Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|4434
Gene name
LocationContig_3:143928..147459
Strand+
Gene length (bp)3531
Transcript length (bp)3186
Coding sequence length (bp)3186
Protein length (aa) 1062

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08101 Msb1-Mug8_dom Meiotically up-regulated protein Msb1/Mug8 domain 2.1E-163 44 511

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P21339|MSB1_YEAST Morphogenesis-related protein MSB1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MSB1 PE=1 SV=1 47 330 1.0E-30
sp|Q10326|MUG8_SCHPO Meiotically up-regulated gene 8 protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mug8 PE=1 SV=1 86 263 4.0E-09

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup3085
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4200
Ophiocordyceps australis map64 (Brazil) OphauB2|4434 (this protein)
Ophiocordyceps camponoti-floridani Ophcf2|03365
Ophiocordyceps camponoti-rufipedis Ophun1|7555
Ophiocordyceps kimflemingae Ophio5|2255
Ophiocordyceps subramaniannii Hirsu2|5359

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|4434
MPGLFSRLKGRDGVRSKKKKNAAAAAASLPQKPTWDDAYARTTVEADEIHELLHCCTAELKARALDLPFFMLPFR
PTSDPSAVRTFIRQFFSQKLSLRGEALLQEIRMTEPMVIAGVTKWCWSRLSGGVVGWDAYELFKVGEYDSNQARD
SFKTFIPISVDNGAKQRIIFDFFDLIAAVAAHGKSNGFGGLQLSRMAAWWAFEHKDTGNGFDGGYRAWLSAADAT
SHLFFAYLRSLSPEHHLTGISMLPRSLEKLLRETDYPPPRSAEMMSSTNKLAMIVDAVSPTPFSLLRRAGHFQYR
DSDRGLQEFSEHDDPVQALSEECYRVLKAISAANQSQVSNAKHSTGLREASWSRFEDIGFSSALDDDEELDGIQP
THTTMRGLRSTPASGNNNMARPTTPSWADFLSSGFVDEGAQRPNLLLPPDKVLPPIESQVRHSSSQSHRPRLESD
RDLEPGELASITKFELDEAFWWVWMSSLAPDETPDRKSAFGRCAVIETRISSARWIVVEEIVAGAAPEPAAGAYI
AEKKRFFSWTKRGKNMTRRKSTGKDALVRGDKALSEENGSNGSGPKTTMGADTHARIQAKAAQLRAMKDNEQQAA
AAAAASQRRGRTDAELMSEKTNSVFTLQPIIAGEASSAMKWVKKYDKGTIKDVYMANSNAGRGVVVTSDMLDFPT
PATEADISVDSSVGRVTPEVPSKTPSPGPHVSIIAAARPSVQSPEPESVHEDSQAPVPSTPEVSTNDTRRSEAAD
GSSTPTHDQKLVKHGTIVPDVAQHEGTNAKGRMEGAKLHKAPAGKERPGALRKFFGRKNRSSKVPDNASSDVNGM
LLKEQPTVVTEPIVQQTPTPAPTPPPMQEVQEVVHQVPQEPMDQPVEELDEQYYETPEPAAMPTPEPDTPQTGEQ
ADVEPDYKASEELSRVDTQDAAEATREFSRFDQGPLTDQPAFAPQAEEETRAISPPIARPAARSNRPKAAPEKVR
EGLSHAASPGVQDRWAQIRKNAAQRAATRQKEDRPRGLGAKTGEGEDDLGDDTIESRVARIKARVAELTGNMEEG
GDSRQALPSRR*
Coding >OphauB2|4434
ATGCCTGGTCTCTTCTCTCGGCTCAAGGGCCGCGATGGCGTCCGCTCCAAGAAGAAGAAGAATGCCGCCGCCGCC
GCCGCCTCGCTGCCCCAAAAGCCCACCTGGGATGATGCCTACGCCCGCACCACCGTCGAAGCCGACGAGATACAC
GAGCTGTTGCACTGCTGCACTGCAGAACTAAAGGCCCGAGCCCTCGACCTGCCCTTTTTCATGCTTCCTTTCCGC
CCGACTTCCGACCCGAGCGCTGTGCGCACTTTTATTCGCCAATTTTTCAGCCAAAAGTTGTCTCTACGCGGCGAG
GCCTTGCTGCAGGAGATACGCATGACGGAGCCCATGGTCATTGCCGGCGTAACAAAGTGGTGTTGGAGTCGACTT
TCGGGCGGCGTCGTTGGCTGGGATGCCTACGAATTGTTCAAGGTTGGAGAATACGACTCAAACCAGGCTCGGGAC
TCTTTCAAGACTTTTATCCCAATTAGTGTGGATAACGGGGCCAAACAGCGCATTATTTTTGACTTTTTTGACTTG
ATTGCTGCCGTTGCTGCCCATGGAAAGTCCAATGGCTTTGGTGGCTTGCAGCTCTCTCGCATGGCTGCCTGGTGG
GCTTTTGAGCACAAGGATACGGGCAATGGCTTTGATGGTGGTTACAGGGCTTGGCTCAGTGCTGCCGATGCCACG
AGTCACCTCTTCTTCGCCTATCTCAGATCTCTTTCGCCTGAGCACCATCTCACCGGCATCTCCATGCTGCCCAGG
TCACTCGAAAAGCTTCTGAGGGAAACGGATTACCCACCGCCCAGGTCGGCTGAAATGATGTCCAGCACCAATAAG
CTAGCCATGATTGTCGACGCTGTGTCCCCTACGCCGTTTTCTCTTTTGCGCCGTGCTGGCCACTTTCAGTATCGT
GACTCGGACAGGGGACTGCAGGAATTTTCAGAACACGATGACCCAGTCCAGGCCCTTTCTGAAGAGTGTTACCGT
GTACTCAAGGCTATTTCAGCCGCCAACCAGTCACAAGTGTCCAACGCCAAGCACTCGACTGGATTGCGTGAAGCG
TCTTGGTCCCGATTTGAGGATATTGGATTTTCTAGCGCCCTTGATGACGATGAGGAGCTTGATGGCATCCAACCC
ACTCACACGACGATGAGGGGCCTTAGGAGTACCCCTGCGTCTGGTAACAACAACATGGCACGGCCCACGACGCCT
TCGTGGGCCGACTTCTTGTCGTCGGGCTTTGTTGATGAGGGTGCTCAGCGACCCAATCTGCTGCTTCCTCCGGAC
AAGGTTTTGCCTCCCATTGAGTCACAAGTGAGGCACAGCAGCTCCCAGTCTCACCGTCCACGCCTCGAATCGGAC
CGCGACTTGGAACCGGGTGAGCTTGCTAGCATCACCAAGTTTGAACTTGACGAGGCCTTTTGGTGGGTGTGGATG
AGCAGCTTGGCGCCCGACGAGACGCCAGACAGAAAGTCAGCCTTTGGCAGATGTGCTGTGATTGAGACAAGAATC
AGCAGTGCTCGCTGGATCGTGGTTGAGGAGATTGTTGCTGGCGCTGCCCCCGAACCCGCTGCTGGGGCTTATATT
GCGGAGAAGAAGCGCTTCTTTAGCTGGACAAAGCGTGGCAAGAACATGACTAGGCGCAAGTCGACGGGCAAGGAC
GCTCTTGTTCGGGGCGACAAGGCTCTGAGCGAAGAAAATGGAAGCAATGGTAGCGGGCCCAAGACGACGATGGGC
GCTGACACTCATGCCAGGATCCAGGCAAAGGCTGCCCAGTTGCGTGCCATGAAGGACAATGAACAGCAAGCTGCT
GCCGCCGCTGCTGCATCGCAACGACGCGGCCGCACTGACGCGGAGCTGATGTCGGAAAAGACTAATAGTGTTTTT
ACTCTTCAGCCAATCATTGCTGGCGAGGCCTCTTCGGCTATGAAATGGGTCAAGAAGTACGACAAGGGAACCATC
AAGGATGTGTACATGGCCAACTCGAATGCCGGGCGCGGCGTGGTTGTTACGTCTGACATGCTTGATTTCCCTACG
CCGGCAACGGAAGCCGACATCAGTGTAGATTCGAGCGTTGGAAGAGTTACTCCCGAGGTGCCTAGCAAGACTCCA
TCGCCGGGACCCCATGTTTCCATTATTGCAGCGGCTCGGCCTTCTGTGCAGTCACCTGAGCCAGAGTCGGTGCAT
GAGGATTCGCAGGCACCCGTGCCGAGCACGCCAGAGGTGTCGACGAATGATACACGACGCTCAGAGGCTGCAGAT
GGCAGCTCGACTCCGACTCATGACCAAAAGCTTGTCAAACATGGCACAATTGTTCCCGACGTGGCACAGCATGAA
GGTACAAATGCAAAGGGCCGCATGGAAGGCGCCAAGCTGCATAAGGCGCCAGCTGGCAAGGAGAGGCCCGGAGCG
CTGCGCAAGTTTTTTGGGCGCAAGAATCGCTCGTCCAAGGTTCCAGACAATGCCTCGTCCGACGTCAATGGCATG
TTGCTCAAGGAACAGCCCACTGTTGTGACGGAGCCCATTGTGCAACAGACGCCCACGCCGGCTCCAACGCCTCCT
CCCATGCAGGAAGTGCAAGAGGTGGTGCACCAAGTGCCGCAGGAACCCATGGATCAGCCTGTAGAGGAGCTTGAC
GAGCAGTACTATGAGACTCCTGAGCCGGCTGCCATGCCTACGCCTGAGCCAGACACTCCGCAGACGGGGGAGCAG
GCCGATGTCGAGCCTGACTACAAGGCGAGCGAAGAGCTGTCGCGCGTCGACACGCAAGATGCCGCTGAAGCGACG
CGTGAATTTTCACGCTTCGACCAGGGACCCTTGACTGATCAACCTGCCTTTGCACCGCAAGCAGAAGAGGAAACC
AGGGCCATTTCGCCGCCCATTGCGCGCCCTGCTGCTCGGTCCAATCGCCCAAAGGCGGCCCCAGAAAAGGTTCGC
GAAGGGCTGAGCCACGCTGCAAGCCCGGGTGTCCAAGACCGCTGGGCCCAGATTCGCAAAAACGCTGCCCAAAGA
GCCGCTACTCGACAGAAAGAGGACCGCCCACGCGGTCTTGGCGCCAAGACTGGAGAGGGAGAGGACGATTTGGGA
GACGACACCATTGAATCACGTGTCGCTCGCATCAAGGCTCGTGTAGCCGAGCTCACGGGCAACATGGAAGAGGGT
GGTGACAGCCGCCAGGCCCTACCAAGCCGACGCTAG
Transcript >OphauB2|4434
ATGCCTGGTCTCTTCTCTCGGCTCAAGGGCCGCGATGGCGTCCGCTCCAAGAAGAAGAAGAATGCCGCCGCCGCC
GCCGCCTCGCTGCCCCAAAAGCCCACCTGGGATGATGCCTACGCCCGCACCACCGTCGAAGCCGACGAGATACAC
GAGCTGTTGCACTGCTGCACTGCAGAACTAAAGGCCCGAGCCCTCGACCTGCCCTTTTTCATGCTTCCTTTCCGC
CCGACTTCCGACCCGAGCGCTGTGCGCACTTTTATTCGCCAATTTTTCAGCCAAAAGTTGTCTCTACGCGGCGAG
GCCTTGCTGCAGGAGATACGCATGACGGAGCCCATGGTCATTGCCGGCGTAACAAAGTGGTGTTGGAGTCGACTT
TCGGGCGGCGTCGTTGGCTGGGATGCCTACGAATTGTTCAAGGTTGGAGAATACGACTCAAACCAGGCTCGGGAC
TCTTTCAAGACTTTTATCCCAATTAGTGTGGATAACGGGGCCAAACAGCGCATTATTTTTGACTTTTTTGACTTG
ATTGCTGCCGTTGCTGCCCATGGAAAGTCCAATGGCTTTGGTGGCTTGCAGCTCTCTCGCATGGCTGCCTGGTGG
GCTTTTGAGCACAAGGATACGGGCAATGGCTTTGATGGTGGTTACAGGGCTTGGCTCAGTGCTGCCGATGCCACG
AGTCACCTCTTCTTCGCCTATCTCAGATCTCTTTCGCCTGAGCACCATCTCACCGGCATCTCCATGCTGCCCAGG
TCACTCGAAAAGCTTCTGAGGGAAACGGATTACCCACCGCCCAGGTCGGCTGAAATGATGTCCAGCACCAATAAG
CTAGCCATGATTGTCGACGCTGTGTCCCCTACGCCGTTTTCTCTTTTGCGCCGTGCTGGCCACTTTCAGTATCGT
GACTCGGACAGGGGACTGCAGGAATTTTCAGAACACGATGACCCAGTCCAGGCCCTTTCTGAAGAGTGTTACCGT
GTACTCAAGGCTATTTCAGCCGCCAACCAGTCACAAGTGTCCAACGCCAAGCACTCGACTGGATTGCGTGAAGCG
TCTTGGTCCCGATTTGAGGATATTGGATTTTCTAGCGCCCTTGATGACGATGAGGAGCTTGATGGCATCCAACCC
ACTCACACGACGATGAGGGGCCTTAGGAGTACCCCTGCGTCTGGTAACAACAACATGGCACGGCCCACGACGCCT
TCGTGGGCCGACTTCTTGTCGTCGGGCTTTGTTGATGAGGGTGCTCAGCGACCCAATCTGCTGCTTCCTCCGGAC
AAGGTTTTGCCTCCCATTGAGTCACAAGTGAGGCACAGCAGCTCCCAGTCTCACCGTCCACGCCTCGAATCGGAC
CGCGACTTGGAACCGGGTGAGCTTGCTAGCATCACCAAGTTTGAACTTGACGAGGCCTTTTGGTGGGTGTGGATG
AGCAGCTTGGCGCCCGACGAGACGCCAGACAGAAAGTCAGCCTTTGGCAGATGTGCTGTGATTGAGACAAGAATC
AGCAGTGCTCGCTGGATCGTGGTTGAGGAGATTGTTGCTGGCGCTGCCCCCGAACCCGCTGCTGGGGCTTATATT
GCGGAGAAGAAGCGCTTCTTTAGCTGGACAAAGCGTGGCAAGAACATGACTAGGCGCAAGTCGACGGGCAAGGAC
GCTCTTGTTCGGGGCGACAAGGCTCTGAGCGAAGAAAATGGAAGCAATGGTAGCGGGCCCAAGACGACGATGGGC
GCTGACACTCATGCCAGGATCCAGGCAAAGGCTGCCCAGTTGCGTGCCATGAAGGACAATGAACAGCAAGCTGCT
GCCGCCGCTGCTGCATCGCAACGACGCGGCCGCACTGACGCGGAGCTGATGTCGGAAAAGACTAATAGTGTTTTT
ACTCTTCAGCCAATCATTGCTGGCGAGGCCTCTTCGGCTATGAAATGGGTCAAGAAGTACGACAAGGGAACCATC
AAGGATGTGTACATGGCCAACTCGAATGCCGGGCGCGGCGTGGTTGTTACGTCTGACATGCTTGATTTCCCTACG
CCGGCAACGGAAGCCGACATCAGTGTAGATTCGAGCGTTGGAAGAGTTACTCCCGAGGTGCCTAGCAAGACTCCA
TCGCCGGGACCCCATGTTTCCATTATTGCAGCGGCTCGGCCTTCTGTGCAGTCACCTGAGCCAGAGTCGGTGCAT
GAGGATTCGCAGGCACCCGTGCCGAGCACGCCAGAGGTGTCGACGAATGATACACGACGCTCAGAGGCTGCAGAT
GGCAGCTCGACTCCGACTCATGACCAAAAGCTTGTCAAACATGGCACAATTGTTCCCGACGTGGCACAGCATGAA
GGTACAAATGCAAAGGGCCGCATGGAAGGCGCCAAGCTGCATAAGGCGCCAGCTGGCAAGGAGAGGCCCGGAGCG
CTGCGCAAGTTTTTTGGGCGCAAGAATCGCTCGTCCAAGGTTCCAGACAATGCCTCGTCCGACGTCAATGGCATG
TTGCTCAAGGAACAGCCCACTGTTGTGACGGAGCCCATTGTGCAACAGACGCCCACGCCGGCTCCAACGCCTCCT
CCCATGCAGGAAGTGCAAGAGGTGGTGCACCAAGTGCCGCAGGAACCCATGGATCAGCCTGTAGAGGAGCTTGAC
GAGCAGTACTATGAGACTCCTGAGCCGGCTGCCATGCCTACGCCTGAGCCAGACACTCCGCAGACGGGGGAGCAG
GCCGATGTCGAGCCTGACTACAAGGCGAGCGAAGAGCTGTCGCGCGTCGACACGCAAGATGCCGCTGAAGCGACG
CGTGAATTTTCACGCTTCGACCAGGGACCCTTGACTGATCAACCTGCCTTTGCACCGCAAGCAGAAGAGGAAACC
AGGGCCATTTCGCCGCCCATTGCGCGCCCTGCTGCTCGGTCCAATCGCCCAAAGGCGGCCCCAGAAAAGGTTCGC
GAAGGGCTGAGCCACGCTGCAAGCCCGGGTGTCCAAGACCGCTGGGCCCAGATTCGCAAAAACGCTGCCCAAAGA
GCCGCTACTCGACAGAAAGAGGACCGCCCACGCGGTCTTGGCGCCAAGACTGGAGAGGGAGAGGACGATTTGGGA
GACGACACCATTGAATCACGTGTCGCTCGCATCAAGGCTCGTGTAGCCGAGCTCACGGGCAACATGGAAGAGGGT
GGTGACAGCCGCCAGGCCCTACCAAGCCGACGCTAG
Gene >OphauB2|4434
ATGCCTGGTCTCTTCTCTCGGCTCAAGGGCCGCGATGGCGTCCGCTCCAAGAAGAAGAAGAATGCCGCCGCCGCC
GCCGCCTCGCTGCCCCAAAAGCCCACCTGGGATGATGCCTACGCCCGCACCACCGTCGAAGCCGACGAGATACAC
GAGCTGTTGCACTGCTGCACTGCAGAACTAAAGGCCCGAGGTATGCCAACATGAATGCTCGGAATCAATGCGTCT
TGCCGCCATGCCCCTGATTCCGAATGATGCCGTGTCACCCTCGCTGACCTTGTAAACTCGTTTTTCAGCCCTCGA
CCTGCCCTTTTTCATGCTTCCTTTCCGCCCGACTTCCGACCCGAGCGCTGTGCGCACTTTTATTCGCCAATTTTT
CAGCCAAAAGTTGTCTCTACGCGGCGAGGCCTTGCTGCAGGAGATACGCATGACGGAGCCCATGGTAAGACCGTC
AACGGCCTAGCGCCTCTCTGCCTCCAGTAATGCTCATTTGTCGTCTTGTAGGTCATTGCCGGCGTAACAAAGTGG
TGTTGGAGTCGACTTTCGGGCGGCGTCGTTGGCTGGGATGCCTACGAATTGTTCAAGGTTGGAGAATACGGTAAT
ACAAGACGCCTCCTCTTGTACTCTGTTTCAGGTGCTAACCTTGCCCCTCCCACACATTAGACTCAAACCAGGCTC
GGGACTCTTTCAAGACTTTTATCCCAATTAGTGTGGATAACGGGGCCAAACAGCGCATTATTTTTGACTTTTTTG
ACTTGATTGCTGCCGTTGCTGCCCATGGAAAGTCCAATGGCTTTGGTGGCTTGCAGCTCTCTCGCATGGCTGCCT
GGTGGGCTTTTGAGCACAAGGATACGGGCAATGGCTTTGATGGTGGTTACAGGGCTTGGCTCAGGTTAGACACTC
GGCCCACGGCACCCCAAACCTTGAGGCACCTTTCCACGCTGACCCCTTGTACAGTGCTGCCGATGCCACGAGTCA
CCTCTTCTTCGCCTATCTCAGATCTCTTTCGCCTGAGCACCATCTCACCGGCATCTCCATGCTGCCCAGGTCACT
CGAAAAGCTTCTGAGGGAAACGGATTACCCACCGCCCAGGTCGGCTGAAATGATGTCCAGCACCAATAAGCTAGC
CATGATTGTCGACGCTGTGTCCCCTACGCCGTTTTCTCTTTTGCGCCGTGCTGGCCACTTTCAGTATCGTGACTC
GGACAGGGGACTGCAGGAATTTTCAGAACACGATGACCCAGTCCAGGCCCTTTCTGAAGAGTGTTACCGTGTACT
CAAGGCTATTTCAGCCGCCAACCAGTCACAAGTGTCCAACGCCAAGCACTCGACTGGATTGCGTGAAGCGTCTTG
GTCCCGATTTGAGGATATTGGATTTTCTAGCGCCCTTGATGACGATGAGGAGCTTGATGGCATCCAACCCACTCA
CACGACGATGAGGGGCCTTAGGAGTACCCCTGCGTCTGGTAACAACAACATGGCACGGCCCACGACGCCTTCGTG
GGCCGACTTCTTGTCGTCGGGCTTTGTTGATGAGGGTGCTCAGCGACCCAATCTGCTGCTTCCTCCGGACAAGGT
TTTGCCTCCCATTGAGTCACAAGTGAGGCACAGCAGCTCCCAGTCTCACCGTCCACGCCTCGAATCGGACCGCGA
CTTGGAACCGGGTGAGCTTGCTAGCATCACCAAGTTTGAACTTGACGAGGCCTTTTGGTGGGTGTGGATGAGCAG
CTTGGCGCCCGACGAGACGCCAGACAGAAAGTCAGCCTTTGGCAGATGTGCTGTGATTGAGACAAGAATCAGCAG
TGCTCGCTGGATCGTGGTTGAGGAGATTGTTGCTGGCGCTGCCCCCGAACCCGCTGCTGGGGCTTATATTGCGGA
GAAGAAGCGCTTCTTTAGCTGGACAAAGCGTGGCAAGAACATGACTAGGCGCAAGTCGACGGGCAAGGACGCTCT
TGTTCGGGGCGACAAGGCTCTGAGCGAAGAAAATGGAAGCAATGGTAGCGGGCCCAAGACGACGATGGGCGCTGA
CACTCATGCCAGGATCCAGGCAAAGGCTGCCCAGTTGCGTGCCATGAAGGACAATGAACAGCAAGCTGCTGCCGC
CGCTGCTGCATCGCAACGACGCGGCCGCACTGACGCGGAGCTGATGTCGGAAAAGACTAATAGTGTTTTTACTCT
TCAGCCAATCATTGCTGGCGAGGCCTCTTCGGCTATGAAATGGGTCAAGAAGTACGACAAGGGAACCATCAAGGA
TGTGTACATGGCCAACTCGAATGCCGGGCGCGGCGTGGTTGTTACGTCTGACATGCTTGATTTCCCTACGCCGGC
AACGGAAGCCGACATCAGTGTAGATTCGAGCGTTGGAAGAGTTACTCCCGAGGTGCCTAGCAAGACTCCATCGCC
GGGACCCCATGTTTCCATTATTGCAGCGGCTCGGCCTTCTGTGCAGTCACCTGAGCCAGAGTCGGTGCATGAGGA
TTCGCAGGCACCCGTGCCGAGCACGCCAGAGGTGTCGACGAATGATACACGACGCTCAGAGGCTGCAGATGGCAG
CTCGACTCCGACTCATGACCAAAAGCTTGTCAAACATGGCACAATTGTTCCCGACGTGGCACAGCATGAAGGTAC
AAATGCAAAGGGCCGCATGGAAGGCGCCAAGCTGCATAAGGCGCCAGCTGGCAAGGAGAGGCCCGGAGCGCTGCG
CAAGTTTTTTGGGCGCAAGAATCGCTCGTCCAAGGTTCCAGACAATGCCTCGTCCGACGTCAATGGCATGTTGCT
CAAGGAACAGCCCACTGTTGTGACGGAGCCCATTGTGCAACAGACGCCCACGCCGGCTCCAACGCCTCCTCCCAT
GCAGGAAGTGCAAGAGGTGGTGCACCAAGTGCCGCAGGAACCCATGGATCAGCCTGTAGAGGAGCTTGACGAGCA
GTACTATGAGACTCCTGAGCCGGCTGCCATGCCTACGCCTGAGCCAGACACTCCGCAGACGGGGGAGCAGGCCGA
TGTCGAGCCTGACTACAAGGCGAGCGAAGAGCTGTCGCGCGTCGACACGCAAGATGCCGCTGAAGCGACGCGTGA
ATTTTCACGCTTCGACCAGGGACCCTTGACTGATCAACCTGCCTTTGCACCGCAAGCAGAAGAGGAAACCAGGGC
CATTTCGCCGCCCATTGCGCGCCCTGCTGCTCGGTCCAATCGCCCAAAGGCGGCCCCAGAAAAGGTTCGCGAAGG
GCTGAGCCACGCTGCAAGCCCGGGTGTCCAAGACCGCTGGGCCCAGATTCGCAAAAACGCTGCCCAAAGAGCCGC
TACTCGACAGAAAGAGGACCGCCCACGCGGTCTTGGCGCCAAGACTGGAGAGGGAGAGGACGATTTGGGAGACGA
CAGTAAGTGCCTCGTATACCTGCTGTAAGACCATGGCTAACTGGTTGACTAGCCATTGAATCACGTGTCGCTCGC
ATCAAGGCTCGTGTAGCCGAGCTCACGGGCAACATGGAAGAGGGTGGTGACAGCCGCCAGGCCCTACCAAGCCGA
CGCTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail