Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|4424
Gene name
LocationContig_3:123980..125062
Strand+
Gene length (bp)1082
Transcript length (bp)966
Coding sequence length (bp)966
Protein length (aa) 322

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07500 TFIIS_M Transcription factor S-II (TFIIS), central domain 3.2E-27 159 267
PF01096 TFIIS_C Transcription factor S-II (TFIIS) 1.2E-17 282 319
PF08711 Med26 TFIIS helical bundle-like domain 3.3E-05 63 97

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P49373|TFS2_SCHPO Transcription elongation factor S-II OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tfs1 PE=3 SV=1 1 321 3.0E-65
sp|P07273|TFS2_YEAST Transcription elongation factor S-II OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DST1 PE=1 SV=4 1 321 7.0E-47
sp|P23193|TCEA1_HUMAN Transcription elongation factor A protein 1 OS=Homo sapiens GN=TCEA1 PE=1 SV=2 61 320 2.0E-31
sp|P10711|TCEA1_MOUSE Transcription elongation factor A protein 1 OS=Mus musculus GN=Tcea1 PE=1 SV=2 61 320 7.0E-31
sp|Q4KLL0|TCEA1_RAT Transcription elongation factor A protein 1 OS=Rattus norvegicus GN=Tcea1 PE=1 SV=1 61 320 1.0E-30
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P49373|TFS2_SCHPO Transcription elongation factor S-II OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tfs1 PE=3 SV=1 1 321 3.0E-65
sp|P07273|TFS2_YEAST Transcription elongation factor S-II OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DST1 PE=1 SV=4 1 321 7.0E-47
sp|P23193|TCEA1_HUMAN Transcription elongation factor A protein 1 OS=Homo sapiens GN=TCEA1 PE=1 SV=2 61 320 2.0E-31
sp|P10711|TCEA1_MOUSE Transcription elongation factor A protein 1 OS=Mus musculus GN=Tcea1 PE=1 SV=2 61 320 7.0E-31
sp|Q4KLL0|TCEA1_RAT Transcription elongation factor A protein 1 OS=Rattus norvegicus GN=Tcea1 PE=1 SV=1 61 320 1.0E-30
sp|Q63799|TCEA2_RAT Transcription elongation factor A protein 2 OS=Rattus norvegicus GN=Tcea2 PE=2 SV=1 61 320 8.0E-30
sp|Q9QVN7|TCEA2_MOUSE Transcription elongation factor A protein 2 OS=Mus musculus GN=Tcea2 PE=2 SV=2 61 320 2.0E-29
sp|Q15560|TCEA2_HUMAN Transcription elongation factor A protein 2 OS=Homo sapiens GN=TCEA2 PE=1 SV=1 61 320 2.0E-29
sp|Q29RL9|TCEA1_BOVIN Transcription elongation factor A protein 1 OS=Bos taurus GN=TCEA1 PE=2 SV=1 61 320 3.0E-29
sp|Q148K0|TCEA2_BOVIN Transcription elongation factor A protein 2 OS=Bos taurus GN=TCEA2 PE=2 SV=1 1 320 7.0E-29
sp|Q54YG9|TCEA1_DICDI Transcription elongation factor A protein 1 OS=Dictyostelium discoideum GN=tcea1 PE=3 SV=1 61 320 9.0E-29
sp|P52652|TFS2_CAEEL Putative transcription elongation factor S-II OS=Caenorhabditis elegans GN=T24H10.1 PE=3 SV=1 61 320 4.0E-25
sp|Q9ZVH8|RDO2_ARATH Transcription elongation factor TFIIS OS=Arabidopsis thaliana GN=TFIIS PE=1 SV=1 177 320 7.0E-25
sp|P23881|TCEA3_MOUSE Transcription elongation factor A protein 3 OS=Mus musculus GN=Tcea3 PE=1 SV=3 158 320 2.0E-23
sp|Q2KI09|TCEA3_BOVIN Transcription elongation factor A protein 3 OS=Bos taurus GN=TCEA3 PE=2 SV=1 24 320 2.0E-22
sp|P20232|TFS2_DROME Transcription elongation factor S-II OS=Drosophila melanogaster GN=TfIIS PE=2 SV=1 189 320 3.0E-22
sp|O75764|TCEA3_HUMAN Transcription elongation factor A protein 3 OS=Homo sapiens GN=TCEA3 PE=1 SV=2 158 320 2.0E-21
sp|Q8N8B7|TEANC_HUMAN Transcription elongation factor A N-terminal and central domain-containing protein OS=Homo sapiens GN=TCEANC PE=1 SV=2 46 321 4.0E-09
sp|P0C8F6|TFS2_ASFM2 Transcription factor S-II-related protein OS=African swine fever virus (isolate Tick/Malawi/Lil 20-1/1983) GN=Mal-147 PE=2 SV=1 229 318 6.0E-09
sp|Q9GMV6|TEANC_MACFA Transcription elongation factor A N-terminal and central domain-containing protein OS=Macaca fascicularis GN=TCEANC PE=2 SV=1 162 321 2.0E-08
sp|P0C8F8|TFS2_ASFWA Transcription factor S-II-related protein OS=African swine fever virus (isolate Warthog/Namibia/Wart80/1980) GN=War-150 PE=2 SV=1 229 318 1.0E-07
sp|P0C8F7|TFS2_ASFP4 Transcription factor S-II-related protein OS=African swine fever virus (isolate Tick/South Africa/Pretoriuskop Pr4/1996) GN=Pret-152 PE=2 SV=1 229 318 2.0E-07
sp|P27948|TFS2_ASFB7 Transcription factor S-II-related protein OS=African swine fever virus (strain Badajoz 1971 Vero-adapted) GN=BA71V-140 PE=2 SV=1 229 318 2.0E-07
sp|Q3US16|TEANC_MOUSE Transcription elongation factor A N-terminal and central domain-containing protein OS=Mus musculus GN=Tceanc PE=2 SV=1 74 318 2.0E-07
sp|P0C8F5|TFS2_ASFK5 Transcription factor S-II-related protein OS=African swine fever virus (isolate Pig/Kenya/KEN-50/1950) GN=Ken-151 PE=2 SV=1 229 318 4.0E-07
sp|Q04307|RPC10_YEAST DNA-directed RNA polymerase III subunit RPC10 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPC11 PE=1 SV=1 286 319 1.0E-06
sp|Q9CQZ7|RPC10_MOUSE DNA-directed RNA polymerase III subunit RPC10 OS=Mus musculus GN=Polr3k PE=3 SV=1 283 319 2.0E-06
sp|Q9Y2Y1|RPC10_HUMAN DNA-directed RNA polymerase III subunit RPC10 OS=Homo sapiens GN=POLR3K PE=1 SV=2 283 319 2.0E-06
sp|Q6GZP4|081R_FRG3G Putative transcription elongation factor S-II-like protein 81R OS=Frog virus 3 (isolate Goorha) GN=FV3-081R PE=3 SV=1 280 318 9.0E-06
sp|Q2M2S7|RPC10_BOVIN DNA-directed RNA polymerase III subunit RPC10 OS=Bos taurus GN=POLR3K PE=3 SV=1 283 319 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0003676 nucleic acid binding Yes
GO:0006351 transcription, DNA-templated Yes
GO:0008270 zinc ion binding Yes
GO:0009059 macromolecule biosynthetic process No
GO:0046872 metal ion binding No
GO:0019438 aromatic compound biosynthetic process No
GO:1901360 organic cyclic compound metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0018130 heterocycle biosynthetic process No
GO:1901576 organic substance biosynthetic process No
GO:0043167 ion binding No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0003674 molecular_function No
GO:0043169 cation binding No
GO:0008150 biological_process No
GO:0005488 binding No
GO:0034654 nucleobase-containing compound biosynthetic process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0043170 macromolecule metabolic process No
GO:0046914 transition metal ion binding No
GO:0044237 cellular metabolic process No
GO:0016070 RNA metabolic process No
GO:0046483 heterocycle metabolic process No
GO:0009058 biosynthetic process No
GO:0044238 primary metabolic process No
GO:0097659 nucleic acid-templated transcription No
GO:0009987 cellular process No
GO:1901362 organic cyclic compound biosynthetic process No
GO:0008152 metabolic process No
GO:0044271 cellular nitrogen compound biosynthetic process No
GO:0032774 RNA biosynthetic process No
GO:0071704 organic substance metabolic process No
GO:1901363 heterocyclic compound binding No
GO:0044249 cellular biosynthetic process No
GO:0097159 organic cyclic compound binding No
GO:0090304 nucleic acid metabolic process No
GO:0006139 nucleobase-containing compound metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 47 0.45

Transmembrane Domains

(None)

Transcription Factor Class

Transcription Factor Class
(based on PFAM domains)
Transcription factor TFIIS

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|4424
MDQRELEARVKALTKSVNTNEPAENAIRLLESLKKEAAPTEEMLRVSSRSFGWELTHVDCIFEATRAGVYVGKLR
SNANKEIARAAAELVIKWKKLVEQEKHSKLQKAKMSSPASASKSLSASPAVAPSPLATGSKKAFTGDTEKRKFDS
DGVDIKRTDSNVRNQCIGLIYNGLAYRSTEPAVDVIARAVAVEQAAMDAYKGETAEYKKKIRSLFSNLKTKSNRE
LGIRVMTGDILPDKFVVMTDDELKSEDQRKKDIELEKENMKKAQVPMAEKSISDSLECGRCKQKKVSYTQAQTRS
ADEPMTTFCECMGCGHRWKFS*
Coding >OphauB2|4424
ATGGACCAACGCGAGCTGGAGGCGCGCGTCAAGGCGTTGACCAAGTCTGTCAATACAAACGAACCAGCAGAAAAT
GCCATTCGCTTGCTCGAGTCACTCAAGAAGGAGGCGGCTCCAACCGAGGAAATGCTGCGGGTGAGCTCCCGGAGC
TTTGGCTGGGAGCTCACTCATGTTGACTGCATCTTTGAGGCAACTCGTGCTGGTGTCTATGTTGGCAAACTCCGA
TCAAACGCCAACAAGGAAATCGCACGGGCGGCTGCGGAGCTGGTGATTAAGTGGAAGAAGCTGGTGGAGCAAGAG
AAGCACTCCAAGTTGCAAAAGGCAAAGATGAGCTCACCAGCGTCGGCGTCGAAATCGCTGTCTGCTAGTCCTGCC
GTGGCACCGTCGCCGCTTGCTACGGGTAGCAAAAAGGCCTTTACGGGGGATACCGAGAAGCGCAAGTTTGACAGC
GATGGGGTGGACATTAAACGCACCGACTCCAATGTGCGCAACCAATGCATCGGCCTCATATACAATGGGCTGGCC
TACCGCTCGACGGAGCCGGCCGTGGACGTGATTGCGCGGGCCGTGGCTGTGGAACAAGCAGCCATGGATGCCTAC
AAGGGCGAGACGGCCGAGTACAAGAAGAAGATTCGCTCCCTCTTCTCCAACCTCAAGACCAAGTCGAACCGCGAG
CTGGGCATCCGCGTCATGACGGGCGACATTTTGCCGGACAAGTTTGTCGTCATGACGGACGACGAGCTCAAGAGC
GAGGACCAGCGCAAAAAGGACATTGAGCTGGAAAAGGAAAACATGAAGAAGGCTCAGGTGCCCATGGCGGAAAAG
AGCATCAGCGACAGCCTCGAGTGCGGCCGCTGCAAACAAAAGAAAGTCAGCTACACCCAGGCGCAAACGCGAAGC
GCCGATGAGCCCATGACGACGTTTTGCGAGTGCATGGGCTGCGGCCATCGCTGGAAGTTTTCCTAG
Transcript >OphauB2|4424
ATGGACCAACGCGAGCTGGAGGCGCGCGTCAAGGCGTTGACCAAGTCTGTCAATACAAACGAACCAGCAGAAAAT
GCCATTCGCTTGCTCGAGTCACTCAAGAAGGAGGCGGCTCCAACCGAGGAAATGCTGCGGGTGAGCTCCCGGAGC
TTTGGCTGGGAGCTCACTCATGTTGACTGCATCTTTGAGGCAACTCGTGCTGGTGTCTATGTTGGCAAACTCCGA
TCAAACGCCAACAAGGAAATCGCACGGGCGGCTGCGGAGCTGGTGATTAAGTGGAAGAAGCTGGTGGAGCAAGAG
AAGCACTCCAAGTTGCAAAAGGCAAAGATGAGCTCACCAGCGTCGGCGTCGAAATCGCTGTCTGCTAGTCCTGCC
GTGGCACCGTCGCCGCTTGCTACGGGTAGCAAAAAGGCCTTTACGGGGGATACCGAGAAGCGCAAGTTTGACAGC
GATGGGGTGGACATTAAACGCACCGACTCCAATGTGCGCAACCAATGCATCGGCCTCATATACAATGGGCTGGCC
TACCGCTCGACGGAGCCGGCCGTGGACGTGATTGCGCGGGCCGTGGCTGTGGAACAAGCAGCCATGGATGCCTAC
AAGGGCGAGACGGCCGAGTACAAGAAGAAGATTCGCTCCCTCTTCTCCAACCTCAAGACCAAGTCGAACCGCGAG
CTGGGCATCCGCGTCATGACGGGCGACATTTTGCCGGACAAGTTTGTCGTCATGACGGACGACGAGCTCAAGAGC
GAGGACCAGCGCAAAAAGGACATTGAGCTGGAAAAGGAAAACATGAAGAAGGCTCAGGTGCCCATGGCGGAAAAG
AGCATCAGCGACAGCCTCGAGTGCGGCCGCTGCAAACAAAAGAAAGTCAGCTACACCCAGGCGCAAACGCGAAGC
GCCGATGAGCCCATGACGACGTTTTGCGAGTGCATGGGCTGCGGCCATCGCTGGAAGTTTTCCTAG
Gene >OphauB2|4424
ATGGACCAACGCGAGCTGGAGGCGCGCGTCAAGGCGTTGACCAAGTCTGTCAATACAAACGAACCAGCAGAAAAT
GCCATTCGCTTGCTCGAGTCACTCAAGAAGGAGGCGGCTCCAACCGAGGAAATGCTGCGGGTGAGCTCGTTTGCC
CTTTTTGCATCCCCTCCCCCCCATCCTTGATGGTGTTTTTGAGCAGCTGGTGGAAGCCGGAGCTTTGGCTGGGAG
CTCACTCATGTTGACTGCATCTTTGAGGCAACTCGTGCTGGTGTCTATGTTGGCAAACTCCGATCAAACGCCAAC
AAGGAAATCGCACGGGCGGCTGCGGAGCTGGTGATTAAGTGGAAGAAGCTGGTGGAGCAAGAGAAGCACTCCAAG
TTGCAAAAGGCAAAGATGAGCTCACCAGCGTCGGCGTCGAAATCGCTGTCTGCTAGTCCTGCCGTGGCACCGTCG
CCGCTTGCTACGGGTAGCAAAAAGGCCTTTACGGGGGATACCGAGAAGCGCAAGTTTGACAGCGATGGGGTGGAC
ATTAAACGCACCGACTCCAATGTGCGCAACCAATGCATCGGCCTCATATACAATGGGCTGGCCTACCGCTCGACG
GAGCCGGCCGTGGACGTGATTGCGCGGGCCGTGGCTGTGGAACAAGCAGCCATGGATGCCTACAAGGGCGAGACG
GCCGAGTACAAGAAGAAGATTCGCTCCCTCTTCTCCAACCTCAAGACCAAGTCGAACCGCGAGCTGGGCATCCGC
GTCATGACGGGCGACATTTTGCCGGACAAGTTTGTCGTCATGACGGACGACGAGCTCAAGAGCGAGGACCAGCGC
AAAAAGGACATTGAGCTGGAAAAGGAAAACATGAAGAAGGCTCAGGTGCCCATGGCGGAAAAGAGCATCAGCGAC
AGCCTCGAGTGCGGCCGCTGCAAACAAAAGAAAGTCAGCTACACCCAGGCGCAAACGCGAAGCGCCGATGAGCCC
ATGACGACGTTTTGCGAGTGCATGGGCTGCGGCCATCGCTGGAAGGTGGGCCGACCAAGATTAAAAGGCTTGATG
GGTGCGCTGACAGCTTGCTACAGTTTTCCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail