Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|4459
Gene name
LocationContig_3:210466..211065
Strand+
Gene length (bp)599
Transcript length (bp)450
Coding sequence length (bp)450
Protein length (aa) 150

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00698 Acyl_transf_1 Acyl transferase domain 4.0E-18 27 120

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P19096|FAS_MOUSE Fatty acid synthase OS=Mus musculus GN=Fasn PE=1 SV=2 17 121 8.0E-15
sp|P12785|FAS_RAT Fatty acid synthase OS=Rattus norvegicus GN=Fasn PE=1 SV=3 17 121 1.0E-14
sp|P49327|FAS_HUMAN Fatty acid synthase OS=Homo sapiens GN=FASN PE=1 SV=3 18 121 1.0E-14
sp|P12276|FAS_CHICK Fatty acid synthase OS=Gallus gallus GN=FASN PE=1 SV=5 19 115 4.0E-13
sp|A1CLY8|CCSA_ASPCL Polyketide synthase-nonribosomal peptide synthetase OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=ccsA PE=3 SV=1 18 114 4.0E-13
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P19096|FAS_MOUSE Fatty acid synthase OS=Mus musculus GN=Fasn PE=1 SV=2 17 121 8.0E-15
sp|P12785|FAS_RAT Fatty acid synthase OS=Rattus norvegicus GN=Fasn PE=1 SV=3 17 121 1.0E-14
sp|P49327|FAS_HUMAN Fatty acid synthase OS=Homo sapiens GN=FASN PE=1 SV=3 18 121 1.0E-14
sp|P12276|FAS_CHICK Fatty acid synthase OS=Gallus gallus GN=FASN PE=1 SV=5 19 115 4.0E-13
sp|A1CLY8|CCSA_ASPCL Polyketide synthase-nonribosomal peptide synthetase OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=ccsA PE=3 SV=1 18 114 4.0E-13
sp|Q71SP7|FAS_BOVIN Fatty acid synthase OS=Bos taurus GN=FASN PE=2 SV=1 17 111 4.0E-13
sp|Q0C8M3|LNKS_ASPTN Lovastatin nonaketide synthase OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=lovB PE=3 SV=2 18 116 1.0E-11
sp|Q9Y8A5|LNKS_ASPTE Lovastatin nonaketide synthase OS=Aspergillus terreus GN=lovB PE=1 SV=1 18 116 1.0E-11
sp|Q4WAZ9|NRP14_ASPFU Nonribosomal peptide synthetase 14 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS14 PE=2 SV=2 18 121 3.0E-10
sp|Q9Y7D5|LOVF_ASPTE Lovastatin diketide synthase LovF OS=Aspergillus terreus GN=lovF PE=1 SV=1 17 116 6.0E-10
sp|Q869W9|PKS16_DICDI Probable polyketide synthase 16 OS=Dictyostelium discoideum GN=pks16 PE=2 SV=1 27 136 3.0E-09
sp|Q869X2|PKS17_DICDI Probable polyketide synthase 17 OS=Dictyostelium discoideum GN=pks17 PE=3 SV=1 27 136 3.0E-08
sp|Q12053|PKSL1_ASPPA Noranthrone synthase OS=Aspergillus parasiticus GN=pksL1 PE=1 SV=1 17 122 2.0E-07
sp|P22367|MSAS_PENPA 6-methylsalicylic acid synthase OS=Penicillium patulum PE=1 SV=1 21 121 2.0E-07
sp|B0G101|PKS8_DICDI Probable polyketide synthase 8/35 OS=Dictyostelium discoideum GN=pks8 PE=3 SV=1 27 141 4.0E-07
sp|B0G100|PKS7_DICDI Probable polyketide synthase 7 OS=Dictyostelium discoideum GN=pks7 PE=3 SV=1 17 141 7.0E-07
sp|Q558Y6|PKS14_DICDI Probable polyketide synthase 14 OS=Dictyostelium discoideum GN=pks14 PE=3 SV=2 32 137 8.0E-07
sp|Q86AE3|PKS9_DICDI Probable polyketide synthase 9/36 OS=Dictyostelium discoideum GN=pks9 PE=2 SV=1 27 141 4.0E-06
sp|Q558W4|PKS15_DICDI Probable polyketide synthase 15 OS=Dictyostelium discoideum GN=pks15 PE=3 SV=2 6 137 9.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 51 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|4459
MASDRDHLLDIDLKGPSIVNFLARCNVTPWAVVGHSSGEIAAGYAPGVLSATEAILNAYYRGLVSQELQAFSKGA
MAAIGLGREAVAPLVHQDAVVGCENSPDSVTVSGSQDAVSNSLEAITLASSASVWLSMLHTTLARCRVGELPVD*
Coding >OphauB2|4459
ATGGCTTCAGACCGCGACCATTTACTAGACATTGACTTGAAGGGACCTAGCATTGTCAACTTTTTGGCTCGATGC
AACGTCACTCCTTGGGCAGTGGTTGGGCACTCGAGCGGCGAAATTGCAGCAGGATACGCTCCTGGAGTCTTGTCG
GCCACCGAAGCTATTCTCAACGCCTATTATCGTGGGCTCGTATCTCAGGAGCTCCAGGCTTTCTCAAAGGGTGCA
ATGGCAGCCATTGGGCTGGGCAGGGAAGCAGTAGCTCCTCTTGTCCATCAAGATGCTGTAGTGGGCTGTGAAAAC
AGTCCAGACAGCGTGACAGTTTCGGGCAGCCAAGATGCCGTGAGTAACTCGCTCGAGGCCATTACGTTGGCGTCC
TCAGCAAGCGTTTGGCTGTCAATGTTGCATACCACTCTAGCACGTTGTCGAGTTGGCGAGTTGCCTGTTGACTAA
Transcript >OphauB2|4459
ATGGCTTCAGACCGCGACCATTTACTAGACATTGACTTGAAGGGACCTAGCATTGTCAACTTTTTGGCTCGATGC
AACGTCACTCCTTGGGCAGTGGTTGGGCACTCGAGCGGCGAAATTGCAGCAGGATACGCTCCTGGAGTCTTGTCG
GCCACCGAAGCTATTCTCAACGCCTATTATCGTGGGCTCGTATCTCAGGAGCTCCAGGCTTTCTCAAAGGGTGCA
ATGGCAGCCATTGGGCTGGGCAGGGAAGCAGTAGCTCCTCTTGTCCATCAAGATGCTGTAGTGGGCTGTGAAAAC
AGTCCAGACAGCGTGACAGTTTCGGGCAGCCAAGATGCCGTGAGTAACTCGCTCGAGGCCATTACGTTGGCGTCC
TCAGCAAGCGTTTGGCTGTCAATGTTGCATACCACTCTAGCACGTTGTCGAGTTGGCGAGTTGCCTGTTGACTAA
Gene >OphauB2|4459
ATGGCTTCAGACCGCGACCATTTACTAGACATTGACTTGAAGGGACCTAGGTATGTATAATGAGCTCGTTTAAAA
GACTTTGAAGATGATGATACTGATCACCATGGGTCCTTTAGCATGACTATAAGAACTGCATGTTCCTCTTCTTTT
GTTTGCCTCGACGCGGCTTGCAAGGCTCTGACGAATAGCGAATGTTCAGCATTGTCAACTTTTTGGCTCGATGCA
ACGTCACTCCTTGGGCAGTGGTTGGGCACTCGAGCGGCGAAATTGCAGCAGGATACGCTCCTGGAGTCTTGTCGG
CCACCGAAGCTATTCTCAACGCCTATTATCGTGGGCTCGTATCTCAGGAGCTCCAGGCTTTCTCAAAGGGTGCAA
TGGCAGCCATTGGGCTGGGCAGGGAAGCAGTAGCTCCTCTTGTCCATCAAGATGCTGTAGTGGGCTGTGAAAACA
GTCCAGACAGCGTGACAGTTTCGGGCAGCCAAGATGCCGTGAGTAACTCGCTCGAGGCCATTACGTTGGCGTCCT
CAGCAAGCGTTTGGCTGTCAATGTTGCATACCACTCTAGCACGTTGTCGAGTTGGCGAGTTGCCTGTTGACTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail