Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|4451
Gene name
LocationContig_3:186908..188471
Strand-
Gene length (bp)1563
Transcript length (bp)1563
Coding sequence length (bp)1563
Protein length (aa) 521

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00018 SH3_1 SH3 domain 1.1E-08 316 362
PF07653 SH3_2 Variant SH3 domain 2.6E-05 315 367

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q12163|NBP2_YEAST NAP1-binding protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NBP2 PE=1 SV=1 260 370 7.0E-17
sp|Q9US59|SKB5_SCHPO Shk1 kinase-binding protein 5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=skb5 PE=1 SV=1 252 368 2.0E-07

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0003674 molecular_function No
GO:0005488 binding No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup3782
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5259
Ophiocordyceps australis map64 (Brazil) OphauB2|4451 (this protein)
Ophiocordyceps camponoti-floridani Ophcf2|03352
Ophiocordyceps camponoti-rufipedis Ophun1|5896
Ophiocordyceps kimflemingae Ophio5|55
Ophiocordyceps subramaniannii Hirsu2|7378

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|4451
MPESTSPASTPTTDSFSLPQHLSSSALPPTADMTPTMTATTTQWRSSNLARSMSHASKERLSHYSTGSAPSKSPP
SSQHLHLLTSTLSYTCVRDFAYPLSHPMHHGPPPPHPSSPPSGMTTPVSESQRLSDPPASFEQRMPWDSWTADGF
SRSCDAPPFQFGDGPPYSEDEDLQSPVVATRHRKHKSNSASLNTDRPRSGRGADAQPSHVLDSSNYDSERGYLVH
RSGDGSERYYVNQGGEANGPGGELVTYPPDHARHSRAFHFAQQLGGNEGYASDDYSSPSSPGCHDADQSRYSRDY
QFTITSPDEEFHGKAVALFDFERENENELPLVEGQIIWVSYRHGQGWLVAEDPKTQENGLVPEEYVRLLRDIEGG
MNSLTGQLGDGSGSPHEAGTPTQTEHGVPEGHHRNISNTTNGYHQPVVSIFSTSSKDLNPYPTEQLGIQAGQTPP
QVVHYHGQRGGSQANTPTLSQHSDLGALRRGSQDSCNRDEAENSSATEESGTKAASSAAQTAEAKTEANR*
Coding >OphauB2|4451
ATGCCCGAGTCCACGTCGCCCGCCTCCACGCCCACCACGGATTCCTTTTCCTTGCCTCAACATCTTAGCTCTTCA
GCCCTGCCGCCGACTGCCGACATGACGCCGACAATGACGGCCACCACGACGCAATGGCGCTCCAGCAATCTGGCC
CGTTCCATGTCGCACGCCTCCAAGGAACGATTGTCGCACTACTCGACGGGCTCGGCGCCTTCAAAATCACCTCCC
TCGTCACAGCATCTCCACCTTCTGACCTCGACCCTCTCCTATACTTGCGTGCGCGATTTCGCATACCCCCTATCT
CATCCTATGCATCATGGCCCTCCTCCTCCCCATCCTTCTAGTCCACCCTCGGGAATGACGACGCCCGTCAGCGAG
TCCCAGAGGCTTTCTGACCCCCCAGCATCCTTCGAGCAGAGGATGCCTTGGGATTCCTGGACCGCCGATGGCTTC
AGCCGCTCATGCGACGCTCCTCCCTTCCAGTTTGGCGATGGCCCCCCATATAGCGAGGATGAAGACCTTCAAAGC
CCCGTCGTTGCCACTCGTCATCGCAAACACAAGTCTAATTCTGCGAGCCTCAACACTGATCGCCCAAGAAGCGGG
CGCGGCGCCGATGCGCAACCCTCACATGTTCTCGATTCGTCAAACTATGACAGCGAGAGGGGTTATCTTGTCCAT
CGAAGCGGTGACGGGAGCGAACGATACTATGTCAATCAAGGGGGCGAGGCCAATGGGCCTGGCGGCGAACTTGTC
ACATACCCCCCCGATCATGCCAGACACAGCCGCGCATTCCACTTTGCTCAGCAACTAGGCGGCAACGAGGGCTAT
GCATCCGATGACTACAGCTCGCCATCTTCCCCCGGCTGCCACGACGCCGACCAATCTCGCTACTCTCGAGATTAT
CAGTTCACAATAACATCTCCCGACGAAGAGTTTCATGGCAAAGCAGTCGCGCTCTTTGACTTTGAACGCGAAAAC
GAAAACGAGCTTCCCCTGGTTGAGGGCCAAATCATATGGGTGTCGTATCGCCATGGCCAAGGCTGGCTGGTGGCT
GAGGATCCCAAGACACAGGAGAATGGTCTGGTGCCCGAGGAATATGTCAGGTTGCTGCGTGACATTGAGGGAGGC
ATGAACAGCCTCACAGGCCAGTTGGGCGATGGCTCTGGCTCGCCCCACGAGGCCGGCACGCCCACCCAAACAGAA
CATGGCGTCCCAGAGGGCCACCATCGAAATATCAGCAACACGACCAATGGCTACCACCAGCCTGTCGTGTCAATT
TTTTCAACATCAAGCAAGGACTTGAATCCATATCCGACAGAGCAGCTGGGCATTCAAGCTGGACAGACACCACCC
CAAGTCGTTCATTACCATGGGCAAAGGGGAGGCAGCCAAGCAAATACTCCCACGCTTTCTCAGCACAGCGATTTG
GGCGCGTTGAGAAGAGGAAGCCAGGACTCTTGCAATCGAGATGAGGCAGAGAATTCCTCAGCTACAGAAGAATCA
GGAACAAAGGCGGCATCATCTGCCGCACAGACGGCCGAAGCAAAGACCGAGGCTAATCGGTGA
Transcript >OphauB2|4451
ATGCCCGAGTCCACGTCGCCCGCCTCCACGCCCACCACGGATTCCTTTTCCTTGCCTCAACATCTTAGCTCTTCA
GCCCTGCCGCCGACTGCCGACATGACGCCGACAATGACGGCCACCACGACGCAATGGCGCTCCAGCAATCTGGCC
CGTTCCATGTCGCACGCCTCCAAGGAACGATTGTCGCACTACTCGACGGGCTCGGCGCCTTCAAAATCACCTCCC
TCGTCACAGCATCTCCACCTTCTGACCTCGACCCTCTCCTATACTTGCGTGCGCGATTTCGCATACCCCCTATCT
CATCCTATGCATCATGGCCCTCCTCCTCCCCATCCTTCTAGTCCACCCTCGGGAATGACGACGCCCGTCAGCGAG
TCCCAGAGGCTTTCTGACCCCCCAGCATCCTTCGAGCAGAGGATGCCTTGGGATTCCTGGACCGCCGATGGCTTC
AGCCGCTCATGCGACGCTCCTCCCTTCCAGTTTGGCGATGGCCCCCCATATAGCGAGGATGAAGACCTTCAAAGC
CCCGTCGTTGCCACTCGTCATCGCAAACACAAGTCTAATTCTGCGAGCCTCAACACTGATCGCCCAAGAAGCGGG
CGCGGCGCCGATGCGCAACCCTCACATGTTCTCGATTCGTCAAACTATGACAGCGAGAGGGGTTATCTTGTCCAT
CGAAGCGGTGACGGGAGCGAACGATACTATGTCAATCAAGGGGGCGAGGCCAATGGGCCTGGCGGCGAACTTGTC
ACATACCCCCCCGATCATGCCAGACACAGCCGCGCATTCCACTTTGCTCAGCAACTAGGCGGCAACGAGGGCTAT
GCATCCGATGACTACAGCTCGCCATCTTCCCCCGGCTGCCACGACGCCGACCAATCTCGCTACTCTCGAGATTAT
CAGTTCACAATAACATCTCCCGACGAAGAGTTTCATGGCAAAGCAGTCGCGCTCTTTGACTTTGAACGCGAAAAC
GAAAACGAGCTTCCCCTGGTTGAGGGCCAAATCATATGGGTGTCGTATCGCCATGGCCAAGGCTGGCTGGTGGCT
GAGGATCCCAAGACACAGGAGAATGGTCTGGTGCCCGAGGAATATGTCAGGTTGCTGCGTGACATTGAGGGAGGC
ATGAACAGCCTCACAGGCCAGTTGGGCGATGGCTCTGGCTCGCCCCACGAGGCCGGCACGCCCACCCAAACAGAA
CATGGCGTCCCAGAGGGCCACCATCGAAATATCAGCAACACGACCAATGGCTACCACCAGCCTGTCGTGTCAATT
TTTTCAACATCAAGCAAGGACTTGAATCCATATCCGACAGAGCAGCTGGGCATTCAAGCTGGACAGACACCACCC
CAAGTCGTTCATTACCATGGGCAAAGGGGAGGCAGCCAAGCAAATACTCCCACGCTTTCTCAGCACAGCGATTTG
GGCGCGTTGAGAAGAGGAAGCCAGGACTCTTGCAATCGAGATGAGGCAGAGAATTCCTCAGCTACAGAAGAATCA
GGAACAAAGGCGGCATCATCTGCCGCACAGACGGCCGAAGCAAAGACCGAGGCTAATCGGTGA
Gene >OphauB2|4451
ATGCCCGAGTCCACGTCGCCCGCCTCCACGCCCACCACGGATTCCTTTTCCTTGCCTCAACATCTTAGCTCTTCA
GCCCTGCCGCCGACTGCCGACATGACGCCGACAATGACGGCCACCACGACGCAATGGCGCTCCAGCAATCTGGCC
CGTTCCATGTCGCACGCCTCCAAGGAACGATTGTCGCACTACTCGACGGGCTCGGCGCCTTCAAAATCACCTCCC
TCGTCACAGCATCTCCACCTTCTGACCTCGACCCTCTCCTATACTTGCGTGCGCGATTTCGCATACCCCCTATCT
CATCCTATGCATCATGGCCCTCCTCCTCCCCATCCTTCTAGTCCACCCTCGGGAATGACGACGCCCGTCAGCGAG
TCCCAGAGGCTTTCTGACCCCCCAGCATCCTTCGAGCAGAGGATGCCTTGGGATTCCTGGACCGCCGATGGCTTC
AGCCGCTCATGCGACGCTCCTCCCTTCCAGTTTGGCGATGGCCCCCCATATAGCGAGGATGAAGACCTTCAAAGC
CCCGTCGTTGCCACTCGTCATCGCAAACACAAGTCTAATTCTGCGAGCCTCAACACTGATCGCCCAAGAAGCGGG
CGCGGCGCCGATGCGCAACCCTCACATGTTCTCGATTCGTCAAACTATGACAGCGAGAGGGGTTATCTTGTCCAT
CGAAGCGGTGACGGGAGCGAACGATACTATGTCAATCAAGGGGGCGAGGCCAATGGGCCTGGCGGCGAACTTGTC
ACATACCCCCCCGATCATGCCAGACACAGCCGCGCATTCCACTTTGCTCAGCAACTAGGCGGCAACGAGGGCTAT
GCATCCGATGACTACAGCTCGCCATCTTCCCCCGGCTGCCACGACGCCGACCAATCTCGCTACTCTCGAGATTAT
CAGTTCACAATAACATCTCCCGACGAAGAGTTTCATGGCAAAGCAGTCGCGCTCTTTGACTTTGAACGCGAAAAC
GAAAACGAGCTTCCCCTGGTTGAGGGCCAAATCATATGGGTGTCGTATCGCCATGGCCAAGGCTGGCTGGTGGCT
GAGGATCCCAAGACACAGGAGAATGGTCTGGTGCCCGAGGAATATGTCAGGTTGCTGCGTGACATTGAGGGAGGC
ATGAACAGCCTCACAGGCCAGTTGGGCGATGGCTCTGGCTCGCCCCACGAGGCCGGCACGCCCACCCAAACAGAA
CATGGCGTCCCAGAGGGCCACCATCGAAATATCAGCAACACGACCAATGGCTACCACCAGCCTGTCGTGTCAATT
TTTTCAACATCAAGCAAGGACTTGAATCCATATCCGACAGAGCAGCTGGGCATTCAAGCTGGACAGACACCACCC
CAAGTCGTTCATTACCATGGGCAAAGGGGAGGCAGCCAAGCAAATACTCCCACGCTTTCTCAGCACAGCGATTTG
GGCGCGTTGAGAAGAGGAAGCCAGGACTCTTGCAATCGAGATGAGGCAGAGAATTCCTCAGCTACAGAAGAATCA
GGAACAAAGGCGGCATCATCTGCCGCACAGACGGCCGAAGCAAAGACCGAGGCTAATCGGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail