Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|4446
Gene name
LocationContig_3:175012..176828
Strand+
Gene length (bp)1816
Transcript length (bp)1674
Coding sequence length (bp)1674
Protein length (aa) 558

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12937 F-box-like F-box-like 1.1E-09 8 51
PF00646 F-box F-box domain 3.3E-08 8 47

Swissprot hits

(None)

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0003674 molecular_function No
GO:0005488 binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|4446
MASSPSDQLPPELWLLILDYIEPLDISNLSRVSRNLRQLCLDPLLWRRHCFLNSAWRDSLKKRRRSSGPRPLGQD
IANWDPVYPGERVSWYTEYIQRHGPTSVNWLQTPQGHHGMAEARGLALYHPTGHAVLAVSPLDDGSICLWDVKGT
RVKQGAILARSEQGLLIRDSRRPPHDEIGINEAISVDSSNHRAFIAAQHRIVEMDLNCLQVASETSFDRSITALS
TIQAGVPLTVGTSSGLRLYDPRDRPRMPQSIVERLDGGSDELNTRRMAKLQLSTSRNWDSQAPLSILHLPSLVSP
HLVTNDIFVAGRFPSILHCDRRKLPEIMESMYSGADIKSIAALACRFPTVEHSKRRKGQLSVSRAAEIKESCPGQ
TLIAGGSYSSKGSLEMYGLDLGVSPPIATAGFVNRQNAAPATIFSVINHGTKIAFSDGAGFVRWFERDGSTEIRR
LRIGNCSAGDADSLFPSSRAAAEDLALKILSTGGSETRDSDEIVFWTGERLGMIGFTPQALFHASDFEAQSRQMS
AEEEEREKYTSEMRRAIGQEADAVRFLNHFQL*
Coding >OphauB2|4446
ATGGCATCTTCACCGTCGGACCAGCTCCCGCCTGAGCTGTGGCTCCTCATCCTTGATTATATCGAACCTCTTGAC
ATCAGCAATCTCTCGCGTGTATCTCGTAACCTCAGGCAGCTCTGCCTCGACCCCTTGCTATGGAGACGGCATTGC
TTCCTCAACTCAGCCTGGCGCGATTCACTCAAGAAGCGTCGGCGAAGTTCTGGCCCTCGGCCGCTTGGCCAGGAC
ATAGCCAACTGGGATCCCGTGTACCCTGGCGAGAGAGTCTCATGGTACACAGAGTACATCCAGCGCCACGGTCCC
ACCAGCGTCAACTGGCTGCAGACACCTCAGGGACACCATGGCATGGCTGAGGCTCGTGGCTTGGCTCTCTATCAT
CCCACTGGGCATGCTGTGCTGGCCGTCTCGCCCCTCGATGACGGGTCCATCTGTCTCTGGGACGTCAAAGGTACA
CGGGTCAAGCAGGGAGCCATCTTGGCCAGGTCTGAGCAAGGTCTTCTTATTCGCGATTCCCGTCGTCCACCTCAC
GACGAGATTGGAATCAACGAGGCGATTAGCGTCGACAGTAGCAATCACCGGGCTTTTATTGCTGCTCAACATCGT
ATCGTGGAAATGGACCTCAATTGTTTACAGGTGGCCAGCGAAACATCATTTGACAGGTCCATCACAGCACTCTCT
ACCATACAAGCAGGAGTCCCTCTGACTGTCGGCACCTCGTCAGGACTTCGTCTATATGACCCTCGGGACCGTCCA
AGAATGCCACAGAGCATCGTCGAGCGTCTTGATGGAGGCTCAGACGAATTGAACACTAGGCGCATGGCTAAGCTG
CAGCTCTCGACATCCAGAAACTGGGATTCACAGGCACCGCTCAGTATCCTCCACCTGCCAAGTCTTGTGTCACCC
CATCTCGTCACCAACGACATCTTTGTGGCTGGACGATTCCCATCGATTCTTCATTGCGATAGGCGCAAGCTTCCA
GAAATCATGGAGTCGATGTACTCGGGAGCAGACATCAAGAGCATAGCGGCTCTTGCCTGTCGGTTTCCCACAGTG
GAACACAGCAAGCGTCGAAAGGGACAATTATCAGTTTCACGAGCGGCTGAGATTAAGGAGTCGTGCCCAGGACAA
ACGCTGATTGCTGGTGGCAGCTACAGCTCCAAAGGCTCGCTTGAAATGTACGGACTTGATCTAGGTGTAAGTCCA
CCGATAGCCACTGCGGGCTTCGTCAACCGACAAAATGCGGCACCTGCAACAATATTCTCAGTCATCAATCACGGG
ACCAAGATTGCCTTTTCTGATGGCGCGGGCTTTGTCAGGTGGTTTGAAAGAGATGGCTCGACCGAGATACGGCGG
CTCCGAATCGGCAATTGCAGCGCGGGAGATGCAGACTCTCTGTTCCCGTCTTCAAGAGCGGCTGCTGAAGACTTG
GCGCTCAAGATTTTGTCGACGGGCGGCAGCGAGACGCGCGACAGCGACGAGATTGTTTTCTGGACGGGAGAAAGA
CTGGGCATGATTGGCTTTACGCCTCAGGCGCTCTTCCACGCCAGCGACTTTGAGGCTCAGAGCCGCCAAATGTCA
GCAGAGGAGGAGGAGAGAGAGAAATATACTAGCGAGATGCGGCGGGCTATTGGGCAAGAAGCGGATGCTGTGAGA
TTTCTCAACCATTTTCAGCTCTAG
Transcript >OphauB2|4446
ATGGCATCTTCACCGTCGGACCAGCTCCCGCCTGAGCTGTGGCTCCTCATCCTTGATTATATCGAACCTCTTGAC
ATCAGCAATCTCTCGCGTGTATCTCGTAACCTCAGGCAGCTCTGCCTCGACCCCTTGCTATGGAGACGGCATTGC
TTCCTCAACTCAGCCTGGCGCGATTCACTCAAGAAGCGTCGGCGAAGTTCTGGCCCTCGGCCGCTTGGCCAGGAC
ATAGCCAACTGGGATCCCGTGTACCCTGGCGAGAGAGTCTCATGGTACACAGAGTACATCCAGCGCCACGGTCCC
ACCAGCGTCAACTGGCTGCAGACACCTCAGGGACACCATGGCATGGCTGAGGCTCGTGGCTTGGCTCTCTATCAT
CCCACTGGGCATGCTGTGCTGGCCGTCTCGCCCCTCGATGACGGGTCCATCTGTCTCTGGGACGTCAAAGGTACA
CGGGTCAAGCAGGGAGCCATCTTGGCCAGGTCTGAGCAAGGTCTTCTTATTCGCGATTCCCGTCGTCCACCTCAC
GACGAGATTGGAATCAACGAGGCGATTAGCGTCGACAGTAGCAATCACCGGGCTTTTATTGCTGCTCAACATCGT
ATCGTGGAAATGGACCTCAATTGTTTACAGGTGGCCAGCGAAACATCATTTGACAGGTCCATCACAGCACTCTCT
ACCATACAAGCAGGAGTCCCTCTGACTGTCGGCACCTCGTCAGGACTTCGTCTATATGACCCTCGGGACCGTCCA
AGAATGCCACAGAGCATCGTCGAGCGTCTTGATGGAGGCTCAGACGAATTGAACACTAGGCGCATGGCTAAGCTG
CAGCTCTCGACATCCAGAAACTGGGATTCACAGGCACCGCTCAGTATCCTCCACCTGCCAAGTCTTGTGTCACCC
CATCTCGTCACCAACGACATCTTTGTGGCTGGACGATTCCCATCGATTCTTCATTGCGATAGGCGCAAGCTTCCA
GAAATCATGGAGTCGATGTACTCGGGAGCAGACATCAAGAGCATAGCGGCTCTTGCCTGTCGGTTTCCCACAGTG
GAACACAGCAAGCGTCGAAAGGGACAATTATCAGTTTCACGAGCGGCTGAGATTAAGGAGTCGTGCCCAGGACAA
ACGCTGATTGCTGGTGGCAGCTACAGCTCCAAAGGCTCGCTTGAAATGTACGGACTTGATCTAGGTGTAAGTCCA
CCGATAGCCACTGCGGGCTTCGTCAACCGACAAAATGCGGCACCTGCAACAATATTCTCAGTCATCAATCACGGG
ACCAAGATTGCCTTTTCTGATGGCGCGGGCTTTGTCAGGTGGTTTGAAAGAGATGGCTCGACCGAGATACGGCGG
CTCCGAATCGGCAATTGCAGCGCGGGAGATGCAGACTCTCTGTTCCCGTCTTCAAGAGCGGCTGCTGAAGACTTG
GCGCTCAAGATTTTGTCGACGGGCGGCAGCGAGACGCGCGACAGCGACGAGATTGTTTTCTGGACGGGAGAAAGA
CTGGGCATGATTGGCTTTACGCCTCAGGCGCTCTTCCACGCCAGCGACTTTGAGGCTCAGAGCCGCCAAATGTCA
GCAGAGGAGGAGGAGAGAGAGAAATATACTAGCGAGATGCGGCGGGCTATTGGGCAAGAAGCGGATGCTGTGAGA
TTTCTCAACCATTTTCAGCTCTAG
Gene >OphauB2|4446
ATGGCATCTTCACCGTCGGACCAGCTCCCGCCTGAGCTGTGGCTCCTCATCCTTGATTGTAAGACGGCCGCTCCA
TCGCCTTGGAACCATGCTGAAACCATGTTGGAACCATGTCACTGACGCTGCCTCGAGATATCGAACCTCTTGACA
TCAGCAATCTCTCGCGTGTATCTCGTAACCTCAGGCAGCTCTGCCTCGACCCCTTGCTATGGAGACGGCATTGCT
TCCTCAACTCAGCCTGGCGCGATTCACTCAAGAAGCGTCGGCGAAGTTCTGGCCCTCGGCCGCTTGGCCAGGACA
TAGCCAACTGGGATCCCGTGTACCCTGGCGAGAGAGTCTCATGGTACACAGAGTACATCCAGCGCCACGGTCCCA
CCAGCGTCAACTGGCTGCAGACACCTCAGGGACACCATGGCATGGCTGAGGCTCGTGGCTTGGCTCTCTATCATC
CCACTGGGCATGCTGTGCTGGCCGTCTCGCCCCTCGATGACGGGTCCATCTGTCTCTGGGACGTCAAAGGTACAC
GGGTCAAGCAGGGAGCCATCTTGGCCAGGTCTGAGCAAGGTCTTCTTATTCGCGATTCCCGTCGTCCACCTCACG
ACGAGATTGGAATCAACGAGGCGATTAGCGTCGACAGTAGCAATCACCGGGCTTTTATTGCTGCTCAACATCGTG
AGTTGCTTGGCGTCTCTCTTGGCCATGATGAAGTCTGGCTTCCTTGTACTCATGAGGCCTTGCAGGTATCGTGGA
AATGGACCTCAATTGTTTACAGGTGGCCAGCGAAACATCATTTGACAGGTCCATCACAGCACTCTCTACCATACA
AGCAGGAGTCCCTCTGACTGTCGGCACCTCGTCAGGACTTCGTCTATATGACCCTCGGGACCGTCCAAGAATGCC
ACAGAGCATCGTCGAGCGTCTTGATGGAGGCTCAGACGAATTGAACACTAGGCGCATGGCTAAGCTGCAGCTCTC
GACATCCAGAAACTGGGATTCACAGGCACCGCTCAGTATCCTCCACCTGCCAAGTCTTGTGTCACCCCATCTCGT
CACCAACGACATCTTTGTGGCTGGACGATTCCCATCGATTCTTCATTGCGATAGGCGCAAGCTTCCAGAAATCAT
GGAGTCGATGTACTCGGGAGCAGACATCAAGAGCATAGCGGCTCTTGCCTGTCGGTTTCCCACAGTGGAACACAG
CAAGCGTCGAAAGGGACAATTATCAGTTTCACGAGCGGCTGAGATTAAGGAGTCGTGCCCAGGACAAACGCTGAT
TGCTGGTGGCAGCTACAGCTCCAAAGGCTCGCTTGAAATGTACGGACTTGATCTAGGTGTAAGTCCACCGATAGC
CACTGCGGGCTTCGTCAACCGACAAAATGCGGCACCTGCAACAATATTCTCAGTCATCAATCACGGGACCAAGAT
TGCCTTTTCTGATGGCGCGGGCTTTGTCAGGTGGTTTGAAAGAGATGGCTCGACCGAGATACGGCGGCTCCGAAT
CGGCAATTGCAGCGCGGGAGATGCAGACTCTCTGTTCCCGTCTTCAAGAGCGGCTGCTGAAGACTTGGCGCTCAA
GATTTTGTCGACGGGCGGCAGCGAGACGCGCGACAGCGACGAGATTGTTTTCTGGACGGGAGAAAGACTGGGCAT
GATTGGCTTTACGCCTCAGGCGCTCTTCCACGCCAGCGACTTTGAGGCTCAGAGCCGCCAAATGTCAGCAGAGGA
GGAGGAGAGAGAGAAATATACTAGCGAGATGCGGCGGGCTATTGGGCAAGAAGCGGATGCTGTGAGATTTCTCAA
CCATTTTCAGCTCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail