Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|4428
Gene name
LocationContig_3:133071..133797
Strand+
Gene length (bp)726
Transcript length (bp)669
Coding sequence length (bp)669
Protein length (aa) 223

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF20354 DUF6649 Family of unknown function (DUF6649) 1.6E-36 29 198

Swissprot hits

(None)

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup5885
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2753
Ophiocordyceps australis map64 (Brazil) OphauB2|4428 (this protein)
Ophiocordyceps camponoti-floridani Ophcf2|03369
Ophiocordyceps camponoti-rufipedis Ophun1|584
Ophiocordyceps kimflemingae Ophio5|2260

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|4428
MVQGVNGAWAHGASAAPDATLMDMDVDAAAGRKRKAESQDNERLSKRLSLLNLERNGSKLYVHVETPSSSSCAPS
NAAPPPLQQGGQDVMQLDDTKNKVYIYNLDDELSSSDGESDDGKLVFLPDIDKHLRNQRIPPHVLANPQGELAGM
QMVLYSDPRSLSVPEEHDSVRKAIIDARRRARDKYRQDAPSSAQETQSSISDAPTAPNVQLDDNEYDAMDID*
Coding >OphauB2|4428
ATGGTGCAGGGCGTCAATGGTGCCTGGGCCCATGGCGCCAGCGCAGCCCCAGACGCGACCTTGATGGACATGGAC
GTGGACGCTGCCGCTGGCCGGAAGCGCAAGGCCGAGTCACAGGACAATGAGCGCCTTTCAAAGCGGCTTAGCCTG
CTTAATCTCGAGCGCAACGGCTCCAAACTCTACGTGCACGTCGAGACGCCATCTTCTTCTTCATGCGCCCCCAGC
AATGCGGCGCCTCCCCCGCTACAACAGGGCGGCCAGGACGTGATGCAGCTCGACGACACCAAGAACAAGGTCTAC
ATTTACAATCTCGATGATGAGCTCTCTTCCTCTGACGGCGAAAGCGACGACGGCAAGCTTGTCTTCCTGCCCGAC
ATTGACAAGCATCTCCGCAACCAGCGTATACCGCCTCATGTCCTGGCCAATCCACAGGGCGAACTTGCCGGCATG
CAAATGGTACTCTATTCGGATCCGCGATCCCTCTCGGTGCCTGAGGAACACGACAGCGTGCGCAAGGCCATTATC
GATGCGCGGCGACGTGCCAGAGATAAATATCGCCAGGATGCCCCCTCGTCTGCCCAAGAGACGCAATCCTCCATC
TCGGATGCACCAACAGCTCCAAATGTACAACTTGACGATAATGAATATGATGCCATGGATATAGATTGA
Transcript >OphauB2|4428
ATGGTGCAGGGCGTCAATGGTGCCTGGGCCCATGGCGCCAGCGCAGCCCCAGACGCGACCTTGATGGACATGGAC
GTGGACGCTGCCGCTGGCCGGAAGCGCAAGGCCGAGTCACAGGACAATGAGCGCCTTTCAAAGCGGCTTAGCCTG
CTTAATCTCGAGCGCAACGGCTCCAAACTCTACGTGCACGTCGAGACGCCATCTTCTTCTTCATGCGCCCCCAGC
AATGCGGCGCCTCCCCCGCTACAACAGGGCGGCCAGGACGTGATGCAGCTCGACGACACCAAGAACAAGGTCTAC
ATTTACAATCTCGATGATGAGCTCTCTTCCTCTGACGGCGAAAGCGACGACGGCAAGCTTGTCTTCCTGCCCGAC
ATTGACAAGCATCTCCGCAACCAGCGTATACCGCCTCATGTCCTGGCCAATCCACAGGGCGAACTTGCCGGCATG
CAAATGGTACTCTATTCGGATCCGCGATCCCTCTCGGTGCCTGAGGAACACGACAGCGTGCGCAAGGCCATTATC
GATGCGCGGCGACGTGCCAGAGATAAATATCGCCAGGATGCCCCCTCGTCTGCCCAAGAGACGCAATCCTCCATC
TCGGATGCACCAACAGCTCCAAATGTACAACTTGACGATAATGAATATGATGCCATGGATATAGATTGA
Gene >OphauB2|4428
ATGGTGCAGGGCGTCAATGGTGCCTGGGCCCATGGCGCCAGCGCAGCCCCAGACGCGACCTTGATGGACATGGAC
GTGGACGCTGCCGCTGGCCGGAAGCGCAAGGCCGAGTCACAGGACAATGAGCGCCTTTCAAAGCGGCTTAGCCTG
CTTAATCTCGGTAAGGCGCTTGCTTTTTCCTCTGCTCGGCCCCATGCTGACGCGCAGGTGCTTGCAGAGCGCAAC
GGCTCCAAACTCTACGTGCACGTCGAGACGCCATCTTCTTCTTCATGCGCCCCCAGCAATGCGGCGCCTCCCCCG
CTACAACAGGGCGGCCAGGACGTGATGCAGCTCGACGACACCAAGAACAAGGTCTACATTTACAATCTCGATGAT
GAGCTCTCTTCCTCTGACGGCGAAAGCGACGACGGCAAGCTTGTCTTCCTGCCCGACATTGACAAGCATCTCCGC
AACCAGCGTATACCGCCTCATGTCCTGGCCAATCCACAGGGCGAACTTGCCGGCATGCAAATGGTACTCTATTCG
GATCCGCGATCCCTCTCGGTGCCTGAGGAACACGACAGCGTGCGCAAGGCCATTATCGATGCGCGGCGACGTGCC
AGAGATAAATATCGCCAGGATGCCCCCTCGTCTGCCCAAGAGACGCAATCCTCCATCTCGGATGCACCAACAGCT
CCAAATGTACAACTTGACGATAATGAATATGATGCCATGGATATAGATTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail