Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|4405
Gene name
LocationContig_3:74958..77757
Strand-
Gene length (bp)2799
Transcript length (bp)2526
Coding sequence length (bp)2526
Protein length (aa) 842

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) 6.1E-08 6 68
PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) 1.5E-16 308 376
PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) 1.0E-09 490 550
PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) 3.3E-11 614 688
PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) 1.4E-14 719 787

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q7SG09|MRD1_NEUCR Multiple RNA-binding domain-containing protein 1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=mrd-1 PE=3 SV=1 2 840 0.0E+00
sp|Q4WJT7|MRD1_ASPFU Multiple RNA-binding domain-containing protein 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=mrd1 PE=3 SV=1 1 840 0.0E+00
sp|Q5BGA9|MRD1_EMENI Multiple RNA-binding domain-containing protein 1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=mrd1 PE=3 SV=1 1 834 0.0E+00
sp|Q6CEW9|MRD1_YARLI Multiple RNA-binding domain-containing protein 1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=MRD1 PE=3 SV=1 4 838 0.0E+00
sp|Q5AJS6|MRD1_CANAL Multiple RNA-binding domain-containing protein 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=MRD1 PE=3 SV=1 4 840 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q7SG09|MRD1_NEUCR Multiple RNA-binding domain-containing protein 1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=mrd-1 PE=3 SV=1 2 840 0.0E+00
sp|Q4WJT7|MRD1_ASPFU Multiple RNA-binding domain-containing protein 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=mrd1 PE=3 SV=1 1 840 0.0E+00
sp|Q5BGA9|MRD1_EMENI Multiple RNA-binding domain-containing protein 1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=mrd1 PE=3 SV=1 1 834 0.0E+00
sp|Q6CEW9|MRD1_YARLI Multiple RNA-binding domain-containing protein 1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=MRD1 PE=3 SV=1 4 838 0.0E+00
sp|Q5AJS6|MRD1_CANAL Multiple RNA-binding domain-containing protein 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=MRD1 PE=3 SV=1 4 840 0.0E+00
sp|O13620|MRD1_SCHPO Multiple RNA-binding domain-containing protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mrd1 PE=3 SV=1 4 810 6.0E-177
sp|Q6CQR6|MRD1_KLULA Multiple RNA-binding domain-containing protein 1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=MRD1 PE=3 SV=1 4 840 2.0E-175
sp|Q75A83|MRD1_ASHGO Multiple RNA-binding domain-containing protein 1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=MRD1 PE=3 SV=2 4 837 4.0E-167
sp|Q06106|MRD1_YEAST Multiple RNA-binding domain-containing protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MRD1 PE=1 SV=1 4 840 3.0E-166
sp|Q6FXP4|MRD1_CANGA Multiple RNA-binding domain-containing protein 1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=MRD1 PE=3 SV=1 4 838 3.0E-165
sp|P0CR16|MRD1_CRYNJ Multiple RNA-binding domain-containing protein 1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=MRD1 PE=3 SV=1 300 840 4.0E-121
sp|P0CR17|MRD1_CRYNB Multiple RNA-binding domain-containing protein 1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=MRD1 PE=3 SV=1 300 840 4.0E-121
sp|Q4PC17|MRD1_USTMA Multiple RNA-binding domain-containing protein 1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=MRD1 PE=3 SV=1 259 808 9.0E-120
sp|Q54PB2|MRD1_DICDI Multiple RNA-binding domain-containing protein 1 OS=Dictyostelium discoideum GN=mrd1 PE=3 SV=1 300 817 3.0E-94
sp|Q9Y4C8|RBM19_HUMAN Probable RNA-binding protein 19 OS=Homo sapiens GN=RBM19 PE=1 SV=3 302 825 5.0E-92
sp|Q8R3C6|RBM19_MOUSE Probable RNA-binding protein 19 OS=Mus musculus GN=Rbm19 PE=1 SV=1 280 810 6.0E-91
sp|P04147|PABP_YEAST Polyadenylate-binding protein, cytoplasmic and nuclear OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PAB1 PE=1 SV=4 613 789 3.0E-14
sp|O74400|YOCE_SCHPO Uncharacterized RNA-binding protein C4F6.14 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC4F6.14 PE=1 SV=1 610 792 8.0E-14
sp|P27476|NSR1_YEAST Nuclear localization sequence-binding protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NSR1 PE=1 SV=1 606 792 9.0E-14
sp|Q74ZS6|PABP_ASHGO Polyadenylate-binding protein, cytoplasmic and nuclear OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=PAB1 PE=3 SV=1 613 789 1.0E-13
sp|O04319|PABP6_ARATH Polyadenylate-binding protein 6 OS=Arabidopsis thaliana GN=PAB6 PE=2 SV=1 308 712 5.0E-13
sp|Q8SR30|PABP_ENCCU Polyadenylate-binding protein, cytoplasmic and nuclear OS=Encephalitozoon cuniculi (strain GB-M1) GN=PAB1 PE=1 SV=1 611 784 2.0E-12
sp|Q8CGC6|RBM28_MOUSE RNA-binding protein 28 OS=Mus musculus GN=Rbm28 PE=1 SV=4 610 795 2.0E-12
sp|A5DW14|PABP_LODEL Polyadenylate-binding protein, cytoplasmic and nuclear OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=PAB1 PE=3 SV=1 613 827 2.0E-12
sp|Q6CSV3|PABP_KLULA Polyadenylate-binding protein, cytoplasmic and nuclear OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=PAB1 PE=3 SV=1 585 808 3.0E-12
sp|P31209|PABP_SCHPO Polyadenylate-binding protein, cytoplasmic and nuclear OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pab1 PE=1 SV=2 610 789 5.0E-12
sp|Q6FKG4|PABP_CANGA Polyadenylate-binding protein, cytoplasmic and nuclear OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=PAB1 PE=3 SV=1 613 793 5.0E-12
sp|Q9NW13|RBM28_HUMAN RNA-binding protein 28 OS=Homo sapiens GN=RBM28 PE=1 SV=3 610 795 5.0E-12
sp|Q4VXU2|PAP1L_HUMAN Polyadenylate-binding protein 1-like OS=Homo sapiens GN=PABPC1L PE=2 SV=1 613 787 6.0E-12
sp|Q05196|PABP5_ARATH Polyadenylate-binding protein 5 OS=Arabidopsis thaliana GN=PAB5 PE=1 SV=3 526 782 1.0E-11
sp|O04319|PABP6_ARATH Polyadenylate-binding protein 6 OS=Arabidopsis thaliana GN=PAB6 PE=2 SV=1 476 813 2.0E-11
sp|A3LXL0|PABP_PICST Polyadenylate-binding protein, cytoplasmic and nuclear OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=PAB1 PE=3 SV=1 613 789 2.0E-11
sp|P42731|PABP2_ARATH Polyadenylate-binding protein 2 OS=Arabidopsis thaliana GN=PAB2 PE=1 SV=1 613 777 3.0E-11
sp|P19338|NUCL_HUMAN Nucleolin OS=Homo sapiens GN=NCL PE=1 SV=3 483 793 3.0E-11
sp|Q5RF26|NUCL_PONAB Nucleolin OS=Pongo abelii GN=NCL PE=2 SV=3 483 793 3.0E-11
sp|Q4R4J7|NUCL_MACFA Nucleolin OS=Macaca fascicularis GN=NCL PE=2 SV=3 483 793 3.0E-11
sp|O22173|PABP4_ARATH Polyadenylate-binding protein 4 OS=Arabidopsis thaliana GN=PAB4 PE=1 SV=1 613 777 4.0E-11
sp|Q6CSV3|PABP_KLULA Polyadenylate-binding protein, cytoplasmic and nuclear OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=PAB1 PE=3 SV=1 483 793 1.0E-10
sp|A4QUF0|PABP_MAGO7 Polyadenylate-binding protein, cytoplasmic and nuclear OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=PAB1 PE=3 SV=1 613 793 2.0E-10
sp|Q2GSX8|PABP_CHAGB Polyadenylate-binding protein, cytoplasmic and nuclear OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=PAB1 PE=3 SV=1 613 793 2.0E-10
sp|Q1DXH0|PABP_COCIM Polyadenylate-binding protein, cytoplasmic and nuclear OS=Coccidioides immitis (strain RS) GN=PAB1 PE=3 SV=1 613 793 2.0E-10
sp|Q9LHP2|SL30A_ARATH Serine/arginine-rich SC35-like splicing factor SCL30A OS=Arabidopsis thaliana GN=SCL30A PE=1 SV=1 308 379 3.0E-10
sp|Q9SEU4|SRC33_ARATH Serine/arginine-rich SC35-like splicing factor SCL33 OS=Arabidopsis thaliana GN=SCL33 PE=1 SV=1 308 379 4.0E-10
sp|Q5AI15|PABP_CANAL Polyadenylate-binding protein, cytoplasmic and nuclear OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PAB1 PE=3 SV=1 613 789 4.0E-10
sp|Q08935|ROC1_NICSY 29 kDa ribonucleoprotein A, chloroplastic OS=Nicotiana sylvestris PE=2 SV=1 585 794 7.0E-10
sp|Q8L3X8|SRC30_ARATH Serine/arginine-rich SC35-like splicing factor SCL30 OS=Arabidopsis thaliana GN=SCL30 PE=1 SV=1 308 379 1.0E-09
sp|Q4P8R9|PABP_USTMA Polyadenylate-binding protein, cytoplasmic and nuclear OS=Ustilago maydis (strain 521 / FGSC 9021) GN=PAB1 PE=3 SV=1 613 793 2.0E-09
sp|Q6BI95|PABP_DEBHA Polyadenylate-binding protein, cytoplasmic and nuclear OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=PAB1 PE=3 SV=2 613 789 2.0E-09
sp|Q0U1G2|PABP_PHANO Polyadenylate-binding protein, cytoplasmic and nuclear OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=PAB1 PE=3 SV=3 613 789 2.0E-09
sp|A5DM21|PABP_PICGU Polyadenylate-binding protein, cytoplasmic and nuclear OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=PAB1 PE=3 SV=2 588 797 2.0E-09
sp|P37838|NOP4_YEAST Nucleolar protein 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NOP4 PE=1 SV=1 613 792 3.0E-09
sp|Q9ZQA8|PABP7_ARATH Polyadenylate-binding protein 7 OS=Arabidopsis thaliana GN=PAB7 PE=2 SV=1 482 810 4.0E-09
sp|Q4WK03|PABP_ASPFU Polyadenylate-binding protein, cytoplasmic and nuclear OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=pab1 PE=3 SV=1 613 793 4.0E-09
sp|A1D4K4|PABP_NEOFI Polyadenylate-binding protein, cytoplasmic and nuclear OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=pab1 PE=3 SV=1 613 793 4.0E-09
sp|Q9H361|PABP3_HUMAN Polyadenylate-binding protein 3 OS=Homo sapiens GN=PABPC3 PE=1 SV=2 613 805 5.0E-09
sp|Q5B630|PABP_EMENI Polyadenylate-binding protein, cytoplasmic and nuclear OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=pab1 PE=2 SV=2 613 793 5.0E-09
sp|P49313|ROC1_NICPL 30 kDa ribonucleoprotein, chloroplastic OS=Nicotiana plumbaginifolia PE=2 SV=1 614 794 5.0E-09
sp|P04147|PABP_YEAST Polyadenylate-binding protein, cytoplasmic and nuclear OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PAB1 PE=1 SV=4 606 797 6.0E-09
sp|Q9EPH8|PABP1_RAT Polyadenylate-binding protein 1 OS=Rattus norvegicus GN=Pabpc1 PE=1 SV=1 613 805 7.0E-09
sp|P0CB38|PAB4L_HUMAN Polyadenylate-binding protein 4-like OS=Homo sapiens GN=PABPC4L PE=2 SV=1 613 835 8.0E-09
sp|P0CP46|PABP_CRYNJ Polyadenylate-binding protein, cytoplasmic and nuclear OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=PAB1 PE=3 SV=1 613 805 8.0E-09
sp|P0CP47|PABP_CRYNB Polyadenylate-binding protein, cytoplasmic and nuclear OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=PAB1 PE=3 SV=1 613 805 8.0E-09
sp|P29341|PABP1_MOUSE Polyadenylate-binding protein 1 OS=Mus musculus GN=Pabpc1 PE=1 SV=2 613 805 8.0E-09
sp|P11940|PABP1_HUMAN Polyadenylate-binding protein 1 OS=Homo sapiens GN=PABPC1 PE=1 SV=2 613 805 9.0E-09
sp|P61286|PABP1_BOVIN Polyadenylate-binding protein 1 OS=Bos taurus GN=PABPC1 PE=2 SV=1 613 805 9.0E-09
sp|Q5R8F7|PABP1_PONAB Polyadenylate-binding protein 1 OS=Pongo abelii GN=PABPC1 PE=2 SV=1 613 805 9.0E-09
sp|P42731|PABP2_ARATH Polyadenylate-binding protein 2 OS=Arabidopsis thaliana GN=PAB2 PE=1 SV=1 483 826 1.0E-08
sp|P42731|PABP2_ARATH Polyadenylate-binding protein 2 OS=Arabidopsis thaliana GN=PAB2 PE=1 SV=1 612 789 1.0E-08
sp|P28644|ROC1_SPIOL 28 kDa ribonucleoprotein, chloroplastic OS=Spinacia oleracea PE=1 SV=1 614 793 1.0E-08
sp|O64380|PABP3_ARATH Polyadenylate-binding protein 3 OS=Arabidopsis thaliana GN=PAB3 PE=2 SV=1 613 782 1.0E-08
sp|P20965|PABPA_XENLA Polyadenylate-binding protein 1-A OS=Xenopus laevis GN=pabpc1-a PE=1 SV=3 613 805 1.0E-08
sp|A5DW14|PABP_LODEL Polyadenylate-binding protein, cytoplasmic and nuclear OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=PAB1 PE=3 SV=1 588 793 2.0E-08
sp|Q0CR95|PABP_ASPTN Polyadenylate-binding protein, cytoplasmic and nuclear OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=pab1 PE=3 SV=1 613 793 2.0E-08
sp|A2Q848|PABP_ASPNC Polyadenylate-binding protein, cytoplasmic and nuclear OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=pab1 PE=3 SV=1 613 793 2.0E-08
sp|Q7S6N6|PABP_NEUCR Polyadenylate-binding protein, cytoplasmic and nuclear OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=pabp-1 PE=3 SV=1 613 793 2.0E-08
sp|P70372|ELAV1_MOUSE ELAV-like protein 1 OS=Mus musculus GN=Elavl1 PE=1 SV=2 692 841 3.0E-08
sp|Q6IP09|PABPB_XENLA Polyadenylate-binding protein 1-B OS=Xenopus laevis GN=pabpc1-b PE=2 SV=1 613 805 3.0E-08
sp|O61374|SXL_CERCA Sex-lethal homolog OS=Ceratitis capitata GN=SXL PE=2 SV=2 612 803 3.0E-08
sp|P31209|PABP_SCHPO Polyadenylate-binding protein, cytoplasmic and nuclear OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pab1 PE=1 SV=2 612 797 4.0E-08
sp|O22173|PABP4_ARATH Polyadenylate-binding protein 4 OS=Arabidopsis thaliana GN=PAB4 PE=1 SV=1 490 793 4.0E-08
sp|Q13310|PABP4_HUMAN Polyadenylate-binding protein 4 OS=Homo sapiens GN=PABPC4 PE=1 SV=1 613 805 4.0E-08
sp|Q04836|CP31A_ARATH 31 kDa ribonucleoprotein, chloroplastic OS=Arabidopsis thaliana GN=CP31A PE=1 SV=1 614 793 5.0E-08
sp|P08199|NUCL_MESAU Nucleolin OS=Mesocricetus auratus GN=NCL PE=1 SV=2 473 793 5.0E-08
sp|Q2UK72|PABP_ASPOR Polyadenylate-binding protein, cytoplasmic and nuclear OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=pab1 PE=3 SV=1 613 793 6.0E-08
sp|P09405|NUCL_MOUSE Nucleolin OS=Mus musculus GN=Ncl PE=1 SV=2 604 790 7.0E-08
sp|Q15717|ELAV1_HUMAN ELAV-like protein 1 OS=Homo sapiens GN=ELAVL1 PE=1 SV=2 692 841 7.0E-08
sp|A1CRM1|PABP_ASPCL Polyadenylate-binding protein, cytoplasmic and nuclear OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=pab1 PE=3 SV=1 613 789 7.0E-08
sp|A3LXL0|PABP_PICST Polyadenylate-binding protein, cytoplasmic and nuclear OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=PAB1 PE=3 SV=1 588 797 8.0E-08
sp|Q6CDH3|PABP_YARLI Polyadenylate-binding protein, cytoplasmic and nuclear OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=PAB1 PE=3 SV=1 613 808 8.0E-08
sp|O22173|PABP4_ARATH Polyadenylate-binding protein 4 OS=Arabidopsis thaliana GN=PAB4 PE=1 SV=1 306 725 9.0E-08
sp|A5DM21|PABP_PICGU Polyadenylate-binding protein, cytoplasmic and nuclear OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=PAB1 PE=3 SV=2 613 793 9.0E-08
sp|Q74ZS6|PABP_ASHGO Polyadenylate-binding protein, cytoplasmic and nuclear OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=PAB1 PE=3 SV=1 612 797 1.0E-07
sp|Q4P8R9|PABP_USTMA Polyadenylate-binding protein, cytoplasmic and nuclear OS=Ustilago maydis (strain 521 / FGSC 9021) GN=PAB1 PE=3 SV=1 612 793 1.0E-07
sp|P13383|NUCL_RAT Nucleolin OS=Rattus norvegicus GN=Ncl PE=1 SV=3 473 793 1.0E-07
sp|Q1PDV2|SRC28_ARATH Serine/arginine-rich SC35-like splicing factor SCL28 OS=Arabidopsis thaliana GN=SCL28 PE=1 SV=1 308 386 1.0E-07
sp|P15771|NUCL_CHICK Nucleolin OS=Gallus gallus GN=NCL PE=1 SV=1 286 378 1.0E-07
sp|Q24668|SXL_DROSU Protein sex-lethal OS=Drosophila subobscura GN=Sxl PE=2 SV=2 657 803 1.0E-07
sp|P38922|HRB1_YEAST Protein HRB1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HRB1 PE=1 SV=2 490 793 1.0E-07
sp|Q9Y4C8|RBM19_HUMAN Probable RNA-binding protein 19 OS=Homo sapiens GN=RBM19 PE=1 SV=3 4 77 2.0E-07
sp|Q5AI15|PABP_CANAL Polyadenylate-binding protein, cytoplasmic and nuclear OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PAB1 PE=3 SV=1 588 797 2.0E-07
sp|P15771|NUCL_CHICK Nucleolin OS=Gallus gallus GN=NCL PE=1 SV=1 483 793 2.0E-07
sp|P30352|SRSF2_CHICK Serine/arginine-rich splicing factor 2 OS=Gallus gallus GN=SRSF2 PE=2 SV=1 308 378 2.0E-07
sp|Q54BM2|PAP1A_DICDI Polyadenylate-binding protein 1-A OS=Dictyostelium discoideum GN=pabpc1A PE=1 SV=1 613 803 2.0E-07
sp|Q5R1W5|SRSF2_PANTR Serine/arginine-rich splicing factor 2 OS=Pan troglodytes GN=SRSF2 PE=2 SV=3 308 378 2.0E-07
sp|O59670|SF3B6_SCHPO Splicing factor 3B subunit 6-like protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC29A3.07c PE=3 SV=2 719 814 2.0E-07
sp|P20397|NUCL_XENLA Nucleolin OS=Xenopus laevis GN=ncl PE=2 SV=3 601 791 2.0E-07
sp|O09032|ELAV4_RAT ELAV-like protein 4 OS=Rattus norvegicus GN=Elavl4 PE=1 SV=1 716 828 2.0E-07
sp|Q61701|ELAV4_MOUSE ELAV-like protein 4 OS=Mus musculus GN=Elavl4 PE=1 SV=1 716 828 2.0E-07
sp|P25555|GBP2_YEAST Single-strand telomeric DNA-binding protein GBP2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GBP2 PE=1 SV=1 604 789 2.0E-07
sp|O97018|SXL_CHRRU Sex-lethal homolog OS=Chrysomya rufifacies GN=SXL PE=2 SV=2 588 796 2.0E-07
sp|P26378|ELAV4_HUMAN ELAV-like protein 4 OS=Homo sapiens GN=ELAVL4 PE=1 SV=2 716 828 2.0E-07
sp|P49314|ROC2_NICPL 31 kDa ribonucleoprotein, chloroplastic OS=Nicotiana plumbaginifolia PE=2 SV=1 614 793 2.0E-07
sp|P21187|PABP_DROME Polyadenylate-binding protein OS=Drosophila melanogaster GN=pAbp PE=1 SV=3 613 796 3.0E-07
sp|Q5U259|ELV1B_XENLA ELAV-like protein 1-B OS=Xenopus laevis GN=elavl1-b PE=1 SV=1 692 841 3.0E-07
sp|Q6DEY7|EPAB_XENTR Embryonic polyadenylate-binding protein OS=Xenopus tropicalis GN=epabp PE=2 SV=1 613 793 3.0E-07
sp|P19339|SXL_DROME Protein sex-lethal OS=Drosophila melanogaster GN=Sxl PE=1 SV=1 657 803 3.0E-07
sp|Q8R3C6|RBM19_MOUSE Probable RNA-binding protein 19 OS=Mus musculus GN=Rbm19 PE=1 SV=1 4 154 4.0E-07
sp|Q28GD4|ELAV2_XENTR ELAV-like protein 2 OS=Xenopus tropicalis GN=elavl2 PE=2 SV=2 716 828 4.0E-07
sp|Q98SP8|EPABA_XENLA Embryonic polyadenylate-binding protein A OS=Xenopus laevis GN=epabp-a PE=1 SV=2 613 805 4.0E-07
sp|Q5R9Z6|ELAV2_PONAB ELAV-like protein 2 OS=Pongo abelii GN=ELAVL2 PE=2 SV=1 716 828 4.0E-07
sp|Q12926|ELAV2_HUMAN ELAV-like protein 2 OS=Homo sapiens GN=ELAVL2 PE=1 SV=2 716 828 4.0E-07
sp|Q60899|ELAV2_MOUSE ELAV-like protein 2 OS=Mus musculus GN=Elavl2 PE=2 SV=1 716 828 4.0E-07
sp|Q9FNR1|RBG3_ARATH Glycine-rich RNA-binding protein 3, mitochondrial OS=Arabidopsis thaliana GN=RBG3 PE=2 SV=1 298 382 4.0E-07
sp|Q9FGS0|CP31B_ARATH RNA-binding protein CP31B, chloroplastic OS=Arabidopsis thaliana GN=CP31B PE=1 SV=1 614 793 5.0E-07
sp|Q06A98|SRSF2_PIG Serine/arginine-rich splicing factor 2 OS=Sus scrofa GN=SRSF2 PE=2 SV=1 308 378 6.0E-07
sp|Q44554|RBPB_NOSS1 Putative RNA-binding protein RbpB OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=rbpB PE=3 SV=3 308 378 6.0E-07
sp|Q6PDU1|SRSF2_RAT Serine/arginine-rich splicing factor 2 OS=Rattus norvegicus GN=Srsf2 PE=1 SV=3 308 378 6.0E-07
sp|Q62093|SRSF2_MOUSE Serine/arginine-rich splicing factor 2 OS=Mus musculus GN=Srsf2 PE=1 SV=4 308 378 6.0E-07
sp|Q01130|SRSF2_HUMAN Serine/arginine-rich splicing factor 2 OS=Homo sapiens GN=SRSF2 PE=1 SV=4 308 378 6.0E-07
sp|Q3MHR5|SRSF2_BOVIN Serine/arginine-rich splicing factor 2 OS=Bos taurus GN=SRSF2 PE=2 SV=3 308 378 6.0E-07
sp|F4HT49|PABP1_ARATH Polyadenylate-binding protein 1 OS=Arabidopsis thaliana GN=PAB1 PE=2 SV=2 613 808 6.0E-07
sp|Q8CGC6|RBM28_MOUSE RNA-binding protein 28 OS=Mus musculus GN=Rbm28 PE=1 SV=4 307 384 7.0E-07
sp|Q9NW13|RBM28_HUMAN RNA-binding protein 28 OS=Homo sapiens GN=RBM28 PE=1 SV=3 307 384 7.0E-07
sp|P15771|NUCL_CHICK Nucleolin OS=Gallus gallus GN=NCL PE=1 SV=1 308 688 8.0E-07
sp|Q9WX37|RBPE_NOSS1 Putative RNA-binding protein RbpE OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=rbpE PE=3 SV=3 308 388 8.0E-07
sp|Q6BI95|PABP_DEBHA Polyadenylate-binding protein, cytoplasmic and nuclear OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=PAB1 PE=3 SV=2 588 797 9.0E-07
sp|Q9ZUU4|CP29B_ARATH RNA-binding protein CP29B, chloroplastic OS=Arabidopsis thaliana GN=CP29B PE=1 SV=1 606 794 9.0E-07
sp|O17310|SXL_MUSDO Sex-lethal homolog OS=Musca domestica GN=SXL PE=2 SV=1 612 796 9.0E-07
sp|Q05196|PABP5_ARATH Polyadenylate-binding protein 5 OS=Arabidopsis thaliana GN=PAB5 PE=1 SV=3 612 793 1.0E-06
sp|Q9ZQA8|PABP7_ARATH Polyadenylate-binding protein 7 OS=Arabidopsis thaliana GN=PAB7 PE=2 SV=1 302 417 1.0E-06
sp|F4HT49|PABP1_ARATH Polyadenylate-binding protein 1 OS=Arabidopsis thaliana GN=PAB1 PE=2 SV=2 612 795 1.0E-06
sp|Q9SVV9|AML3_ARATH Protein MEI2-like 3 OS=Arabidopsis thaliana GN=ML3 PE=2 SV=2 608 792 1.0E-06
sp|Q08937|ROC2_NICSY 29 kDa ribonucleoprotein B, chloroplastic OS=Nicotiana sylvestris PE=2 SV=1 614 793 1.0E-06
sp|Q6GR16|EPABB_XENLA Embryonic polyadenylate-binding protein B OS=Xenopus laevis GN=epabp-b PE=2 SV=1 613 793 1.0E-06
sp|Q6FKG4|PABP_CANGA Polyadenylate-binding protein, cytoplasmic and nuclear OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=PAB1 PE=3 SV=1 588 797 2.0E-06
sp|P19338|NUCL_HUMAN Nucleolin OS=Homo sapiens GN=NCL PE=1 SV=3 604 790 2.0E-06
sp|Q5RF26|NUCL_PONAB Nucleolin OS=Pongo abelii GN=NCL PE=2 SV=3 604 790 2.0E-06
sp|Q4R4J7|NUCL_MACFA Nucleolin OS=Macaca fascicularis GN=NCL PE=2 SV=3 604 790 2.0E-06
sp|P20397|NUCL_XENLA Nucleolin OS=Xenopus laevis GN=ncl PE=2 SV=3 483 793 2.0E-06
sp|Q99020|ROAA_MOUSE Heterogeneous nuclear ribonucleoprotein A/B OS=Mus musculus GN=Hnrnpab PE=1 SV=1 595 797 2.0E-06
sp|P92964|SRS31_ARATH Serine/arginine-rich splicing factor RS31 OS=Arabidopsis thaliana GN=RS31 PE=1 SV=2 614 792 2.0E-06
sp|Q9FMP4|SF3B6_ARATH Splicing factor 3B subunit 6-like protein OS=Arabidopsis thaliana GN=At5g12190 PE=2 SV=1 719 811 2.0E-06
sp|P41891|GAR2_SCHPO Protein gar2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gar2 PE=1 SV=2 611 792 2.0E-06
sp|Q57014|RBPA_SYNY3 Putative RNA-binding protein RbpA OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=rbpA PE=3 SV=3 308 378 2.0E-06
sp|Q6GLB5|ELAV1_XENTR ELAV-like protein 1 OS=Xenopus tropicalis GN=elavl1 PE=2 SV=1 692 841 2.0E-06
sp|Q91584|ELAV3_XENLA ELAV-like protein 3 OS=Xenopus laevis GN=elavl3 PE=2 SV=1 716 828 2.0E-06
sp|Q28FX0|ELAV3_XENTR ELAV-like protein 3 OS=Xenopus tropicalis GN=elavl3 PE=2 SV=1 716 828 2.0E-06
sp|Q8ITY4|SF3B6_CAEEL Splicing factor 3B subunit 6-like protein OS=Caenorhabditis elegans GN=C50D2.5 PE=3 SV=2 705 816 2.0E-06
sp|P42731|PABP2_ARATH Polyadenylate-binding protein 2 OS=Arabidopsis thaliana GN=PAB2 PE=1 SV=1 280 719 3.0E-06
sp|Q6IP09|PABPB_XENLA Polyadenylate-binding protein 1-B OS=Xenopus laevis GN=pabpc1-b PE=2 SV=1 612 793 3.0E-06
sp|Q9FXA2|PABP8_ARATH Polyadenylate-binding protein 8 OS=Arabidopsis thaliana GN=PAB8 PE=1 SV=1 609 789 3.0E-06
sp|Q91903|ELAV2_XENLA ELAV-like protein 2 OS=Xenopus laevis GN=elavl2 PE=1 SV=2 716 828 3.0E-06
sp|Q8CH84|ELAV2_RAT ELAV-like protein 2 OS=Rattus norvegicus GN=Elavl2 PE=1 SV=1 716 828 3.0E-06
sp|Q9EPH8|PABP1_RAT Polyadenylate-binding protein 1 OS=Rattus norvegicus GN=Pabpc1 PE=1 SV=1 612 793 4.0E-06
sp|Q9FXA2|PABP8_ARATH Polyadenylate-binding protein 8 OS=Arabidopsis thaliana GN=PAB8 PE=1 SV=1 305 725 4.0E-06
sp|P19683|ROC4_NICSY 31 kDa ribonucleoprotein, chloroplastic OS=Nicotiana sylvestris PE=1 SV=1 614 793 4.0E-06
sp|P29341|PABP1_MOUSE Polyadenylate-binding protein 1 OS=Mus musculus GN=Pabpc1 PE=1 SV=2 612 793 5.0E-06
sp|Q15415|RBY1F_HUMAN RNA-binding motif protein, Y chromosome, family 1 member F/J OS=Homo sapiens GN=RBMY1F PE=1 SV=2 307 378 5.0E-06
sp|Q9ZQA8|PABP7_ARATH Polyadenylate-binding protein 7 OS=Arabidopsis thaliana GN=PAB7 PE=2 SV=1 610 789 6.0E-06
sp|Q9FXA2|PABP8_ARATH Polyadenylate-binding protein 8 OS=Arabidopsis thaliana GN=PAB8 PE=1 SV=1 612 793 7.0E-06
sp|P20965|PABPA_XENLA Polyadenylate-binding protein 1-A OS=Xenopus laevis GN=pabpc1-a PE=1 SV=3 612 793 8.0E-06
sp|P21187|PABP_DROME Polyadenylate-binding protein OS=Drosophila melanogaster GN=pAbp PE=1 SV=3 581 793 8.0E-06
sp|P19682|ROC3_NICSY 28 kDa ribonucleoprotein, chloroplastic OS=Nicotiana sylvestris PE=1 SV=1 614 793 8.0E-06
sp|Q9VRV7|SF3B6_DROME Splicing factor 3B subunit 6-like protein OS=Drosophila melanogaster GN=CG13298 PE=1 SV=1 719 810 9.0E-06
sp|Q7ZT82|RFX1L_DANRE RNA binding protein fox-1 homolog 1-like OS=Danio rerio GN=rbfox1l PE=1 SV=1 714 817 9.0E-06
sp|P82277|RRP2_SPIOL 30S ribosomal protein 2, chloroplastic OS=Spinacia oleracea GN=PSRP2 PE=1 SV=1 486 690 9.0E-06
sp|Q9WX39|RBPF_NOSS1 Putative RNA-binding protein RbpF OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=rbpF PE=3 SV=3 308 385 9.0E-06
sp|P0CR16|MRD1_CRYNJ Multiple RNA-binding domain-containing protein 1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=MRD1 PE=3 SV=1 4 158 1.0E-05
sp|P0CR17|MRD1_CRYNB Multiple RNA-binding domain-containing protein 1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=MRD1 PE=3 SV=1 4 158 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0003723 RNA binding Yes
GO:0003674 molecular_function No
GO:0005488 binding No
GO:1901363 heterocyclic compound binding No
GO:0097159 organic cyclic compound binding No
GO:0003676 nucleic acid binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 19 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|4405
MATSRIFVKGLPPNMTETEFRSHFSANNRHITDVKLIPQRRIGYIGYKSSEDASSAVKYFNRSYIRMSKILVEPA
RPISDLSLQNSSRSASCSVNNNKAQAIGDKGEVSKKRKREEPDKADSKLHEFLRVMKPGRQGAIADDTGLCDLGE
AETRENVVPVDDSDDDYHDMPTRPDKSRRIEQKGNDQRGEDAKLQGREAEAPNAASVVARDTSEDTEPVASQATE
PKITATDDDWLRSRTSRLLDLVDADELVDKTIPKPSSESAIACKEEVLHSSAEMTSHVAGTATGSQEFSEDGAVE
AISKTCRLFVRNLAYDVSEENLREAFEKHGELQEVHLPANAMGSGKGFALVLFVNAADAVKAFQAMDGTTFQGRI
LHIIPADAKKQGGLDEIGISKLSLRKQNLIRKRADAASTSFNWNSLWMSQDAVNSSVASRLGISKSELLDPTSAE
AGIKQAIAETTVIQETKAYFTANGVDLEAFKSKKRGDRCILVKNFPYGTSMDELRRMFEEFGAVVRVLMPPSGTI
AIVQFAQANDAKRAFSRLAYRRIKDSLLFLEKGPQDLLRGDDRADALSLEGDRRQKVTGVKKLSVSELLSGRHGA
EANDAESDEATTSLFVRNLNFATTASRLAEAFGTLDGFVSAQVKTKMDAKKPGQRLSMGFGFVEFASKAQSQKAA
KSMEGYVLDGHALGVRMSHGGRDAGEERRREDRAQKLAARRTKLIIKNLPFQATKGDVRTLFGSYGQLRSVRVPK
KVDNSTRGFAFADFVSAKEAEKALEALGDTHLLGRRLVVEYAEAEAVDAEAEIDKMQRKVGGQVNKVALEQLTGA
RGRAKVNIGNDEERED*
Coding >OphauB2|4405
ATGGCGACGTCCAGAATTTTTGTCAAGGGGCTCCCCCCGAATATGACAGAAACCGAGTTTCGAAGCCACTTCTCT
GCTAATAATCGACACATCACGGACGTCAAATTGATACCACAGCGACGCATTGGCTACATTGGCTACAAGAGCTCA
GAGGACGCCTCGAGCGCTGTCAAATACTTCAACAGATCATACATTCGAATGTCAAAAATATTGGTAGAGCCAGCG
AGACCTATCTCAGACCTTAGCCTGCAGAATAGCTCTAGATCTGCGAGCTGCTCAGTGAATAACAACAAGGCACAA
GCTATTGGAGATAAGGGAGAAGTGTCAAAAAAACGGAAGCGAGAAGAGCCCGACAAGGCCGATTCAAAACTGCAC
GAATTCCTCCGAGTCATGAAACCAGGAAGACAAGGCGCCATTGCAGACGATACAGGTCTCTGCGACCTCGGAGAG
GCCGAGACTCGCGAAAATGTGGTGCCCGTGGATGACAGCGATGACGACTACCATGACATGCCCACAAGGCCTGAC
AAGTCACGCAGGATAGAACAAAAAGGGAACGATCAACGAGGTGAGGATGCGAAACTCCAAGGAAGGGAGGCTGAA
GCGCCAAACGCCGCTTCAGTTGTGGCTAGAGACACGTCAGAAGATACTGAACCAGTGGCGAGCCAAGCCACAGAG
CCAAAGATTACGGCTACTGACGATGACTGGCTGCGTTCGAGGACGAGCCGGCTGCTGGATCTCGTTGATGCTGAC
GAGCTTGTTGACAAAACAATACCAAAGCCTAGCAGCGAATCAGCTATTGCATGCAAAGAAGAAGTGCTACATTCC
TCAGCCGAAATGACATCTCATGTGGCGGGAACAGCTACGGGGTCGCAGGAATTTTCAGAAGATGGCGCGGTCGAG
GCCATCTCGAAGACATGTCGACTCTTTGTGCGCAATTTGGCATACGACGTTAGCGAGGAAAACTTGCGGGAAGCC
TTTGAAAAACATGGAGAGTTGCAAGAGGTTCATTTGCCCGCCAACGCTATGGGATCGGGCAAGGGGTTCGCCCTC
GTGTTGTTTGTCAATGCGGCAGACGCGGTGAAGGCATTCCAGGCAATGGATGGCACGACGTTCCAGGGGCGCATT
CTTCACATCATTCCAGCCGACGCCAAAAAACAGGGGGGATTGGACGAGATTGGAATTTCCAAGCTGTCGCTGAGG
AAACAAAATTTGATTCGCAAGAGGGCCGACGCGGCGTCTACAAGCTTCAACTGGAATTCACTTTGGATGAGCCAG
GACGCGGTCAACTCGTCAGTGGCCAGCCGACTTGGGATTTCCAAGTCGGAGCTGCTCGATCCTACCTCGGCGGAA
GCCGGCATCAAGCAAGCCATAGCGGAGACAACAGTGATCCAGGAGACAAAGGCATATTTCACAGCCAACGGGGTG
GATCTGGAAGCCTTCAAGTCAAAGAAGCGGGGCGACAGATGCATCCTGGTAAAAAACTTCCCGTATGGTACAAGC
ATGGACGAACTCAGAAGAATGTTCGAAGAGTTTGGCGCTGTGGTCAGGGTACTCATGCCTCCAAGCGGGACGATT
GCGATTGTACAGTTCGCACAGGCCAACGACGCAAAGAGGGCATTTAGTCGGCTTGCTTACCGACGGATCAAGGAT
AGTCTCCTTTTCCTAGAGAAGGGGCCTCAGGATCTGTTGAGAGGCGACGATCGCGCAGATGCGCTCAGCCTTGAG
GGTGATCGGCGGCAAAAAGTGACCGGGGTCAAGAAGCTAAGCGTCAGTGAGCTGCTCTCGGGGCGTCATGGGGCA
GAAGCAAATGATGCAGAGAGTGATGAGGCAACAACATCGCTGTTTGTCCGCAATTTAAACTTTGCCACAACCGCT
AGCAGATTGGCAGAAGCTTTCGGGACGCTTGACGGATTCGTCTCAGCCCAGGTCAAGACCAAGATGGACGCTAAA
AAGCCGGGCCAGAGACTGAGCATGGGGTTTGGCTTCGTCGAGTTTGCAAGCAAGGCGCAGTCACAAAAGGCAGCC
AAGAGCATGGAGGGCTACGTGCTAGATGGGCATGCGCTGGGAGTGCGAATGTCACATGGTGGGCGCGATGCGGGT
GAGGAGCGACGCCGAGAGGACAGAGCCCAAAAGTTGGCGGCGCGGCGGACCAAGCTTATCATCAAGAACTTGCCC
TTCCAGGCGACTAAAGGTGATGTGAGGACGCTATTTGGCAGCTATGGGCAGCTAAGGAGTGTGCGTGTACCGAAA
AAGGTGGACAACTCTACGCGGGGCTTTGCATTTGCAGACTTTGTGAGTGCTAAGGAGGCGGAGAAGGCACTAGAG
GCTCTGGGCGACACCCACTTGCTGGGGCGGCGGCTTGTGGTAGAGTATGCGGAAGCTGAGGCAGTGGATGCCGAG
GCAGAGATTGACAAGATGCAACGCAAAGTAGGGGGCCAAGTCAATAAAGTAGCCCTTGAGCAGCTGACGGGGGCC
AGAGGGAGGGCAAAGGTGAATATTGGCAATGATGAGGAGCGCGAGGATTGA
Transcript >OphauB2|4405
ATGGCGACGTCCAGAATTTTTGTCAAGGGGCTCCCCCCGAATATGACAGAAACCGAGTTTCGAAGCCACTTCTCT
GCTAATAATCGACACATCACGGACGTCAAATTGATACCACAGCGACGCATTGGCTACATTGGCTACAAGAGCTCA
GAGGACGCCTCGAGCGCTGTCAAATACTTCAACAGATCATACATTCGAATGTCAAAAATATTGGTAGAGCCAGCG
AGACCTATCTCAGACCTTAGCCTGCAGAATAGCTCTAGATCTGCGAGCTGCTCAGTGAATAACAACAAGGCACAA
GCTATTGGAGATAAGGGAGAAGTGTCAAAAAAACGGAAGCGAGAAGAGCCCGACAAGGCCGATTCAAAACTGCAC
GAATTCCTCCGAGTCATGAAACCAGGAAGACAAGGCGCCATTGCAGACGATACAGGTCTCTGCGACCTCGGAGAG
GCCGAGACTCGCGAAAATGTGGTGCCCGTGGATGACAGCGATGACGACTACCATGACATGCCCACAAGGCCTGAC
AAGTCACGCAGGATAGAACAAAAAGGGAACGATCAACGAGGTGAGGATGCGAAACTCCAAGGAAGGGAGGCTGAA
GCGCCAAACGCCGCTTCAGTTGTGGCTAGAGACACGTCAGAAGATACTGAACCAGTGGCGAGCCAAGCCACAGAG
CCAAAGATTACGGCTACTGACGATGACTGGCTGCGTTCGAGGACGAGCCGGCTGCTGGATCTCGTTGATGCTGAC
GAGCTTGTTGACAAAACAATACCAAAGCCTAGCAGCGAATCAGCTATTGCATGCAAAGAAGAAGTGCTACATTCC
TCAGCCGAAATGACATCTCATGTGGCGGGAACAGCTACGGGGTCGCAGGAATTTTCAGAAGATGGCGCGGTCGAG
GCCATCTCGAAGACATGTCGACTCTTTGTGCGCAATTTGGCATACGACGTTAGCGAGGAAAACTTGCGGGAAGCC
TTTGAAAAACATGGAGAGTTGCAAGAGGTTCATTTGCCCGCCAACGCTATGGGATCGGGCAAGGGGTTCGCCCTC
GTGTTGTTTGTCAATGCGGCAGACGCGGTGAAGGCATTCCAGGCAATGGATGGCACGACGTTCCAGGGGCGCATT
CTTCACATCATTCCAGCCGACGCCAAAAAACAGGGGGGATTGGACGAGATTGGAATTTCCAAGCTGTCGCTGAGG
AAACAAAATTTGATTCGCAAGAGGGCCGACGCGGCGTCTACAAGCTTCAACTGGAATTCACTTTGGATGAGCCAG
GACGCGGTCAACTCGTCAGTGGCCAGCCGACTTGGGATTTCCAAGTCGGAGCTGCTCGATCCTACCTCGGCGGAA
GCCGGCATCAAGCAAGCCATAGCGGAGACAACAGTGATCCAGGAGACAAAGGCATATTTCACAGCCAACGGGGTG
GATCTGGAAGCCTTCAAGTCAAAGAAGCGGGGCGACAGATGCATCCTGGTAAAAAACTTCCCGTATGGTACAAGC
ATGGACGAACTCAGAAGAATGTTCGAAGAGTTTGGCGCTGTGGTCAGGGTACTCATGCCTCCAAGCGGGACGATT
GCGATTGTACAGTTCGCACAGGCCAACGACGCAAAGAGGGCATTTAGTCGGCTTGCTTACCGACGGATCAAGGAT
AGTCTCCTTTTCCTAGAGAAGGGGCCTCAGGATCTGTTGAGAGGCGACGATCGCGCAGATGCGCTCAGCCTTGAG
GGTGATCGGCGGCAAAAAGTGACCGGGGTCAAGAAGCTAAGCGTCAGTGAGCTGCTCTCGGGGCGTCATGGGGCA
GAAGCAAATGATGCAGAGAGTGATGAGGCAACAACATCGCTGTTTGTCCGCAATTTAAACTTTGCCACAACCGCT
AGCAGATTGGCAGAAGCTTTCGGGACGCTTGACGGATTCGTCTCAGCCCAGGTCAAGACCAAGATGGACGCTAAA
AAGCCGGGCCAGAGACTGAGCATGGGGTTTGGCTTCGTCGAGTTTGCAAGCAAGGCGCAGTCACAAAAGGCAGCC
AAGAGCATGGAGGGCTACGTGCTAGATGGGCATGCGCTGGGAGTGCGAATGTCACATGGTGGGCGCGATGCGGGT
GAGGAGCGACGCCGAGAGGACAGAGCCCAAAAGTTGGCGGCGCGGCGGACCAAGCTTATCATCAAGAACTTGCCC
TTCCAGGCGACTAAAGGTGATGTGAGGACGCTATTTGGCAGCTATGGGCAGCTAAGGAGTGTGCGTGTACCGAAA
AAGGTGGACAACTCTACGCGGGGCTTTGCATTTGCAGACTTTGTGAGTGCTAAGGAGGCGGAGAAGGCACTAGAG
GCTCTGGGCGACACCCACTTGCTGGGGCGGCGGCTTGTGGTAGAGTATGCGGAAGCTGAGGCAGTGGATGCCGAG
GCAGAGATTGACAAGATGCAACGCAAAGTAGGGGGCCAAGTCAATAAAGTAGCCCTTGAGCAGCTGACGGGGGCC
AGAGGGAGGGCAAAGGTGAATATTGGCAATGATGAGGAGCGCGAGGATTGA
Gene >OphauB2|4405
ATGGCGACGTCCAGAATTTTTGTCAAGGGGCTCCCCCCGAATATGACAGAAACCGAGTTTCGAAGCCACTTCTCT
GCTAATAATCGACACATCACGGACGTCAAATTGATACCACAGCGACGCATTGGCTACATTGGCTACAAGAGCTCA
GAGGACGCCTCGAGCGCTGTCAAATACTTCAACAGATCATACATTCGAATGTCAAAAATATTGGTAGAGCCAGCG
AGACCTGTATGATCAAACATGGCCCGCTCTAGCCTCCATTCTGGTACTGATGGAATGCTAGATCTCAGACCTTAG
CCTGCAGAATAGCTCTAGATCTGCGAGCTGCTCAGTGAATAACAACAAGGCACAAGCTATTGGAGATAAGGGAGA
AGTGTCAAAAAAACGGAAGCGAGAAGAGCCCGACAAGGCCGATTCAAAACTGCACGAATTCCTCCGAGTCATGAA
ACCAGGAAGACAAGGCGCCATTGCAGACGATACAGGTCTCTGCGACCTCGGAGAGGCCGAGACTCGCGAAAATGT
GGTGCCCGTGGATGACAGCGATGACGACTACCATGACATGCCCACAAGGCCTGACAAGTCACGCAGGATAGAACA
AAAAGGGAACGATCAACGAGGTGAGGATGCGAAACTCCAAGGAAGGGAGGCTGAAGCGCCAAACGCCGCTTCAGT
TGTGGCTAGAGACACGTCAGAAGATACTGAACCAGTGGCGAGCCAAGCCACAGAGCCAAAGATTACGGCTACTGA
CGATGACTGGCTGCGTTCGAGGACGAGCCGGCTGCTGGATCTCGTTGATGCTGACGAGCTTGTTGACAAAACAAT
ACCAAAGCCTAGCAGCGAATCAGCTATTGCATGCAAAGAAGAAGTGCTACATTCCTCAGCCGAAATGACATCTCA
TGTGGCGGGAACAGCTACGGGGTCGCAGGAATTTTCAGAAGATGGCGCGGTCGAGGCCATCTCGAAGACATGTCG
ACTCTTTGTGCGCAATTTGGCATACGACGTTAGCGAGGAAAACTTGCGGGAAGCCTTTGAAAAACATGGAGAGTT
GCAAGAGGTACGTAAAGATATGCGTGAAAACAGTGGCGAAAGGTACCAAAAGGCTGCAATGATGAAGCCCATGAT
AGGGACAGCTTATACCATTGAGTATATGATGTAAACCTGGGCGAATATTTTAGTAGATGCTTCGATTTCTGACTG
GCCGGTCTAACATTGACACAAAGACGGATGGTGCGACGATGAAAAATCAGAAGCTGACTTGGCACCTTGCATCAG
GTTCATTTGCCCGCCAACGCTATGGGATCGGGCAAGGGGTTCGCCCTCGTGTTGTTTGTCAATGCGGCAGACGCG
GTGAAGGCATTCCAGGCAATGGATGGCACGACGTTCCAGGGGCGCATTCTTCACATCATTCCAGCCGACGCCAAA
AAACAGGGGGGATTGGACGAGATTGGAATTTCCAAGCTGTCGCTGAGGAAACAAAATTTGATTCGCAAGAGGGCC
GACGCGGCGTCTACAAGCTTCAACTGGAATTCACTTTGGATGAGCCAGGACGCGGTCAACTCGTCAGTGGCCAGC
CGACTTGGGATTTCCAAGTCGGAGCTGCTCGATCCTACCTCGGCGGAAGCCGGCATCAAGCAAGCCATAGCGGAG
ACAACAGTGATCCAGGAGACAAAGGCATATTTCACAGCCAACGGGGTGGATCTGGAAGCCTTCAAGTCAAAGAAG
CGGGGCGACAGATGCATCCTGGTAAAAAACTTCCCGTATGGTACAAGCATGGACGAACTCAGAAGAATGTTCGAA
GAGTTTGGCGCTGTGGTCAGGGTACTCATGCCTCCAAGCGGGACGATTGCGATTGTACAGTTCGCACAGGCCAAC
GACGCAAAGAGGGCATTTAGTCGGCTTGCTTACCGACGGATCAAGGATAGTCTCCTTTTCCTAGAGAAGGGGCCT
CAGGATCTGTTGAGAGGCGACGATCGCGCAGATGCGCTCAGCCTTGAGGGTGATCGGCGGCAAAAAGTGACCGGG
GTCAAGAAGCTAAGCGTCAGTGAGCTGCTCTCGGGGCGTCATGGGGCAGAAGCAAATGATGCAGAGAGTGATGAG
GCAACAACATCGCTGTTTGTCCGCAATTTAAACTTTGCCACAACCGCTAGCAGATTGGCAGAAGCTTTCGGGACG
CTTGACGGATTCGTCTCAGCCCAGGTCAAGACCAAGATGGACGCTAAAAAGCCGGGCCAGAGACTGAGCATGGGG
TTTGGCTTCGTCGAGTTTGCAAGCAAGGCGCAGTCACAAAAGGCAGCCAAGAGCATGGAGGGCTACGTGCTAGAT
GGGCATGCGCTGGGAGTGCGAATGTCACATGGTGGGCGCGATGCGGGTGAGGAGCGACGCCGAGAGGACAGAGCC
CAAAAGTTGGCGGCGCGGCGGACCAAGCTTATCATCAAGAACTTGCCCTTCCAGGCGACTAAAGGTGATGTGAGG
ACGCTATTTGGCAGCTATGGGCAGCTAAGGAGTGTGCGTGTACCGAAAAAGGTGGACAACTCTACGCGGGGCTTT
GCATTTGCAGACTTTGTGAGTGCTAAGGAGGCGGAGAAGGCACTAGAGGCTCTGGGCGACACCCACTTGCTGGGG
CGGCGGCTTGTGGTAGAGTATGCGGAAGCTGAGGCAGTGGATGCCGAGGCAGAGATTGACAAGATGCAACGCAAA
GTAGGGGGCCAAGTCAATAAAGTAGCCCTTGAGCAGCTGACGGGGGCCAGAGGGAGGGCAAAGGTGAATATTGGC
AATGATGAGGAGCGCGAGGATTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail