Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|4458
Gene name
LocationContig_3:205911..209325
Strand-
Gene length (bp)3414
Transcript length (bp)3198
Coding sequence length (bp)3198
Protein length (aa) 1066

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13718 GNAT_acetyltr_2 GNAT acetyltransferase 2 1.3E-99 538 767
PF13725 tRNA_bind_2 Possible tRNA binding domain 6.3E-90 775 1012
PF05127 Helicase_RecD Helicase 1.8E-64 282 496
PF08351 TmcA_N tRNA(Met) cytidine acetyltransferase TmcA, N-terminal 4.3E-57 9 202

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P87115|NAT10_SCHPO RNA cytidine acetyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=nat10 PE=1 SV=1 1 1039 0.0E+00
sp|Q9H0A0|NAT10_HUMAN RNA cytidine acetyltransferase OS=Homo sapiens GN=NAT10 PE=1 SV=2 1 1037 0.0E+00
sp|Q55EJ3|NAT10_DICDI RNA cytidine acetyltransferase OS=Dictyostelium discoideum GN=nat10 PE=3 SV=1 1 1013 0.0E+00
sp|Q8K224|NAT10_MOUSE RNA cytidine acetyltransferase OS=Mus musculus GN=Nat10 PE=1 SV=1 1 1037 0.0E+00
sp|O01757|NAT10_CAEEL RNA cytidine acetyltransferase OS=Caenorhabditis elegans GN=nath-10 PE=3 SV=1 3 1043 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P87115|NAT10_SCHPO RNA cytidine acetyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=nat10 PE=1 SV=1 1 1039 0.0E+00
sp|Q9H0A0|NAT10_HUMAN RNA cytidine acetyltransferase OS=Homo sapiens GN=NAT10 PE=1 SV=2 1 1037 0.0E+00
sp|Q55EJ3|NAT10_DICDI RNA cytidine acetyltransferase OS=Dictyostelium discoideum GN=nat10 PE=3 SV=1 1 1013 0.0E+00
sp|Q8K224|NAT10_MOUSE RNA cytidine acetyltransferase OS=Mus musculus GN=Nat10 PE=1 SV=1 1 1037 0.0E+00
sp|O01757|NAT10_CAEEL RNA cytidine acetyltransferase OS=Caenorhabditis elegans GN=nath-10 PE=3 SV=1 3 1043 0.0E+00
sp|Q9W3C1|NAT10_DROME RNA cytidine acetyltransferase OS=Drosophila melanogaster GN=l(1)G0020 PE=1 SV=2 1 1011 0.0E+00
sp|Q9XIK4|NT101_ARATH RNA cytidine acetyltransferase 1 OS=Arabidopsis thaliana GN=At1g10490 PE=2 SV=2 3 1040 0.0E+00
sp|Q9M2Q4|NT102_ARATH RNA cytidine acetyltransferase 2 OS=Arabidopsis thaliana GN=At3g57940 PE=2 SV=2 3 1007 0.0E+00
sp|P53914|NAT10_YEAST RNA cytidine acetyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NAT10 PE=1 SV=1 1 1065 0.0E+00
sp|P54008|NAT10_ACHAM RNA cytidine acetyltransferase (Fragment) OS=Achlya ambisexualis PE=3 SV=1 465 795 3.0E-105
sp|Q8TYZ5|TMCA_METKA tRNA(Met) cytidine acetyltransferase TmcA OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) GN=tmcA PE=3 SV=1 79 866 2.0E-68
sp|Q9UZ78|TMCA_PYRAB tRNA(Met) cytidine acetyltransferase TmcA OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=tmcA PE=3 SV=1 108 659 1.0E-57
sp|A1RY08|TMCA_THEPD tRNA(Met) cytidine acetyltransferase TmcA OS=Thermofilum pendens (strain Hrk 5) GN=tmcA PE=3 SV=1 19 923 2.0E-53
sp|D5C1K8|TMCA_NITHN tRNA(Met) cytidine acetyltransferase TmcA OS=Nitrosococcus halophilus (strain Nc4) GN=tmcA PE=3 SV=1 256 925 2.0E-40
sp|C3N792|TMCA_SULIY tRNA(Met) cytidine acetyltransferase TmcA OS=Sulfolobus islandicus (strain Y.G.57.14 / Yellowstone #1) GN=tmcA PE=3 SV=1 108 694 4.0E-36
sp|D4GW73|TMCA_HALVD tRNA(Met) cytidine acetyltransferase TmcA OS=Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2) GN=tmcA PE=3 SV=1 109 771 2.0E-31
sp|Q5V5M5|TMCA_HALMA tRNA(Met) cytidine acetyltransferase TmcA OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=tmcA PE=3 SV=1 112 792 4.0E-30
sp|Q9KKJ5|TMCA_VIBCH tRNA(Met) cytidine acetyltransferase TmcA OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=tmcA PE=3 SV=1 280 666 4.0E-26
sp|Q9YBQ6|TMCA_AERPE tRNA(Met) cytidine acetyltransferase TmcA OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=tmcA PE=3 SV=1 112 621 3.0E-21
sp|A8ADB3|TMCA_CITK8 tRNA(Met) cytidine acetyltransferase TmcA OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=tmcA PE=3 SV=1 278 664 6.0E-17
sp|P76562|TMCA_ECOLI tRNA(Met) cytidine acetyltransferase TmcA OS=Escherichia coli (strain K12) GN=tmcA PE=1 SV=1 280 663 1.0E-15
sp|Q7VLN6|TMCA_HAEDU tRNA(Met) cytidine acetyltransferase TmcA OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=tmcA PE=3 SV=1 383 771 3.0E-14
[Show less]

GO

GO Term Description Terminal node
GO:0008080 N-acetyltransferase activity Yes
GO:0003824 catalytic activity No
GO:0016407 acetyltransferase activity No
GO:0016746 acyltransferase activity No
GO:0003674 molecular_function No
GO:0016410 N-acyltransferase activity No
GO:0016740 transferase activity No
GO:0016747 acyltransferase activity, transferring groups other than amino-acyl groups No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup4609
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2458
Ophiocordyceps australis map64 (Brazil) OphauB2|4458 (this protein)
Ophiocordyceps camponoti-floridani Ophcf2|03345
Ophiocordyceps camponoti-rufipedis Ophun1|6806
Ophiocordyceps kimflemingae Ophio5|61
Ophiocordyceps subramaniannii Hirsu2|9667

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|4458
MQRKQVDQRIPTLIRNGLQDKKRSFFVVVGDHCKDVIVHLHYIMSSMDIKQNKSVLWAYKNKLLGFTSHRKKREQ
KIKKEIRRGIREANSEDPFELFVSLHNIRYTYYKETDKILGNTFGMCILQDFEALTPNILARTMETVEGGGLVVM
LLKGMNSLRQLYNLSMDVHSRYRTEAHTDVVARFNERFLLSLGRCDSCLVIDDELNVLPISGAKDVKPLPPPDLN
QPKTARQIELETLKEEKREEEPLGSLLGLAKTVDQAKALVTFTESIAEKTLRSTVALTAARGRGKSAALGVAVAA
AVAYGYSNIFITSPSPENLKTLFEFIFKGFDALGYADHADYSIIQSTNPDFNKAIVRVNIHRQHRQTIQYIRPQD
AHVLGQAELVVIDEAAAIPLPLVRKLMGPYLVFMASTINGYEGTGRSLSLKLIKQLREQSRSASIATDGQGRLVD
GSKREAVGNDEFQTARKLREMSLEEPIRYSRGDGVEKWLNKLLCLDATLPKAKSSSHGCPDPTQCELVMVNRDTL
FSFHPVSEAFLHQMVALYVASHYKNSPDDLQLMSDAPAHELFVLVPPNVENSGKLPEPLCVIQVALEGKISRQSV
LNSLSRGQRPHGDLIPWLVSQQFQDDEFASLSGARIVRIATNPEYVAMGYGTKALHLLVDYYEGRFISLSEEEDA
APVVVRRVKDDELAKTSLLQEEITVRDQGQMPPLFAKLHEKKPQALDYMGVSYGLTPSLHRFWKRATFSPVYLRQ
TANDLTGEHTCVMLRSLQNSGDASWLGAFSRDFHKRFLSLLSYHFRVFPSITALSLDESANAGARLDSAEIAPLD
KTEMDRQFSPFDLKRLESYANNMLDYHVILDLLPTIATWYFSGKLRADIKLTGVQQCILLALGLQRKDVEAVAQE
LSLPTSQLLAMFIKILRKMTSHFGSLVSAAVDAEMPKAEKLGVTRENANGAHDDEVVDTRFVALAESLNDELEQG
GDEALVALREKQRQLIDSLPLDQFEIEGDAPAWQEAEKQVRKAAKEGKTSVVVSVKSGKAKRKAGQTAAEIYDEV
LGDKARKKSKKGKKA*
Coding >OphauB2|4458
ATGCAGCGCAAGCAAGTAGACCAGCGCATTCCGACGCTGATCCGCAATGGCCTGCAAGACAAGAAGAGGAGCTTC
TTTGTCGTTGTCGGCGACCACTGCAAAGATGTCATTGTTCACCTGCACTACATCATGTCCAGCATGGACATTAAA
CAGAACAAGTCGGTGCTTTGGGCATACAAGAATAAGCTGCTCGGCTTCACCAGTCACCGCAAAAAACGCGAACAA
AAAATAAAAAAAGAAATTAGGCGAGGCATTCGCGAGGCCAACTCGGAAGACCCATTCGAGCTCTTCGTCTCTCTG
CACAACATTCGCTATACCTACTACAAGGAGACGGACAAGATTCTGGGCAACACGTTCGGCATGTGCATTCTTCAG
GATTTTGAGGCCCTGACACCCAATATCTTGGCTCGAACCATGGAGACAGTCGAGGGCGGCGGTCTGGTCGTCATG
CTGCTCAAGGGAATGAATAGCCTAAGACAACTATATAATCTGTCCATGGACGTCCATTCACGTTATCGCACGGAA
GCCCACACCGATGTTGTGGCCAGATTTAACGAGCGATTCCTGCTCTCCCTCGGTCGCTGTGACTCTTGTCTTGTC
ATCGATGACGAGCTCAACGTGCTGCCCATTTCAGGAGCCAAGGACGTCAAACCTCTGCCTCCTCCAGACCTGAAT
CAGCCAAAAACGGCCCGACAGATAGAGCTGGAGACCCTCAAGGAAGAAAAAAGAGAAGAGGAGCCGCTGGGCTCG
CTTCTCGGGCTTGCCAAGACTGTTGATCAGGCCAAGGCCCTCGTCACCTTTACAGAGTCTATTGCGGAAAAGACA
CTGAGAAGTACCGTTGCCCTTACTGCTGCCAGAGGTCGAGGCAAATCCGCTGCTCTGGGAGTTGCTGTAGCCGCG
GCCGTGGCTTACGGCTATAGCAACATATTCATCACGTCTCCATCTCCCGAAAATCTCAAAACCCTCTTCGAATTC
ATCTTCAAGGGCTTTGATGCCTTGGGATACGCCGATCATGCCGACTACTCCATCATCCAAAGCACCAATCCCGAC
TTCAACAAGGCCATTGTGCGTGTCAATATCCACAGACAGCATCGACAGACGATTCAGTATATCCGGCCTCAAGAT
GCTCACGTGCTCGGCCAAGCTGAGCTAGTGGTTATTGATGAAGCGGCCGCTATTCCTCTTCCCTTGGTTCGCAAG
CTCATGGGCCCTTATCTGGTGTTTATGGCGTCGACCATTAATGGCTATGAAGGAACAGGGCGGTCTCTGTCATTG
AAGCTCATCAAGCAATTACGGGAGCAGTCAAGATCGGCTTCTATAGCGACGGATGGACAAGGTCGGCTAGTTGAC
GGTTCAAAAAGAGAGGCGGTGGGAAACGACGAGTTTCAGACGGCAAGAAAACTTCGAGAAATGAGCCTCGAGGAG
CCTATTCGCTACTCACGTGGAGACGGCGTTGAAAAGTGGCTCAACAAGTTGCTCTGTCTCGACGCTACGCTCCCC
AAGGCCAAGTCGAGCAGCCACGGTTGCCCAGATCCTACCCAATGTGAACTCGTCATGGTTAACCGCGATACCCTC
TTTTCCTTCCATCCTGTATCCGAGGCCTTTTTGCACCAAATGGTGGCCTTGTACGTTGCGAGCCACTACAAAAAC
TCGCCCGATGACTTGCAGCTCATGAGCGATGCCCCAGCGCATGAGTTGTTTGTTTTGGTGCCTCCAAATGTGGAA
AACAGTGGCAAGCTTCCGGAGCCGTTGTGCGTCATACAAGTCGCTCTGGAAGGCAAAATTAGTCGACAGAGCGTG
CTCAACAGCTTGAGTCGAGGACAAAGACCGCACGGTGACTTGATACCATGGCTTGTGAGTCAGCAGTTCCAGGAC
GACGAGTTTGCTTCGCTGTCTGGCGCTCGTATTGTCCGCATCGCAACCAATCCCGAGTACGTGGCCATGGGATAC
GGCACCAAGGCACTACATCTTCTTGTTGACTACTATGAGGGCCGCTTCATTAGCTTGTCTGAAGAGGAAGACGCA
GCACCCGTTGTTGTGCGCCGCGTCAAGGACGATGAATTGGCCAAGACATCGCTGCTCCAAGAAGAAATCACAGTC
AGAGATCAGGGCCAAATGCCTCCTCTTTTTGCCAAATTGCATGAGAAGAAACCCCAGGCTCTCGACTACATGGGT
GTTAGTTACGGCCTGACGCCTAGTCTACACAGATTTTGGAAGCGAGCCACTTTTTCACCCGTCTACCTACGCCAA
ACGGCCAATGACCTGACAGGCGAGCACACGTGTGTCATGCTGCGGTCTCTACAGAATAGCGGAGATGCGTCGTGG
CTTGGGGCATTCTCGCGTGACTTTCATAAGCGCTTTCTCTCTCTGCTCTCCTATCACTTTCGCGTCTTTCCTTCA
ATTACAGCTCTCAGCCTTGATGAGTCTGCCAATGCCGGCGCCCGGCTCGACTCGGCCGAGATTGCGCCTTTGGAC
AAGACTGAGATGGATCGACAATTTTCGCCCTTTGATCTCAAGCGGCTCGAGTCGTATGCCAATAACATGCTGGAC
TACCATGTCATTCTTGATTTGCTGCCCACGATTGCCACTTGGTACTTTTCGGGCAAGCTCAGGGCGGATATCAAG
TTGACTGGCGTTCAGCAATGCATTCTGCTCGCTCTTGGGCTGCAGCGCAAAGATGTTGAAGCCGTGGCCCAGGAG
CTCTCCTTGCCGACATCACAGCTCCTGGCCATGTTTATTAAAATCCTGCGCAAGATGACTTCACACTTTGGCTCC
CTAGTATCAGCTGCTGTGGATGCAGAGATGCCCAAGGCTGAGAAGCTTGGAGTGACGAGGGAAAATGCAAATGGT
GCACACGATGACGAAGTGGTGGATACGCGCTTCGTTGCCTTGGCGGAAAGTCTCAACGACGAGCTGGAACAAGGC
GGAGACGAGGCTCTTGTGGCGCTCAGGGAGAAGCAGAGACAGCTCATTGACTCGCTGCCTCTGGACCAATTTGAA
ATCGAGGGAGACGCACCCGCATGGCAAGAAGCAGAGAAGCAGGTGCGCAAGGCCGCCAAGGAGGGCAAGACGAGC
GTCGTGGTGAGCGTCAAGTCGGGCAAGGCCAAGAGAAAAGCAGGCCAAACGGCGGCTGAGATTTACGACGAGGTT
CTCGGCGACAAGGCGCGCAAAAAGTCGAAAAAGGGCAAGAAGGCCTAG
Transcript >OphauB2|4458
ATGCAGCGCAAGCAAGTAGACCAGCGCATTCCGACGCTGATCCGCAATGGCCTGCAAGACAAGAAGAGGAGCTTC
TTTGTCGTTGTCGGCGACCACTGCAAAGATGTCATTGTTCACCTGCACTACATCATGTCCAGCATGGACATTAAA
CAGAACAAGTCGGTGCTTTGGGCATACAAGAATAAGCTGCTCGGCTTCACCAGTCACCGCAAAAAACGCGAACAA
AAAATAAAAAAAGAAATTAGGCGAGGCATTCGCGAGGCCAACTCGGAAGACCCATTCGAGCTCTTCGTCTCTCTG
CACAACATTCGCTATACCTACTACAAGGAGACGGACAAGATTCTGGGCAACACGTTCGGCATGTGCATTCTTCAG
GATTTTGAGGCCCTGACACCCAATATCTTGGCTCGAACCATGGAGACAGTCGAGGGCGGCGGTCTGGTCGTCATG
CTGCTCAAGGGAATGAATAGCCTAAGACAACTATATAATCTGTCCATGGACGTCCATTCACGTTATCGCACGGAA
GCCCACACCGATGTTGTGGCCAGATTTAACGAGCGATTCCTGCTCTCCCTCGGTCGCTGTGACTCTTGTCTTGTC
ATCGATGACGAGCTCAACGTGCTGCCCATTTCAGGAGCCAAGGACGTCAAACCTCTGCCTCCTCCAGACCTGAAT
CAGCCAAAAACGGCCCGACAGATAGAGCTGGAGACCCTCAAGGAAGAAAAAAGAGAAGAGGAGCCGCTGGGCTCG
CTTCTCGGGCTTGCCAAGACTGTTGATCAGGCCAAGGCCCTCGTCACCTTTACAGAGTCTATTGCGGAAAAGACA
CTGAGAAGTACCGTTGCCCTTACTGCTGCCAGAGGTCGAGGCAAATCCGCTGCTCTGGGAGTTGCTGTAGCCGCG
GCCGTGGCTTACGGCTATAGCAACATATTCATCACGTCTCCATCTCCCGAAAATCTCAAAACCCTCTTCGAATTC
ATCTTCAAGGGCTTTGATGCCTTGGGATACGCCGATCATGCCGACTACTCCATCATCCAAAGCACCAATCCCGAC
TTCAACAAGGCCATTGTGCGTGTCAATATCCACAGACAGCATCGACAGACGATTCAGTATATCCGGCCTCAAGAT
GCTCACGTGCTCGGCCAAGCTGAGCTAGTGGTTATTGATGAAGCGGCCGCTATTCCTCTTCCCTTGGTTCGCAAG
CTCATGGGCCCTTATCTGGTGTTTATGGCGTCGACCATTAATGGCTATGAAGGAACAGGGCGGTCTCTGTCATTG
AAGCTCATCAAGCAATTACGGGAGCAGTCAAGATCGGCTTCTATAGCGACGGATGGACAAGGTCGGCTAGTTGAC
GGTTCAAAAAGAGAGGCGGTGGGAAACGACGAGTTTCAGACGGCAAGAAAACTTCGAGAAATGAGCCTCGAGGAG
CCTATTCGCTACTCACGTGGAGACGGCGTTGAAAAGTGGCTCAACAAGTTGCTCTGTCTCGACGCTACGCTCCCC
AAGGCCAAGTCGAGCAGCCACGGTTGCCCAGATCCTACCCAATGTGAACTCGTCATGGTTAACCGCGATACCCTC
TTTTCCTTCCATCCTGTATCCGAGGCCTTTTTGCACCAAATGGTGGCCTTGTACGTTGCGAGCCACTACAAAAAC
TCGCCCGATGACTTGCAGCTCATGAGCGATGCCCCAGCGCATGAGTTGTTTGTTTTGGTGCCTCCAAATGTGGAA
AACAGTGGCAAGCTTCCGGAGCCGTTGTGCGTCATACAAGTCGCTCTGGAAGGCAAAATTAGTCGACAGAGCGTG
CTCAACAGCTTGAGTCGAGGACAAAGACCGCACGGTGACTTGATACCATGGCTTGTGAGTCAGCAGTTCCAGGAC
GACGAGTTTGCTTCGCTGTCTGGCGCTCGTATTGTCCGCATCGCAACCAATCCCGAGTACGTGGCCATGGGATAC
GGCACCAAGGCACTACATCTTCTTGTTGACTACTATGAGGGCCGCTTCATTAGCTTGTCTGAAGAGGAAGACGCA
GCACCCGTTGTTGTGCGCCGCGTCAAGGACGATGAATTGGCCAAGACATCGCTGCTCCAAGAAGAAATCACAGTC
AGAGATCAGGGCCAAATGCCTCCTCTTTTTGCCAAATTGCATGAGAAGAAACCCCAGGCTCTCGACTACATGGGT
GTTAGTTACGGCCTGACGCCTAGTCTACACAGATTTTGGAAGCGAGCCACTTTTTCACCCGTCTACCTACGCCAA
ACGGCCAATGACCTGACAGGCGAGCACACGTGTGTCATGCTGCGGTCTCTACAGAATAGCGGAGATGCGTCGTGG
CTTGGGGCATTCTCGCGTGACTTTCATAAGCGCTTTCTCTCTCTGCTCTCCTATCACTTTCGCGTCTTTCCTTCA
ATTACAGCTCTCAGCCTTGATGAGTCTGCCAATGCCGGCGCCCGGCTCGACTCGGCCGAGATTGCGCCTTTGGAC
AAGACTGAGATGGATCGACAATTTTCGCCCTTTGATCTCAAGCGGCTCGAGTCGTATGCCAATAACATGCTGGAC
TACCATGTCATTCTTGATTTGCTGCCCACGATTGCCACTTGGTACTTTTCGGGCAAGCTCAGGGCGGATATCAAG
TTGACTGGCGTTCAGCAATGCATTCTGCTCGCTCTTGGGCTGCAGCGCAAAGATGTTGAAGCCGTGGCCCAGGAG
CTCTCCTTGCCGACATCACAGCTCCTGGCCATGTTTATTAAAATCCTGCGCAAGATGACTTCACACTTTGGCTCC
CTAGTATCAGCTGCTGTGGATGCAGAGATGCCCAAGGCTGAGAAGCTTGGAGTGACGAGGGAAAATGCAAATGGT
GCACACGATGACGAAGTGGTGGATACGCGCTTCGTTGCCTTGGCGGAAAGTCTCAACGACGAGCTGGAACAAGGC
GGAGACGAGGCTCTTGTGGCGCTCAGGGAGAAGCAGAGACAGCTCATTGACTCGCTGCCTCTGGACCAATTTGAA
ATCGAGGGAGACGCACCCGCATGGCAAGAAGCAGAGAAGCAGGTGCGCAAGGCCGCCAAGGAGGGCAAGACGAGC
GTCGTGGTGAGCGTCAAGTCGGGCAAGGCCAAGAGAAAAGCAGGCCAAACGGCGGCTGAGATTTACGACGAGGTT
CTCGGCGACAAGGCGCGCAAAAAGTCGAAAAAGGGCAAGAAGGCCTAG
Gene >OphauB2|4458
ATGCAGCGCAAGCAAGTGTATGGTACCTCGGTCTTCCTCATGGCTTCTAGATGCTAATCGATGCTTTATTAGAGA
CCAGCGCATTCCGACGCTGATCCGCAATGGCCTGCAAGACAAGAAGAGGAGCTTCTTTGTCGTTGTCGGCGACCA
CTGCAAAGATGTCATTGTTCACCTGCACTACATCATGTCCAGCATGGACATTAAACAGAACAAGTCGGTGCTTTG
GGCATACAAGAATAAGCTGCTCGGCTTCACCAGGTGCGCCCTGCTATCCCATTTGCTCAGCTTCTGCCCAGCTTC
TACCCCCCCTCCTTGTCTGTGCTGACATTGTATGCCAATAGTCACCGCAAAAAACGCGAACAAAAAATAAAAAAA
GAAATTAGGCGAGGCATTCGCGAGGCCAACTCGGAAGACCCATTCGAGCTCTTCGTCTCTCTGCACAACATTCGC
TATACCTACTACAAGGAGACGGACAAGATTCTGGGCAACACGTTCGGCATGTGCATTCTTCAGGATTTTGAGGCC
CTGACACCCAATATCTTGGCTCGAACCATGGAGACAGTCGAGGGCGGCGGTCTGGTCGTCATGCTGCTCAAGGGA
ATGAATAGCCTAAGACAACTATATAATCTGTCCATGGACGTCCATTCACGTTATCGCACGGAAGCCCACACCGAT
GTTGTGGCCAGATTTAACGAGCGATTCCTGCTCTCCCTCGGTCGCTGTGACTCTTGTCTTGTCATCGATGACGAG
CTCAACGTGCTGCCCATTTCAGGAGCCAAGGACGTCAAACCTCTGCCTCCTCCAGACCTGAATCAGCCAAAAACG
GCCCGACAGATAGAGCTGGAGACCCTCAAGGAAGAAAAAAGAGAAGAGGAGCCGCTGGGCTCGCTTCTCGGGCTT
GCCAAGACTGTTGATCAGGCCAAGGCCCTCGTCACCTTTACAGAGTCTATTGCGGAAAAGACACTGAGAAGTACC
GTTGCCCTTACTGCTGCCAGAGGTCGAGGCAAATCCGCTGCTCTGGGAGTTGCTGTAGCCGCGGCCGTGGCTTAC
GGCTATAGCAACATATTCATCACGTCTCCATCTCCCGAAAATCTCAAAACCCTCTTCGAATTCATCTTCAAGGGC
TTTGATGCCTTGGGATACGCCGATCATGCCGACTACTCCATCATCCAAAGCACCAATCCCGACTTCAACAAGGCC
ATTGTGCGTGTCAATATCCACAGACAGCATCGACAGACGATTCAGTATATCCGGCCTCAAGATGCTCACGTGCTC
GGCCAAGCTGAGCTAGTGGTTATTGATGAAGCGGCCGCTATTCCTCTTCCCTTGGTTCGCAAGCTCATGGGCCCT
TATCTGGTGTTTATGGCGTCGACCATTAATGGCTATGAAGGAACAGGGCGGTCTCTGTCATTGAAGCTCATCAAG
CAATTACGGGAGCAGTCAAGATCGGCTTCTATAGCGACGGATGGACAAGGTCGGCTAGTTGACGGTTCAAAAAGA
GAGGCGGTGGGAAACGACGAGTTTCAGACGGCAAGAAAACTTCGAGAAATGAGCCTCGAGGAGCCTATTCGCTAC
TCACGTGGAGACGGCGTTGAAAAGTGGCTCAACAAGTTGCTCTGTCTCGACGCTACGCTCCCCAAGGCCAAGTCG
AGCAGCCACGGTTGCCCAGATCCTACCCAATGTGAACTCGTCATGGTTAACCGCGATACCCTCTTTTCCTTCCAT
CCTGTATCCGAGGCCTTTTTGCACCAAATGGTGGCCTTGTACGTTGCGAGCCACTACAAAAACTCGCCCGATGAC
TTGCAGCTCATGAGCGATGCCCCAGCGCATGAGTTGTTTGTTTTGGTGCCTCCAAATGTGGAAAACAGTGGCAAG
CTTCCGGAGCCGTTGTGCGTCATACAAGTCGCTCTGGAAGGCAAAATTAGTCGACAGAGCGTGCTCAACAGCTTG
AGTCGAGGACAAAGACCGCACGGTGACTTGATACCATGGCTTGTGAGTCAGCAGTTCCAGGACGACGAGTTTGCT
TCGCTGTCTGGCGCTCGTATTGTCCGCATCGCAACCAATCCCGAGTACGTGGCCATGGGATACGGCACCAAGGCA
CTACATCTTCTTGTTGACTACTATGAGGGCCGCTTCATTAGCTTGTCTGAAGAGGAAGACGCAGCACCCGTTGTT
GTGCGCCGCGTCAAGGACGATGAATTGGCCAAGACATCGCTGCTCCAAGAAGAAATCACAGTCAGAGATCAGGGC
CAAATGCCTCCTCTTTTTGCCAAATTGCATGAGAAGAAACCCCAGGCTCTCGACTACATGGGTGTTAGTTACGGC
CTGACGCCTAGTCTACACAGATTTTGGAAGCGAGCCACTTTTTCACCCGTCTACCTACGCCAAACGGCCAATGAC
CTGACAGGCGAGCACACGTGTGTCATGCTGCGGTCTCTACAGAATAGCGGAGATGCGTCGTGGCTTGGGGCATTC
TCGCGTGACTTTCATAAGCGCTTTCTCTCTCTGCTCTCCTATCACTTTCGCGTCTTTCCTTCAATTACAGCTCTC
AGCCTTGATGAGTCTGCCAATGCCGGCGCCCGGCTCGACTCGGCCGAGATTGCGCCTTTGGACAAGACTGAGATG
GATCGACAATTTTCGCCCTTTGATCTCAAGCGGCTCGAGTCGTATGCCAATAACATGCTGGACTACCATGTCATT
CTTGATTTGCTGCCCACGATTGCCACTTGGTACTTTTCGGGCAAGCTCAGGGCGGATATCAAGTTGACTGGCGTT
CAGCAATGCATTCTGCTCGCTCTTGGGCTGCAGCGCAAAGATGTTGAAGCCGTGGCCCAGGAGCTCTCCTTGCCG
ACATCACAGCTCCTGGCCATGTTTATTAAAATCCTGCGCAAGATGACTTCACACTTTGGCTCCCTAGTATCAGCT
GCTGTGGATGCAGAGATGCCCAAGGCTGAGAAGCTTGGAGTGACGAGGGAAAATGCAAATGGTGCACACGATGAC
GAAGTGGTGGATACGCGCTTCGTTGCCTTGGCGGAAAGTCTCAACGACGAGCTGGAACAAGGCGGAGACGAGGCT
CTTGTGGCGCTCAGGGAGAAGCAGAGACAGCTCATTGACTCGCTGCCTCTGGACCAGTAAGAGGCCCGTTTGGTC
AAGACTGCTTGCTCTCTTTGGTCCTCAAGAGTCTGTTTTGCCACTAACAGCTCGAGCAGATTTGAAATCGAGGGA
GACGCACCCGCATGGCAAGAAGCAGAGAAGCAGGTGCGCAAGGCCGCCAAGGAGGGCAAGACGAGCGTCGTGGTG
AGCGTCAAGTCGGGCAAGGCCAAGAGAAAAGCAGGCCAAACGGCGGCTGAGATTTACGACGAGGTTCTCGGCGAC
AAGGCGCGCAAAAAGTCGAAAAAGGGCAAGAAGGCCTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail