Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|4437
Gene name
LocationContig_3:151787..153039
Strand-
Gene length (bp)1252
Transcript length (bp)867
Coding sequence length (bp)867
Protein length (aa) 289

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF14413 Thg1C Thg1 C terminal domain 3.2E-52 139 266
PF04446 Thg1 tRNAHis guanylyltransferase 5.2E-52 6 136

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q7SDM8|THG1_NEUCR tRNA(His) guanylyltransferase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=rgt-1 PE=3 SV=1 1 287 4.0E-149
sp|Q6BKD4|THG1_DEBHA tRNA(His) guanylyltransferase OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=THG1 PE=3 SV=2 1 278 6.0E-98
sp|Q9CY52|THG1_MOUSE Probable tRNA(His) guanylyltransferase OS=Mus musculus GN=Thg1l PE=1 SV=1 1 280 2.0E-96
sp|Q5M965|THG1_RAT Probable tRNA(His) guanylyltransferase OS=Rattus norvegicus GN=Thg1l PE=2 SV=1 1 280 4.0E-95
sp|Q05B50|THG1_BOVIN Probable tRNA(His) guanylyltransferase OS=Bos taurus GN=THG1L PE=2 SV=1 1 277 2.0E-94
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q7SDM8|THG1_NEUCR tRNA(His) guanylyltransferase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=rgt-1 PE=3 SV=1 1 287 4.0E-149
sp|Q6BKD4|THG1_DEBHA tRNA(His) guanylyltransferase OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=THG1 PE=3 SV=2 1 278 6.0E-98
sp|Q9CY52|THG1_MOUSE Probable tRNA(His) guanylyltransferase OS=Mus musculus GN=Thg1l PE=1 SV=1 1 280 2.0E-96
sp|Q5M965|THG1_RAT Probable tRNA(His) guanylyltransferase OS=Rattus norvegicus GN=Thg1l PE=2 SV=1 1 280 4.0E-95
sp|Q05B50|THG1_BOVIN Probable tRNA(His) guanylyltransferase OS=Bos taurus GN=THG1L PE=2 SV=1 1 277 2.0E-94
sp|Q54E29|THG1_DICDI Probable tRNA(His) guanylyltransferase OS=Dictyostelium discoideum GN=thg1 PE=3 SV=1 1 280 3.0E-92
sp|Q9NWX6|THG1_HUMAN Probable tRNA(His) guanylyltransferase OS=Homo sapiens GN=THG1L PE=1 SV=2 1 277 1.0E-91
sp|Q9Y7T3|THG1_SCHPO tRNA(His) guanylyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=thg1 PE=3 SV=1 1 276 3.0E-89
sp|Q9V3N8|THG1_DROME Probable tRNA(His) guanylyltransferase OS=Drosophila melanogaster GN=l(2)35Bc PE=2 SV=1 1 278 6.0E-83
sp|Q6FPX3|THG1_CANGA tRNA(His) guanylyltransferase OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=THG1 PE=3 SV=1 1 223 2.0E-76
sp|P53215|THG1_YEAST tRNA(His) guanylyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=THG1 PE=1 SV=1 1 223 1.0E-75
sp|Q75DJ3|THG1_ASHGO tRNA(His) guanylyltransferase OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=THG1 PE=3 SV=1 1 220 1.0E-74
sp|Q6CW75|THG1_KLULA tRNA(His) guanylyltransferase OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=THG1 PE=3 SV=1 1 220 2.0E-73
sp|F4IRQ5|THG1_ARATH tRNA(His) guanylyltransferase 1 OS=Arabidopsis thaliana GN=THG1 PE=1 SV=1 7 278 2.0E-67
sp|F4ISV6|THG2_ARATH tRNA(His) guanylyltransferase 2 OS=Arabidopsis thaliana GN=THG2 PE=1 SV=1 7 278 3.0E-66
sp|F4IRQ5|THG1_ARATH tRNA(His) guanylyltransferase 1 OS=Arabidopsis thaliana GN=THG1 PE=1 SV=1 1 287 2.0E-61
sp|F4ISV6|THG2_ARATH tRNA(His) guanylyltransferase 2 OS=Arabidopsis thaliana GN=THG2 PE=1 SV=1 1 215 4.0E-59
[Show less]

GO

GO Term Description Terminal node
GO:0008193 tRNA guanylyltransferase activity Yes
GO:0006400 tRNA modification Yes
GO:0000287 magnesium ion binding Yes
GO:0005488 binding No
GO:0008033 tRNA processing No
GO:1901360 organic cyclic compound metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0070568 guanylyltransferase activity No
GO:0043167 ion binding No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0006396 RNA processing No
GO:0003674 molecular_function No
GO:0046872 metal ion binding No
GO:0006399 tRNA metabolic process No
GO:0008150 biological_process No
GO:0016772 transferase activity, transferring phosphorus-containing groups No
GO:0006725 cellular aromatic compound metabolic process No
GO:0008192 RNA guanylyltransferase activity No
GO:0043170 macromolecule metabolic process No
GO:0008152 metabolic process No
GO:0016070 RNA metabolic process No
GO:0034660 ncRNA metabolic process No
GO:0046483 heterocycle metabolic process No
GO:0016740 transferase activity No
GO:0009451 RNA modification No
GO:0044238 primary metabolic process No
GO:0009987 cellular process No
GO:0043412 macromolecule modification No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0044237 cellular metabolic process No
GO:0071704 organic substance metabolic process No
GO:0034470 ncRNA processing No
GO:0016779 nucleotidyltransferase activity No
GO:0090304 nucleic acid metabolic process No
GO:0043169 cation binding No
GO:0003824 catalytic activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 49 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|4437
MANSKYEYVRAFEQPDSMLQNTWIVVRLDGRAFTKMCAKYQFQKPNDRRALHLMNVAAKAVVSDMPDITIGYGIS
DEYSFVFHKSCNLFERRASKLVSTVVSTFTANYVFSWSTYFPDTPLTFPLPTFDGRAVCYPSVQNLRDYLSWRQV
DCHINNLYNTTFWALVQLGGLDNKEAEKTLTGTYAADKNEILFSRFHINYNNEPDMFKKGSVIFRDYELVDPNSH
KSACNVQAMSEPSPQSKSQAEKEKKRRAKARVVVEHLDIIKDDFWDRRPWILSNKPGKVPKET*
Coding >OphauB2|4437
ATGGCAAACTCAAAATATGAATATGTCCGGGCTTTTGAGCAGCCAGACTCGATGCTGCAAAACACGTGGATTGTG
GTGCGTCTAGACGGACGGGCTTTCACAAAAATGTGCGCCAAGTATCAGTTCCAAAAGCCAAACGACCGTAGAGCC
TTGCATCTTATGAATGTGGCCGCAAAGGCCGTCGTCTCTGACATGCCCGACATTACCATTGGCTATGGCATCAGC
GACGAATACAGCTTCGTCTTTCACAAGTCGTGCAATCTCTTTGAACGGAGGGCAAGCAAGCTCGTGAGCACCGTC
GTCTCAACCTTTACAGCCAACTATGTCTTCTCTTGGTCCACATACTTTCCCGATACACCTCTGACATTTCCTCTG
CCGACTTTTGATGGCCGGGCCGTGTGCTATCCCAGTGTGCAAAATCTGCGCGACTACCTGAGCTGGCGGCAGGTT
GACTGCCATATCAACAATCTCTACAACACCACTTTTTGGGCACTTGTACAGCTTGGGGGTCTCGATAATAAAGAG
GCCGAAAAGACCCTCACGGGAACATATGCCGCTGATAAAAACGAAATTCTCTTTTCACGTTTCCACATCAACTAC
AACAACGAGCCTGACATGTTCAAGAAGGGCAGCGTCATCTTTCGAGACTATGAGTTGGTCGATCCGAATAGTCAC
AAGTCGGCATGCAATGTCCAAGCCATGTCTGAACCATCACCGCAATCCAAAAGCCAAGCAGAAAAGGAAAAGAAG
CGGAGAGCCAAAGCCAGAGTGGTTGTGGAGCATTTGGACATTATCAAGGATGATTTTTGGGATAGACGGCCCTGG
ATTCTGTCCAACAAACCAGGCAAGGTTCCCAAAGAAACGTAA
Transcript >OphauB2|4437
ATGGCAAACTCAAAATATGAATATGTCCGGGCTTTTGAGCAGCCAGACTCGATGCTGCAAAACACGTGGATTGTG
GTGCGTCTAGACGGACGGGCTTTCACAAAAATGTGCGCCAAGTATCAGTTCCAAAAGCCAAACGACCGTAGAGCC
TTGCATCTTATGAATGTGGCCGCAAAGGCCGTCGTCTCTGACATGCCCGACATTACCATTGGCTATGGCATCAGC
GACGAATACAGCTTCGTCTTTCACAAGTCGTGCAATCTCTTTGAACGGAGGGCAAGCAAGCTCGTGAGCACCGTC
GTCTCAACCTTTACAGCCAACTATGTCTTCTCTTGGTCCACATACTTTCCCGATACACCTCTGACATTTCCTCTG
CCGACTTTTGATGGCCGGGCCGTGTGCTATCCCAGTGTGCAAAATCTGCGCGACTACCTGAGCTGGCGGCAGGTT
GACTGCCATATCAACAATCTCTACAACACCACTTTTTGGGCACTTGTACAGCTTGGGGGTCTCGATAATAAAGAG
GCCGAAAAGACCCTCACGGGAACATATGCCGCTGATAAAAACGAAATTCTCTTTTCACGTTTCCACATCAACTAC
AACAACGAGCCTGACATGTTCAAGAAGGGCAGCGTCATCTTTCGAGACTATGAGTTGGTCGATCCGAATAGTCAC
AAGTCGGCATGCAATGTCCAAGCCATGTCTGAACCATCACCGCAATCCAAAAGCCAAGCAGAAAAGGAAAAGAAG
CGGAGAGCCAAAGCCAGAGTGGTTGTGGAGCATTTGGACATTATCAAGGATGATTTTTGGGATAGACGGCCCTGG
ATTCTGTCCAACAAACCAGGCAAGGTTCCCAAAGAAACGTAA
Gene >OphauB2|4437
ATGGCAAACTCAAAGTAAGTAGCACATTTGGCTTGTGCTCGCCGTCGCAGCTAAACATGTCGCAAGATATGAATA
TGTCCGGGCTTTTGAGCAGCCAGACTCGATGCTGCAAAACACGTGGATTGTGGTGCGTCTAGACGGACGGGCTTT
CACAAAGTAATGCAGGCAATTCCACGTCGTGCTCCCAAAAGCCTCAATTAACTCTTGACCTGGTAGAATGTGCGC
CAAGTATCAGTTCCAAAAGCCAAACGACCGTAGAGCCTTGCATCTTATGAATGTGGCCGCAAAGGCCGTCGTCTC
TGACATGCCCGACATTACCATTGGCTATGGCATCAGCGACGAATACAGGTGAAGATGAAGGTCCCAAGAATTATA
CCGCTTCCTTCATAGTCTCACCTTGCGCAGCTTCGTCTTTCACAAGTCGTGCAATCTCTTTGAACGGAGGGCAAG
GTTAGTTGTCTCTAATTTCTTCATCATCAGATATCTCTAGTGCCTTGGTTCATGATTTGTAGCAAGCTCGTGAGC
ACCGTCGTCTCAACCTTTACAGCCAACTATGTCTTCTCTTGGTCCACATACTTTCCCGATACACCTCTGACATTT
CCTCTGCCGACTTTTGATGGCCGGGCCGTGTGCTATCCCAGTGTGCAAAATCTGCGCGACTACCTGAGCTGGCGG
CAGGTTGACTGTAAGTTGCTCCACATTTTCTTTTGCCTCTGGCTAAACCTTCGAGGCCATATCAACAATCTCTAC
AACACCACTTTTTGGGCACTTGTACAGCTTGGGGGTCTCGATAATAAAGAGGCCGAAAAGACCCTCACGGTGCGT
TTCTAGAGCTATTCTATCTTGCTTCACGGCAACTAATCTGGCTCGTCCAGGGAACATATGCCGCTGATAAAAACG
AAATTCTCTTTTCACGTTTCCACATCAACTACAACAACGAGCCTGACATGTTCAAGAAGGGCAGCGTCATCTTTC
GAGACGTGAGTCTGGCGTCCTTTTTGGTGTGTGGAAGCAGCTGACTGTGATGCTCCAGTATGAGTTGGTCGATCC
GAATAGTCACAAGTCGGCATGCAATGTCCAAGCCATGTCTGAACCATCACCGCAATCCAAAAGCCAAGCAGAAAA
GGAAAAGAAGCGGAGAGCCAAAGCCAGAGTGGTTGTGGAGCATTTGGACATTATCAAGGATGATTTTTGGGATAG
ACGGCCCTGGATTCTGTCCAACAAACCAGGCAAGGTTCCCAAAGAAACGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail