAS_PENPA 6-methylsalicylic acid synthase OS=Penicillium patulum PE=1 SV=1 21 121 2.0E-07
sp|B0G101|PKS8_DICDI Probable polyketide synthase 8/35 OS=Dictyostelium discoideum GN=pks8 PE=3 SV=1 27 141 4.0E-07
sp|B0G100|PKS7_DICDI Probable polyketide synthase 7 OS=Dictyostelium discoideum GN=pks7 PE=3 SV=1 17 141 7.0E-07
sp|Q558Y6|PKS14_DICDI Probable polyketide synthase 14 OS=Dictyostelium discoideum GN=pks14 PE=3 SV=2 32 137 8.0E-07
sp|Q86AE3|PKS9_DICDI Probable polyketide synthase 9/36 OS=Dictyostelium discoideum GN=pks9 PE=2 SV=1 27 141 4.0E-06
sp|Q558W4|PKS15_DICDI Probable polyketide synthase 15 OS=Dictyostelium discoideum GN=pks15 PE=3 SV=2 6 137 9.0E-06
[Show less]

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup1
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|201
Ophiocordyceps australis 1348a (Ghana) OphauG2|7422
Ophiocordyceps australis 1348a (Ghana) OphauG2|7411
Ophiocordyceps australis 1348a (Ghana) OphauG2|6241
Ophiocordyceps australis 1348a (Ghana) OphauG2|4898
Ophiocordyceps australis 1348a (Ghana) OphauG2|4897
Ophiocordyceps australis 1348a (Ghana) OphauG2|2708
Ophiocordyceps australis 1348a (Ghana) OphauG2|2128
Ophiocordyceps australis 1348a (Ghana) OphauG2|1191
Ophiocordyceps australis 1348a (Ghana) OphauG2|1124
Ophiocordyceps australis 1348a (Ghana) OphauG2|7710
Ophiocordyceps australis map64 (Brazil) OphauB2|4459 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|5387
Ophiocordyceps australis map64 (Brazil) OphauB2|476
Ophiocordyceps australis map64 (Brazil) OphauB2|5635
Ophiocordyceps australis map64 (Brazil) OphauB2|3063
Ophiocordyceps australis map64 (Brazil) OphauB2|5406
Ophiocordyceps australis map64 (Brazil) OphauB2|3017
Ophiocordyceps australis map64 (Brazil) OphauB2|712
Ophiocordyceps australis map64 (Brazil) OphauB2|1455
Ophiocordyceps australis map64 (Brazil) OphauB2|1454
Ophiocordyceps australis map64 (Brazil) OphauB2|6068
Ophiocordyceps australis map64 (Brazil) OphauB2|6715
Ophiocordyceps australis map64 (Brazil) OphauB2|5636
Ophiocordyceps australis map64 (Brazil) OphauB2|7340
Ophiocordyceps australis map64 (Brazil) OphauB2|7710
Ophiocordyceps australis map64 (Brazil) OphauB2|2028
Ophiocordyceps australis map64 (Brazil) OphauB2|5805
Ophiocordyceps camponoti-floridani Ophcf2|02942
Ophiocordyceps subramaniannii Hirsu2|8482
Ophiocordyceps subramaniannii Hirsu2|8480
Ophiocordyceps subramaniannii Hirsu2|7800
Ophiocordyceps subramaniannii Hirsu2|7724
Ophiocordyceps subramaniannii Hirsu2|6729
Ophiocordyceps subramaniannii Hirsu2|5683
Ophiocordyceps subramaniannii Hirsu2|5301
Ophiocordyceps subramaniannii Hirsu2|5151
Ophiocordyceps subramaniannii Hirsu2|4977
Ophiocordyceps subramaniannii Hirsu2|4297
Ophiocordyceps subramaniannii Hirsu2|4296
Ophiocordyceps subramaniannii Hirsu2|3325
Ophiocordyceps subramaniannii Hirsu2|26
Ophiocordyceps subramaniannii Hirsu2|25
Ophiocordyceps subramaniannii Hirsu2|9187
Ophiocordyceps subramaniannii Hirsu2|11188

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|4459
MASDRDHLLDIDLKGPSIVNFLARCNVTPWAVVGHSSGEIAAGYAPGVLSATEAILNAYYRGLVSQELQAFSKGA
MAAIGLGREAVAPLVHQDAVVGCENSPDSVTVSGSQDAVSNSLEAITLASSASVWLSMLHTTLARCRVGELPVD*
Coding >OphauB2|4459
ATGGCTTCAGACCGCGACCATTTACTAGACATTGACTTGAAGGGACCTAGCATTGTCAACTTTTTGGCTCGATGC
AACGTCACTCCTTGGGCAGTGGTTGGGCACTCGAGCGGCGAAATTGCAGCAGGATACGCTCCTGGAGTCTTGTCG
GCCACCGAAGCTATTCTCAACGCCTATTATCGTGGGCTCGTATCTCAGGAGCTCCAGGCTTTCTCAAAGGGTGCA
ATGGCAGCCATTGGGCTGGGCAGGGAAGCAGTAGCTCCTCTTGTCCATCAAGATGCTGTAGTGGGCTGTGAAAAC
AGTCCAGACAGCGTGACAGTTTCGGGCAGCCAAGATGCCGTGAGTAACTCGCTCGAGGCCATTACGTTGGCGTCC
TCAGCAAGCGTTTGGCTGTCAATGTTGCATACCACTCTAGCACGTTGTCGAGTTGGCGAGTTGCCTGTTGACTAA
Transcript >OphauB2|4459
ATGGCTTCAGACCGCGACCATTTACTAGACATTGACTTGAAGGGACCTAGCATTGTCAACTTTTTGGCTCGATGC
AACGTCACTCCTTGGGCAGTGGTTGGGCACTCGAGCGGCGAAATTGCAGCAGGATACGCTCCTGGAGTCTTGTCG
GCCACCGAAGCTATTCTCAACGCCTATTATCGTGGGCTCGTATCTCAGGAGCTCCAGGCTTTCTCAAAGGGTGCA
ATGGCAGCCATTGGGCTGGGCAGGGAAGCAGTAGCTCCTCTTGTCCATCAAGATGCTGTAGTGGGCTGTGAAAAC
AGTCCAGACAGCGTGACAGTTTCGGGCAGCCAAGATGCCGTGAGTAACTCGCTCGAGGCCATTACGTTGGCGTCC
TCAGCAAGCGTTTGGCTGTCAATGTTGCATACCACTCTAGCACGTTGTCGAGTTGGCGAGTTGCCTGTTGACTAA
Gene >OphauB2|4459
ATGGCTTCAGACCGCGACCATTTACTAGACATTGACTTGAAGGGACCTAGGTATGTATAATGAGCTCGTTTAAAA
GACTTTGAAGATGATGATACTGATCACCATGGGTCCTTTAGCATGACTATAAGAACTGCATGTTCCTCTTCTTTT
GTTTGCCTCGACGCGGCTTGCAAGGCTCTGACGAATAGCGAATGTTCAGCATTGTCAACTTTTTGGCTCGATGCA
ACGTCACTCCTTGGGCAGTGGTTGGGCACTCGAGCGGCGAAATTGCAGCAGGATACGCTCCTGGAGTCTTGTCGG
CCACCGAAGCTATTCTCAACGCCTATTATCGTGGGCTCGTATCTCAGGAGCTCCAGGCTTTCTCAAAGGGTGCAA
TGGCAGCCATTGGGCTGGGCAGGGAAGCAGTAGCTCCTCTTGTCCATCAAGATGCTGTAGTGGGCTGTGAAAACA
GTCCAGACAGCGTGACAGTTTCGGGCAGCCAAGATGCCGTGAGTAACTCGCTCGAGGCCATTACGTTGGCGTCCT
CAGCAAGCGTTTGGCTGTCAATGTTGCATACCACTCTAGCACGTTGTCGAGTTGGCGAGTTGCCTGTTGACTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail