Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|4395
Gene name
LocationContig_3:45169..47060
Strand+
Gene length (bp)1891
Transcript length (bp)1752
Coding sequence length (bp)1752
Protein length (aa) 584

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00152 tRNA-synt_2 tRNA synthetases class II (D, K and N) 1.4E-52 163 459
PF00152 tRNA-synt_2 tRNA synthetases class II (D, K and N) 6.4E-09 499 546
PF01336 tRNA_anti-codon OB-fold nucleic acid binding domain 6.8E-10 63 145

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O74858|SYKM_SCHPO Lysine--tRNA ligase, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=msk1 PE=3 SV=1 34 550 3.0E-102
sp|Q22099|SYK_CAEEL Lysine--tRNA ligase OS=Caenorhabditis elegans GN=krs-1 PE=3 SV=1 45 548 5.0E-83
sp|Q99MN1|SYK_MOUSE Lysine--tRNA ligase OS=Mus musculus GN=Kars PE=1 SV=1 10 548 3.0E-78
sp|Q15046|SYK_HUMAN Lysine--tRNA ligase OS=Homo sapiens GN=KARS PE=1 SV=3 32 548 7.0E-78
sp|P37879|SYK_CRIGR Lysine--tRNA ligase OS=Cricetulus griseus GN=KARS PE=1 SV=1 32 548 5.0E-77
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O74858|SYKM_SCHPO Lysine--tRNA ligase, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=msk1 PE=3 SV=1 34 550 3.0E-102
sp|Q22099|SYK_CAEEL Lysine--tRNA ligase OS=Caenorhabditis elegans GN=krs-1 PE=3 SV=1 45 548 5.0E-83
sp|Q99MN1|SYK_MOUSE Lysine--tRNA ligase OS=Mus musculus GN=Kars PE=1 SV=1 10 548 3.0E-78
sp|Q15046|SYK_HUMAN Lysine--tRNA ligase OS=Homo sapiens GN=KARS PE=1 SV=3 32 548 7.0E-78
sp|P37879|SYK_CRIGR Lysine--tRNA ligase OS=Cricetulus griseus GN=KARS PE=1 SV=1 32 548 5.0E-77
sp|Q6F2U9|SYK_ORYSJ Lysine--tRNA ligase OS=Oryza sativa subsp. japonica GN=Os03g0586800 PE=2 SV=1 33 548 3.0E-76
sp|Q9ZPI1|SYKC_ARATH Lysine--tRNA ligase, cytoplasmic OS=Arabidopsis thaliana GN=At3g11710 PE=1 SV=1 33 548 3.0E-76
sp|Q43776|SYK_SOLLC Lysine--tRNA ligase OS=Solanum lycopersicum GN=LYSRS PE=2 SV=1 45 548 8.0E-76
sp|P15180|SYKC_YEAST Lysine--tRNA ligase, cytoplasmic OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KRS1 PE=1 SV=2 23 548 4.0E-75
sp|A9CS74|SYKC_ENTBH Probable lysine--tRNA ligase, cytoplasmic OS=Enterocytozoon bieneusi (strain H348) GN=EBI_25548 PE=3 SV=1 63 548 1.0E-74
sp|Q5N1D9|SYK_SYNP6 Lysine--tRNA ligase OS=Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1) GN=lysS PE=3 SV=1 55 548 1.0E-74
sp|Q31KH4|SYK_SYNE7 Lysine--tRNA ligase OS=Synechococcus elongatus (strain PCC 7942) GN=lysS PE=3 SV=1 55 548 1.0E-74
sp|A3CY14|SYK_METMJ Lysine--tRNA ligase OS=Methanoculleus marisnigri (strain ATCC 35101 / DSM 1498 / JR1) GN=lysS PE=3 SV=1 41 551 2.0E-72
sp|Q8SS56|SYKC_ENCCU Probable lysine--tRNA ligase, cytoplasmic OS=Encephalitozoon cuniculi (strain GB-M1) GN=ECU04_0580 PE=3 SV=2 45 548 5.0E-72
sp|Q839A8|SYK_ENTFA Lysine--tRNA ligase OS=Enterococcus faecalis (strain ATCC 700802 / V583) GN=lysS PE=3 SV=1 41 548 1.0E-71
sp|C4V8R9|SYKC_NOSCE Probable lysine--tRNA ligase, cytoplasmic OS=Nosema ceranae (strain BRL01) GN=NCER_100909 PE=3 SV=1 63 548 1.0E-70
sp|Q8PVP6|SYK2_METMA Lysine--tRNA ligase 2 OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=lysS2 PE=3 SV=1 33 548 2.0E-70
sp|B0KCE4|SYK_THEP3 Lysine--tRNA ligase OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) GN=lysS PE=3 SV=1 62 548 4.0E-70
sp|Q9UUE6|SYKC_SCHPO Lysine--tRNA ligase, cytoplasmic OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=krs1 PE=3 SV=1 45 554 9.0E-70
sp|B0K5C0|SYK_THEPX Lysine--tRNA ligase OS=Thermoanaerobacter sp. (strain X514) GN=lysS PE=3 SV=1 32 548 2.0E-69
sp|Q8R7N1|SYK_CALS4 Lysine--tRNA ligase OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=lysS PE=3 SV=1 63 548 2.0E-69
sp|Q6KIP6|SYK_MYCMO Lysine--tRNA ligase OS=Mycoplasma mobile (strain ATCC 43663 / 163K / NCTC 11711) GN=lysS PE=3 SV=1 116 549 5.0E-69
sp|O67258|SYK_AQUAE Lysine--tRNA ligase OS=Aquifex aeolicus (strain VF5) GN=lysS PE=3 SV=1 63 547 9.0E-69
sp|Q7UZP0|SYK_PROMP Lysine--tRNA ligase OS=Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / MED4) GN=lysS PE=3 SV=1 63 548 6.0E-68
sp|P32048|SYKM_YEAST Lysine--tRNA ligase, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MSK1 PE=1 SV=3 62 550 6.0E-68
sp|Q899G7|SYK_CLOTE Lysine--tRNA ligase OS=Clostridium tetani (strain Massachusetts / E88) GN=lysS PE=3 SV=1 63 548 6.0E-68
sp|Q4A5F3|SYK_MYCS5 Lysine--tRNA ligase OS=Mycoplasma synoviae (strain 53) GN=lysS PE=3 SV=2 65 549 7.0E-68
sp|Q8DMA9|SYK_THEEB Lysine--tRNA ligase OS=Thermosynechococcus elongatus (strain BP-1) GN=lysS PE=3 SV=1 43 548 1.0E-67
sp|A4SJK0|SYK_AERS4 Lysine--tRNA ligase OS=Aeromonas salmonicida (strain A449) GN=lysS PE=3 SV=1 54 548 1.0E-67
sp|Q3ZWX9|SYK_DEHMC Lysine--tRNA ligase OS=Dehalococcoides mccartyi (strain CBDB1) GN=lysS PE=3 SV=1 50 549 1.0E-67
sp|A7NFC6|SYK_ROSCS Lysine--tRNA ligase OS=Roseiflexus castenholzii (strain DSM 13941 / HLO8) GN=lysS PE=3 SV=1 32 548 1.0E-67
sp|A7HM68|SYK_FERNB Lysine--tRNA ligase OS=Fervidobacterium nodosum (strain ATCC 35602 / DSM 5306 / Rt17-B1) GN=lysS PE=3 SV=1 33 548 2.0E-67
sp|A1AWN8|SYK_RUTMC Lysine--tRNA ligase OS=Ruthia magnifica subsp. Calyptogena magnifica GN=lysS PE=3 SV=1 42 552 3.0E-67
sp|Q7U3A4|SYK_PROMM Lysine--tRNA ligase OS=Prochlorococcus marinus (strain MIT 9313) GN=lysS PE=3 SV=1 50 548 4.0E-67
sp|Q3A9M2|SYK_CARHZ Lysine--tRNA ligase OS=Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901) GN=lysS PE=3 SV=1 48 548 5.0E-67
sp|A2BZ03|SYK_PROM5 Lysine--tRNA ligase OS=Prochlorococcus marinus (strain MIT 9515) GN=lysS PE=3 SV=1 63 548 5.0E-67
sp|B3PNH7|SYK_MYCA5 Lysine--tRNA ligase OS=Mycoplasma arthritidis (strain 158L3-1) GN=lysS PE=3 SV=1 69 550 8.0E-67
sp|A5FRN5|SYK_DEHMB Lysine--tRNA ligase OS=Dehalococcoides mccartyi (strain ATCC BAA-2100 / JCM 16839 / KCTC 5957 / BAV1) GN=lysS PE=3 SV=1 50 549 9.0E-67
sp|Q0B0N3|SYK_SYNWW Lysine--tRNA ligase OS=Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen) GN=lysS PE=3 SV=1 32 548 2.0E-66
sp|Q6LUN2|SYK_PHOPR Lysine--tRNA ligase OS=Photobacterium profundum GN=lysS PE=3 SV=1 61 548 4.0E-66
sp|A3PFA8|SYK_PROM0 Lysine--tRNA ligase OS=Prochlorococcus marinus (strain MIT 9301) GN=lysS PE=3 SV=1 24 548 4.0E-66
sp|C4LCP0|SYK_TOLAT Lysine--tRNA ligase OS=Tolumonas auensis (strain DSM 9187 / TA4) GN=lysS PE=3 SV=1 49 548 9.0E-66
sp|B7ID87|SYK_THEAB Lysine--tRNA ligase OS=Thermosipho africanus (strain TCF52B) GN=lysS PE=3 SV=1 63 550 1.0E-65
sp|A6L8C6|SYK_PARD8 Lysine--tRNA ligase OS=Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / NCTC 11152) GN=lysS PE=3 SV=1 8 548 1.0E-65
sp|Q7U9X5|SYK_SYNPX Lysine--tRNA ligase OS=Synechococcus sp. (strain WH8102) GN=lysS PE=3 SV=1 60 561 2.0E-65
sp|B2GA78|SYK_LACF3 Lysine--tRNA ligase OS=Lactobacillus fermentum (strain NBRC 3956 / LMG 18251) GN=lysS PE=3 SV=1 57 548 3.0E-65
sp|A6L7P5|SYK_BACV8 Lysine--tRNA ligase OS=Bacteroides vulgatus (strain ATCC 8482 / DSM 1447 / NCTC 11154) GN=lysS PE=3 SV=1 63 548 3.0E-65
sp|P73443|SYK_SYNY3 Lysine--tRNA ligase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=lysS PE=3 SV=1 63 549 3.0E-65
sp|Q8YAB8|SYK_LISMO Lysine--tRNA ligase OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=lysS PE=3 SV=1 63 549 4.0E-65
sp|B2J384|SYK_NOSP7 Lysine--tRNA ligase OS=Nostoc punctiforme (strain ATCC 29133 / PCC 73102) GN=lysS PE=3 SV=1 63 548 5.0E-65
sp|Q8TSN5|SYK2_METAC Lysine--tRNA ligase 2 OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=lysS2 PE=3 SV=1 32 548 5.0E-65
sp|A2C629|SYK_PROM3 Lysine--tRNA ligase OS=Prochlorococcus marinus (strain MIT 9303) GN=lysS PE=3 SV=1 63 548 6.0E-65
sp|A8G7C4|SYK_PROM2 Lysine--tRNA ligase OS=Prochlorococcus marinus (strain MIT 9215) GN=lysS PE=3 SV=1 24 548 7.0E-65
sp|Q92F47|SYK_LISIN Lysine--tRNA ligase OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=lysS PE=3 SV=1 63 549 9.0E-65
sp|Q8YPW9|SYK_NOSS1 Lysine--tRNA ligase OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=lysS PE=3 SV=1 24 548 1.0E-64
sp|A0AF28|SYK_LISW6 Lysine--tRNA ligase OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=lysS PE=3 SV=1 63 549 1.0E-64
sp|B2VF45|SYK_ERWT9 Lysine--tRNA ligase OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=lysS PE=3 SV=1 63 548 1.0E-64
sp|Q050Q1|SYK_LEPBL Lysine--tRNA ligase OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain L550) GN=lysS PE=3 SV=1 33 548 1.0E-64
sp|Q04SM4|SYK_LEPBJ Lysine--tRNA ligase OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) GN=lysS PE=3 SV=1 33 548 1.0E-64
sp|A6LMS4|SYK_THEM4 Lysine--tRNA ligase OS=Thermosipho melanesiensis (strain DSM 12029 / CIP 104789 / BI429) GN=lysS PE=3 SV=1 33 548 2.0E-64
sp|P41255|SYK_THETH Lysine--tRNA ligase OS=Thermus thermophilus GN=lysS PE=1 SV=1 63 548 2.0E-64
sp|Q5SJG7|SYK_THET8 Lysine--tRNA ligase OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=lysS PE=3 SV=1 63 548 2.0E-64
sp|Q72JT9|SYK_THET2 Lysine--tRNA ligase OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=lysS PE=3 SV=1 63 548 2.0E-64
sp|A5UPG6|SYK_ROSS1 Lysine--tRNA ligase OS=Roseiflexus sp. (strain RS-1) GN=lysS PE=3 SV=1 50 548 2.0E-64
sp|A0KNK7|SYK_AERHH Lysine--tRNA ligase OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=lysS PE=3 SV=1 63 548 2.0E-64
sp|Q7VFL0|SYK_HELHP Lysine--tRNA ligase OS=Helicobacter hepaticus (strain ATCC 51449 / 3B1) GN=lysS PE=3 SV=1 64 548 2.0E-64
sp|Q72R38|SYK_LEPIC Lysine--tRNA ligase OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130) GN=lysS PE=3 SV=1 33 548 2.0E-64
sp|A7I3S8|SYK_CAMHC Lysine--tRNA ligase OS=Campylobacter hominis (strain ATCC BAA-381 / LMG 19568 / NCTC 13146 / CH001A) GN=lysS PE=3 SV=1 33 553 2.0E-64
sp|Q3B0J9|SYK_SYNS9 Lysine--tRNA ligase OS=Synechococcus sp. (strain CC9902) GN=lysS PE=3 SV=1 63 548 2.0E-64
sp|P46191|SYK_MYCHP Lysine--tRNA ligase OS=Mycoplasma hominis (strain ATCC 23114 / NBRC 14850 / NCTC 10111 / PG21) GN=lysS PE=3 SV=2 117 550 3.0E-64
sp|A4JFZ6|SYK_BURVG Lysine--tRNA ligase OS=Burkholderia vietnamiensis (strain G4 / LMG 22486) GN=lysS PE=3 SV=1 63 548 3.0E-64
sp|Q3M8C8|SYK_ANAVT Lysine--tRNA ligase OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=lysS PE=3 SV=1 63 548 3.0E-64
sp|A2RFR7|SYK_STRPG Lysine--tRNA ligase OS=Streptococcus pyogenes serotype M5 (strain Manfredo) GN=lysS PE=3 SV=1 65 548 3.0E-64
sp|Q8P1X6|SYK_STRP8 Lysine--tRNA ligase OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=lysS PE=3 SV=1 65 548 3.0E-64
sp|Q5XD62|SYK_STRP6 Lysine--tRNA ligase OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=lysS PE=3 SV=2 65 548 3.0E-64
sp|Q318C3|SYK_PROM9 Lysine--tRNA ligase OS=Prochlorococcus marinus (strain MIT 9312) GN=lysS PE=3 SV=1 24 548 3.0E-64
sp|Q7V9Q0|SYK_PROMA Lysine--tRNA ligase OS=Prochlorococcus marinus (strain SARG / CCMP1375 / SS120) GN=lysS PE=3 SV=1 63 548 4.0E-64
sp|Q49158|SYK_MYCFP Lysine--tRNA ligase OS=Mycoplasma fermentans (strain ATCC 19989 / NBRC 14854 / NCTC 10117 / PG18) GN=lysS PE=3 SV=2 120 550 4.0E-64
sp|Q38V83|SYK_LACSS Lysine--tRNA ligase OS=Lactobacillus sakei subsp. sakei (strain 23K) GN=lysS PE=3 SV=1 63 548 4.0E-64
sp|B5XKG9|SYK_STRPZ Lysine--tRNA ligase OS=Streptococcus pyogenes serotype M49 (strain NZ131) GN=lysS PE=3 SV=1 65 548 4.0E-64
sp|Q9LJE2|SYKM_ARATH Lysine--tRNA ligase, chloroplastic/mitochondrial OS=Arabidopsis thaliana GN=OVA5 PE=2 SV=1 50 548 5.0E-64
sp|A8GIP4|SYK_SERP5 Lysine--tRNA ligase OS=Serratia proteamaculans (strain 568) GN=lysS PE=3 SV=1 63 548 5.0E-64
sp|Q057G7|SYK_BUCCC Lysine--tRNA ligase OS=Buchnera aphidicola subsp. Cinara cedri (strain Cc) GN=lysS PE=3 SV=1 65 550 5.0E-64
sp|P0DG47|SYK_STRPQ Lysine--tRNA ligase OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=lysS PE=3 SV=1 65 548 5.0E-64
sp|P0DG46|SYK_STRP3 Lysine--tRNA ligase OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=lysS PE=3 SV=1 65 548 5.0E-64
sp|A0PXN4|SYK_CLONN Lysine--tRNA ligase OS=Clostridium novyi (strain NT) GN=lysS PE=3 SV=1 63 548 5.0E-64
sp|Q8F4P5|SYK_LEPIN Lysine--tRNA ligase OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601) GN=lysS PE=3 SV=1 33 548 5.0E-64
sp|B0URW9|SYK_HISS2 Lysine--tRNA ligase OS=Histophilus somni (strain 2336) GN=lysS PE=3 SV=1 55 548 6.0E-64
sp|A9B5T5|SYK_HERA2 Lysine--tRNA ligase OS=Herpetosiphon aurantiacus (strain ATCC 23779 / DSM 785) GN=lysS PE=3 SV=1 32 548 6.0E-64
sp|A8FKI8|SYK_CAMJ8 Lysine--tRNA ligase OS=Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828) GN=lysS PE=3 SV=1 33 548 7.0E-64
sp|Q724I4|SYK_LISMF Lysine--tRNA ligase OS=Listeria monocytogenes serotype 4b (strain F2365) GN=lysS PE=3 SV=1 63 549 7.0E-64
sp|Q03LD3|SYK_STRTD Lysine--tRNA ligase OS=Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9) GN=lysS PE=3 SV=1 64 548 8.0E-64
sp|A5EY50|SYK_DICNV Lysine--tRNA ligase OS=Dichelobacter nodosus (strain VCS1703A) GN=lysS PE=3 SV=1 54 548 9.0E-64
sp|A9MRI4|SYK_SALAR Lysine--tRNA ligase OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=lysS PE=3 SV=1 48 550 1.0E-63
sp|A0L6F7|SYK_MAGMM Lysine--tRNA ligase OS=Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1) GN=lysS PE=3 SV=1 63 548 1.0E-63
sp|B4F0M6|SYK_PROMH Lysine--tRNA ligase OS=Proteus mirabilis (strain HI4320) GN=lysS PE=3 SV=1 39 548 1.0E-63
sp|Q97EB7|SYK_CLOAB Lysine--tRNA ligase OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=lysS PE=3 SV=1 14 548 1.0E-63
sp|Q9RXE1|SYK_DEIRA Lysine--tRNA ligase OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=lysS PE=3 SV=1 60 575 1.0E-63
sp|Q9KGG4|SYK_BACHD Lysine--tRNA ligase OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=lysS PE=3 SV=1 63 549 2.0E-63
sp|B4TUQ8|SYK_SALSV Lysine--tRNA ligase OS=Salmonella schwarzengrund (strain CVM19633) GN=lysS PE=3 SV=1 48 550 2.0E-63
sp|B5BFK5|SYK_SALPK Lysine--tRNA ligase OS=Salmonella paratyphi A (strain AKU_12601) GN=lysS PE=3 SV=1 48 550 2.0E-63
sp|A9N3L6|SYK_SALPB Lysine--tRNA ligase OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=lysS PE=3 SV=1 48 550 2.0E-63
sp|Q5PL30|SYK_SALPA Lysine--tRNA ligase OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=lysS PE=3 SV=1 48 550 2.0E-63
sp|B4T535|SYK_SALNS Lysine--tRNA ligase OS=Salmonella newport (strain SL254) GN=lysS PE=3 SV=1 48 550 2.0E-63
sp|B4TGW0|SYK_SALHS Lysine--tRNA ligase OS=Salmonella heidelberg (strain SL476) GN=lysS PE=3 SV=1 48 550 2.0E-63
sp|B5RE01|SYK_SALG2 Lysine--tRNA ligase OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=lysS PE=3 SV=1 48 550 2.0E-63
sp|B5QXG7|SYK_SALEP Lysine--tRNA ligase OS=Salmonella enteritidis PT4 (strain P125109) GN=lysS PE=3 SV=1 48 550 2.0E-63
sp|B5FUF3|SYK_SALDC Lysine--tRNA ligase OS=Salmonella dublin (strain CT_02021853) GN=lysS PE=3 SV=1 48 550 2.0E-63
sp|Q57K76|SYK_SALCH Lysine--tRNA ligase OS=Salmonella choleraesuis (strain SC-B67) GN=lysS PE=3 SV=1 48 550 2.0E-63
sp|B5F5G4|SYK_SALA4 Lysine--tRNA ligase OS=Salmonella agona (strain SL483) GN=lysS PE=3 SV=1 48 550 2.0E-63
sp|P28354|SYK1_SALTY Lysine--tRNA ligase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=lysS PE=3 SV=3 48 550 2.0E-63
sp|Q0BDR2|SYK_BURCM Lysine--tRNA ligase OS=Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) GN=lysS PE=3 SV=1 63 548 2.0E-63
sp|B1YT20|SYK_BURA4 Lysine--tRNA ligase OS=Burkholderia ambifaria (strain MC40-6) GN=lysS PE=3 SV=1 63 548 2.0E-63
sp|Q8Z3X8|SYK1_SALTI Lysine--tRNA ligase OS=Salmonella typhi GN=lysS PE=3 SV=3 48 550 2.0E-63
sp|Q3ANE6|SYK_SYNSC Lysine--tRNA ligase OS=Synechococcus sp. (strain CC9605) GN=lysS PE=3 SV=1 63 548 2.0E-63
sp|Q0T106|SYK_SHIF8 Lysine--tRNA ligase OS=Shigella flexneri serotype 5b (strain 8401) GN=lysS PE=3 SV=1 48 550 2.0E-63
sp|B2U0Q7|SYK_SHIB3 Lysine--tRNA ligase OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=lysS PE=3 SV=1 48 550 2.0E-63
sp|Q83JU6|SYK1_SHIFL Lysine--tRNA ligase OS=Shigella flexneri GN=lysS PE=3 SV=3 48 550 2.0E-63
sp|Q5L9E5|SYK_BACFN Lysine--tRNA ligase OS=Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / JCM 11019 / NCTC 9343) GN=lysS PE=3 SV=1 63 548 2.0E-63
sp|Q64PM9|SYK_BACFR Lysine--tRNA ligase OS=Bacteroides fragilis (strain YCH46) GN=lysS PE=3 SV=1 63 548 2.0E-63
sp|A5I7P4|SYK_CLOBH Lysine--tRNA ligase OS=Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A) GN=lysS PE=3 SV=1 63 548 3.0E-63
sp|A7FZA5|SYK_CLOB1 Lysine--tRNA ligase OS=Clostridium botulinum (strain ATCC 19397 / Type A) GN=lysS PE=3 SV=1 63 548 3.0E-63
sp|B0TTP2|SYK_SHEHH Lysine--tRNA ligase OS=Shewanella halifaxensis (strain HAW-EB4) GN=lysS PE=3 SV=1 64 548 3.0E-63
sp|A7MR65|SYK_CROS8 Lysine--tRNA ligase OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=lysS PE=3 SV=1 48 550 3.0E-63
sp|Q31WF2|SYK_SHIBS Lysine--tRNA ligase OS=Shigella boydii serotype 4 (strain Sb227) GN=lysS PE=3 SV=1 48 550 3.0E-63
sp|Q7MAR1|SYK_WOLSU Lysine--tRNA ligase OS=Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / LMG 7466 / NCTC 11488 / FDC 602W) GN=lysS PE=3 SV=1 64 548 3.0E-63
sp|Q0IDW9|SYK_SYNS3 Lysine--tRNA ligase OS=Synechococcus sp. (strain CC9311) GN=lysS PE=3 SV=1 63 548 3.0E-63
sp|B2IN95|SYK_STRPS Lysine--tRNA ligase OS=Streptococcus pneumoniae (strain CGSP14) GN=lysS PE=3 SV=1 64 548 3.0E-63
sp|P0A8N3|SYK1_ECOLI Lysine--tRNA ligase OS=Escherichia coli (strain K12) GN=lysS PE=1 SV=2 48 550 3.0E-63
sp|P0A8N4|SYK1_ECOL6 Lysine--tRNA ligase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=lysS PE=3 SV=2 48 550 3.0E-63
sp|A1VYC1|SYK_CAMJJ Lysine--tRNA ligase OS=Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176) GN=lysS PE=3 SV=1 33 548 3.0E-63
sp|P41258|SYK_CAMJE Lysine--tRNA ligase OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) GN=lysS PE=3 SV=2 33 548 3.0E-63
sp|Q5HW66|SYK_CAMJR Lysine--tRNA ligase OS=Campylobacter jejuni (strain RM1221) GN=lysS PE=3 SV=1 33 548 3.0E-63
sp|C0PY12|SYK_SALPC Lysine--tRNA ligase OS=Salmonella paratyphi C (strain RKS4594) GN=lysS PE=3 SV=1 48 550 4.0E-63
sp|B8CU98|SYK_SHEPW Lysine--tRNA ligase OS=Shewanella piezotolerans (strain WP3 / JCM 13877) GN=lysS PE=3 SV=1 64 548 4.0E-63
sp|A5GQ58|SYK_SYNR3 Lysine--tRNA ligase OS=Synechococcus sp. (strain RCC307) GN=lysS PE=3 SV=1 63 548 4.0E-63
sp|A8AW92|SYK_STRGC Lysine--tRNA ligase OS=Streptococcus gordonii (strain Challis / ATCC 35105 / CH1 / DL1 / V288) GN=lysS PE=3 SV=1 61 548 4.0E-63
sp|B4EDB2|SYK_BURCJ Lysine--tRNA ligase OS=Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610) GN=lysS PE=3 SV=1 63 548 5.0E-63
sp|A9AGV1|SYK_BURM1 Lysine--tRNA ligase OS=Burkholderia multivorans (strain ATCC 17616 / 249) GN=lysS PE=3 SV=1 63 548 5.0E-63
sp|A7H4X7|SYK_CAMJD Lysine--tRNA ligase OS=Campylobacter jejuni subsp. doylei (strain ATCC BAA-1458 / RM4099 / 269.97) GN=lysS PE=3 SV=1 33 548 6.0E-63
sp|A3QB36|SYK_SHELP Lysine--tRNA ligase OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) GN=lysS PE=3 SV=1 48 548 7.0E-63
sp|Q32BV3|SYK_SHIDS Lysine--tRNA ligase OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=lysS PE=3 SV=1 48 550 7.0E-63
sp|A4WE42|SYK_ENT38 Lysine--tRNA ligase OS=Enterobacter sp. (strain 638) GN=lysS PE=3 SV=1 48 550 7.0E-63
sp|Q031U8|SYK_LACLS Lysine--tRNA ligase OS=Lactococcus lactis subsp. cremoris (strain SK11) GN=lysS PE=3 SV=1 65 548 7.0E-63
sp|A2RIA0|SYK_LACLM Lysine--tRNA ligase OS=Lactococcus lactis subsp. cremoris (strain MG1363) GN=lysS PE=3 SV=1 65 548 7.0E-63
sp|A8AP96|SYK_CITK8 Lysine--tRNA ligase OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=lysS PE=3 SV=1 48 550 7.0E-63
sp|A9WK04|SYK_CHLAA Lysine--tRNA ligase OS=Chloroflexus aurantiacus (strain ATCC 29366 / DSM 635 / J-10-fl) GN=lysS PE=3 SV=1 45 548 8.0E-63
sp|P57822|SYK_PASMU Lysine--tRNA ligase OS=Pasteurella multocida (strain Pm70) GN=lysS PE=3 SV=1 58 548 8.0E-63
sp|B3R478|SYK_CUPTR Lysine--tRNA ligase OS=Cupriavidus taiwanensis (strain R1 / LMG 19424) GN=lysS PE=3 SV=1 63 548 1.0E-62
sp|Q8CWS5|SYK_STRR6 Lysine--tRNA ligase OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=lysS PE=3 SV=1 64 548 1.0E-62
sp|B5E317|SYK_STRP4 Lysine--tRNA ligase OS=Streptococcus pneumoniae serotype 19F (strain G54) GN=lysS PE=3 SV=1 64 548 1.0E-62
sp|Q04LI2|SYK_STRP2 Lysine--tRNA ligase OS=Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) GN=lysS PE=3 SV=1 64 548 1.0E-62
sp|A0K8P2|SYK_BURCH Lysine--tRNA ligase OS=Burkholderia cenocepacia (strain HI2424) GN=lysS PE=3 SV=1 63 548 1.0E-62
sp|B1JUZ7|SYK_BURCC Lysine--tRNA ligase OS=Burkholderia cenocepacia (strain MC0-3) GN=lysS PE=3 SV=1 63 548 1.0E-62
sp|Q1BHT1|SYK_BURCA Lysine--tRNA ligase OS=Burkholderia cenocepacia (strain AU 1054) GN=lysS PE=3 SV=1 63 548 1.0E-62
sp|Q8E0I1|SYK_STRA5 Lysine--tRNA ligase OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=lysS PE=3 SV=1 60 548 1.0E-62
sp|Q8E656|SYK_STRA3 Lysine--tRNA ligase OS=Streptococcus agalactiae serotype III (strain NEM316) GN=lysS PE=3 SV=1 60 548 1.0E-62
sp|Q3K1V5|SYK_STRA1 Lysine--tRNA ligase OS=Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700) GN=lysS PE=3 SV=1 60 548 1.0E-62
sp|Q97RS9|SYK_STRPN Lysine--tRNA ligase OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=lysS PE=1 SV=2 64 548 1.0E-62
sp|Q6D945|SYK_PECAS Lysine--tRNA ligase OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=lysS PE=3 SV=1 55 548 1.0E-62
sp|Q8XD57|SYK1_ECO57 Lysine--tRNA ligase OS=Escherichia coli O157:H7 GN=lysS PE=3 SV=3 48 550 1.0E-62
sp|Q9A0V7|SYK_STRP1 Lysine--tRNA ligase OS=Streptococcus pyogenes serotype M1 GN=lysS PE=3 SV=1 65 548 2.0E-62
sp|Q88Z28|SYK_LACPL Lysine--tRNA ligase OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=lysS PE=3 SV=1 58 548 2.0E-62
sp|Q9CII7|SYK_LACLA Lysine--tRNA ligase OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=lysS PE=3 SV=1 65 548 2.0E-62
sp|Q2FSN8|SYK_METHJ Lysine--tRNA ligase OS=Methanospirillum hungatei JF-1 (strain ATCC 27890 / DSM 864 / NBRC 100397 / JF-1) GN=lysS PE=3 SV=1 45 556 2.0E-62
sp|Q2P1U6|SYK_XANOM Lysine--tRNA ligase OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=lysS PE=3 SV=1 38 548 2.0E-62
sp|Q12JH2|SYK_SHEDO Lysine--tRNA ligase OS=Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) GN=lysS PE=3 SV=1 64 548 3.0E-62
sp|B1IAN6|SYK_STRPI Lysine--tRNA ligase OS=Streptococcus pneumoniae (strain Hungary19A-6) GN=lysS PE=3 SV=1 64 548 3.0E-62
sp|P56126|SYK_HELPY Lysine--tRNA ligase OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=lysS PE=3 SV=1 49 550 3.0E-62
sp|Q087X1|SYK_SHEFN Lysine--tRNA ligase OS=Shewanella frigidimarina (strain NCIMB 400) GN=lysS PE=3 SV=1 28 548 4.0E-62
sp|Q1LPK6|SYK_CUPMC Lysine--tRNA ligase OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) GN=lysS PE=3 SV=1 63 548 4.0E-62
sp|A1JPL4|SYK_YERE8 Lysine--tRNA ligase OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=lysS PE=3 SV=1 54 550 4.0E-62
sp|A5UIX4|SYK_HAEIG Lysine--tRNA ligase OS=Haemophilus influenzae (strain PittGG) GN=lysS PE=3 SV=1 63 548 4.0E-62
sp|Q4QL88|SYK_HAEI8 Lysine--tRNA ligase OS=Haemophilus influenzae (strain 86-028NP) GN=lysS PE=3 SV=1 63 548 5.0E-62
sp|Q9X231|SYK_THEMA Lysine--tRNA ligase OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=lysS PE=3 SV=1 22 544 6.0E-62
sp|B0BP90|SYK_ACTPJ Lysine--tRNA ligase OS=Actinobacillus pleuropneumoniae serotype 3 (strain JL03) GN=lysS PE=3 SV=1 63 548 6.0E-62
sp|A3N0G9|SYK_ACTP2 Lysine--tRNA ligase OS=Actinobacillus pleuropneumoniae serotype 5b (strain L20) GN=lysS PE=3 SV=1 63 548 6.0E-62
sp|B1KTC1|SYK_CLOBM Lysine--tRNA ligase OS=Clostridium botulinum (strain Loch Maree / Type A3) GN=lysS PE=3 SV=1 63 548 6.0E-62
sp|Q03E09|SYK_PEDPA Lysine--tRNA ligase OS=Pediococcus pentosaceus (strain ATCC 25745 / 183-1w) GN=lysS PE=3 SV=1 62 550 7.0E-62
sp|Q473I5|SYK_CUPPJ Lysine--tRNA ligase OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=lysS PE=3 SV=1 58 548 7.0E-62
sp|Q5QYV9|SYK_IDILO Lysine--tRNA ligase OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=lysS PE=3 SV=1 39 548 8.0E-62
sp|A9BD62|SYK_PROM4 Lysine--tRNA ligase OS=Prochlorococcus marinus (strain MIT 9211) GN=lysS PE=3 SV=1 63 548 9.0E-62
sp|A5D5Q4|SYK_PELTS Lysine--tRNA ligase OS=Pelotomaculum thermopropionicum (strain DSM 13744 / JCM 10971 / SI) GN=lysS PE=3 SV=1 63 544 9.0E-62
sp|Q8NXZ0|SYK_STAAW Lysine--tRNA ligase OS=Staphylococcus aureus (strain MW2) GN=lysS PE=3 SV=1 39 548 1.0E-61
sp|Q6GBX1|SYK_STAAS Lysine--tRNA ligase OS=Staphylococcus aureus (strain MSSA476) GN=lysS PE=3 SV=1 39 548 1.0E-61
sp|Q8CQV5|SYK_STAES Lysine--tRNA ligase OS=Staphylococcus epidermidis (strain ATCC 12228) GN=lysS PE=3 SV=1 39 548 1.0E-61
sp|Q5HRN7|SYK_STAEQ Lysine--tRNA ligase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=lysS PE=3 SV=1 39 548 1.0E-61
sp|A7GJB3|SYK_CLOBL Lysine--tRNA ligase OS=Clostridium botulinum (strain Langeland / NCTC 10281 / Type F) GN=lysS PE=3 SV=1 63 548 1.0E-61
sp|B1IGJ2|SYK_CLOBK Lysine--tRNA ligase OS=Clostridium botulinum (strain Okra / Type B1) GN=lysS PE=3 SV=1 63 548 1.0E-61
sp|Q8RG52|SYK_FUSNN Lysine--tRNA ligase OS=Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / CIP 101130 / JCM 8532 / LMG 13131) GN=lysS PE=3 SV=1 17 548 1.0E-61
sp|P67610|SYK_STAAN Lysine--tRNA ligase OS=Staphylococcus aureus (strain N315) GN=lysS PE=1 SV=1 39 548 1.0E-61
sp|P67609|SYK_STAAM Lysine--tRNA ligase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=lysS PE=3 SV=1 39 548 1.0E-61
sp|Q5HIF7|SYK_STAAC Lysine--tRNA ligase OS=Staphylococcus aureus (strain COL) GN=lysS PE=3 SV=1 39 548 1.0E-61
sp|Q2YVW8|SYK_STAAB Lysine--tRNA ligase OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=lysS PE=3 SV=1 39 548 1.0E-61
sp|Q2G0Q3|SYK_STAA8 Lysine--tRNA ligase OS=Staphylococcus aureus (strain NCTC 8325) GN=lysS PE=3 SV=1 39 548 1.0E-61
sp|Q2FJC3|SYK_STAA3 Lysine--tRNA ligase OS=Staphylococcus aureus (strain USA300) GN=lysS PE=3 SV=1 39 548 1.0E-61
sp|A7WYS8|SYK_STAA1 Lysine--tRNA ligase OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=lysS PE=3 SV=1 39 548 1.0E-61
sp|Q4L3H5|SYK_STAHJ Lysine--tRNA ligase OS=Staphylococcus haemolyticus (strain JCSC1435) GN=lysS PE=3 SV=1 60 548 1.0E-61
sp|A4VTP6|SYK_STRSY Lysine--tRNA ligase OS=Streptococcus suis (strain 05ZYH33) GN=lysS PE=3 SV=1 65 548 1.0E-61
sp|A4VZY0|SYK_STRS2 Lysine--tRNA ligase OS=Streptococcus suis (strain 98HAH33) GN=lysS PE=3 SV=1 65 548 1.0E-61
sp|Q5WVS0|SYK_LEGPL Lysine--tRNA ligase OS=Legionella pneumophila (strain Lens) GN=lysS PE=3 SV=1 63 548 1.0E-61
sp|B1LAX6|SYK_THESQ Lysine--tRNA ligase OS=Thermotoga sp. (strain RQ2) GN=lysS PE=3 SV=1 21 544 2.0E-61
sp|A5ILE6|SYK_THEP1 Lysine--tRNA ligase OS=Thermotoga petrophila (strain RKU-1 / ATCC BAA-488 / DSM 13995) GN=lysS PE=3 SV=1 21 544 2.0E-61
sp|Q8FAT5|SYK2_ECOL6 Lysine--tRNA ligase, heat inducible OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=lysU PE=3 SV=3 48 548 2.0E-61
sp|P0A8N5|SYK2_ECOLI Lysine--tRNA ligase, heat inducible OS=Escherichia coli (strain K12) GN=lysU PE=1 SV=2 48 548 2.0E-61
sp|P0A8N6|SYK2_ECO57 Lysine--tRNA ligase, heat inducible OS=Escherichia coli O157:H7 GN=lysU PE=3 SV=2 48 548 2.0E-61
sp|B1KFR7|SYK_SHEWM Lysine--tRNA ligase OS=Shewanella woodyi (strain ATCC 51908 / MS32) GN=lysS PE=3 SV=1 64 548 2.0E-61
sp|Q47C53|SYK_DECAR Lysine--tRNA ligase OS=Dechloromonas aromatica (strain RCB) GN=lysS PE=3 SV=1 63 548 2.0E-61
sp|B2US13|SYK_HELPS Lysine--tRNA ligase OS=Helicobacter pylori (strain Shi470) GN=lysS PE=3 SV=1 49 550 2.0E-61
sp|A8H0J7|SYK_SHEPA Lysine--tRNA ligase OS=Shewanella pealeana (strain ATCC 700345 / ANG-SQ1) GN=lysS PE=3 SV=1 64 548 2.0E-61
sp|B1JPH6|SYK_YERPY Lysine--tRNA ligase OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=lysS PE=3 SV=1 48 550 2.0E-61
sp|Q666T3|SYK_YERPS Lysine--tRNA ligase OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=lysS PE=3 SV=1 48 550 2.0E-61
sp|A4TIC5|SYK_YERPP Lysine--tRNA ligase OS=Yersinia pestis (strain Pestoides F) GN=lysS PE=3 SV=1 48 550 2.0E-61
sp|Q1CF16|SYK_YERPN Lysine--tRNA ligase OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=lysS PE=3 SV=1 48 550 2.0E-61
sp|A9R4M4|SYK_YERPG Lysine--tRNA ligase OS=Yersinia pestis bv. Antiqua (strain Angola) GN=lysS PE=3 SV=1 48 550 2.0E-61
sp|Q8ZHK5|SYK_YERPE Lysine--tRNA ligase OS=Yersinia pestis GN=lysS PE=3 SV=1 48 550 2.0E-61
sp|B2K0N6|SYK_YERPB Lysine--tRNA ligase OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=lysS PE=3 SV=1 48 550 2.0E-61
sp|Q1CB23|SYK_YERPA Lysine--tRNA ligase OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=lysS PE=3 SV=1 48 550 2.0E-61
sp|A7FF39|SYK_YERP3 Lysine--tRNA ligase OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=lysS PE=3 SV=1 48 550 2.0E-61
sp|A5UCQ0|SYK_HAEIE Lysine--tRNA ligase OS=Haemophilus influenzae (strain PittEE) GN=lysS PE=3 SV=1 63 548 3.0E-61
sp|Q8PLC6|SYK_XANAC Lysine--tRNA ligase OS=Xanthomonas axonopodis pv. citri (strain 306) GN=lysS PE=3 SV=1 38 548 3.0E-61
sp|Q17YS1|SYK_HELAH Lysine--tRNA ligase OS=Helicobacter acinonychis (strain Sheeba) GN=lysS PE=3 SV=1 64 550 3.0E-61
sp|B6JPT1|SYK_HELP2 Lysine--tRNA ligase OS=Helicobacter pylori (strain P12) GN=lysS PE=3 SV=1 49 550 3.0E-61
sp|B2SV97|SYK_XANOP Lysine--tRNA ligase OS=Xanthomonas oryzae pv. oryzae (strain PXO99A) GN=lysS PE=3 SV=1 38 548 3.0E-61
sp|C6D8Z6|SYK_PECCP Lysine--tRNA ligase OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=lysS PE=3 SV=1 64 548 3.0E-61
sp|B2U8U9|SYK_RALPJ Lysine--tRNA ligase OS=Ralstonia pickettii (strain 12J) GN=lysS PE=3 SV=1 63 548 3.0E-61
sp|Q1CUX6|SYK_HELPH Lysine--tRNA ligase OS=Helicobacter pylori (strain HPAG1) GN=lysS PE=3 SV=1 49 550 3.0E-61
sp|Q0KCG3|SYK_CUPNH Lysine--tRNA ligase OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=lysS PE=3 SV=1 63 548 3.0E-61
sp|A8FRH9|SYK_SHESH Lysine--tRNA ligase OS=Shewanella sediminis (strain HAW-EB3) GN=lysS PE=3 SV=1 48 548 4.0E-61
sp|Q53638|SYK_STAAU Lysine--tRNA ligase OS=Staphylococcus aureus GN=lysS PE=3 SV=1 39 548 4.0E-61
sp|B3H1E8|SYK_ACTP7 Lysine--tRNA ligase OS=Actinobacillus pleuropneumoniae serotype 7 (strain AP76) GN=lysS PE=3 SV=1 63 548 5.0E-61
sp|Q8Y0L5|SYK_RALSO Lysine--tRNA ligase OS=Ralstonia solanacearum (strain GMI1000) GN=lysS PE=3 SV=1 63 548 5.0E-61
sp|B8GRJ2|SYK_THISH Lysine--tRNA ligase OS=Thioalkalivibrio sulfidiphilus (strain HL-EbGR7) GN=lysS PE=3 SV=1 63 548 5.0E-61
sp|B2RJY1|SYK_PORG3 Lysine--tRNA ligase OS=Porphyromonas gingivalis (strain ATCC 33277 / DSM 20709 / JCM 12257) GN=lysS PE=3 SV=1 58 548 5.0E-61
sp|B3QMN9|SYK_CHLP8 Lysine--tRNA ligase OS=Chlorobaculum parvum (strain NCIB 8327) GN=lysS PE=3 SV=1 32 548 5.0E-61
sp|Q6GJF4|SYK_STAAR Lysine--tRNA ligase OS=Staphylococcus aureus (strain MRSA252) GN=lysS PE=3 SV=1 39 548 5.0E-61
sp|B5Z9V6|SYK_HELPG Lysine--tRNA ligase OS=Helicobacter pylori (strain G27) GN=lysS PE=3 SV=1 49 550 5.0E-61
sp|Q5ZUL6|SYK_LEGPH Lysine--tRNA ligase OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) GN=lysS PE=3 SV=1 63 548 8.0E-61
sp|A5ICT2|SYK_LEGPC Lysine--tRNA ligase OS=Legionella pneumophila (strain Corby) GN=lysS PE=3 SV=1 63 548 8.0E-61
sp|Q9PR83|SYK_UREPA Lysine--tRNA ligase OS=Ureaplasma parvum serovar 3 (strain ATCC 700970) GN=lysS PE=3 SV=1 14 549 8.0E-61
sp|B1AI47|SYK_UREP2 Lysine--tRNA ligase OS=Ureaplasma parvum serovar 3 (strain ATCC 27815 / 27 / NCTC 11736) GN=lysS PE=3 SV=1 14 549 8.0E-61
sp|Q3Z8X9|SYK_DEHM1 Lysine--tRNA ligase OS=Dehalococcoides mccartyi (strain ATCC BAA-2266 / KCTC 15142 / 195) GN=lysS PE=3 SV=1 62 549 9.0E-61
sp|Q3BUB6|SYK_XANC5 Lysine--tRNA ligase OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=lysS PE=3 SV=1 38 548 1.0E-60
sp|Q5X4D5|SYK_LEGPA Lysine--tRNA ligase OS=Legionella pneumophila (strain Paris) GN=lysS PE=3 SV=1 63 548 1.0E-60
sp|Q2SXD6|SYK_BURTA Lysine--tRNA ligase OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=lysS PE=1 SV=1 63 548 1.0E-60
sp|B1MVJ0|SYK_LEUCK Lysine--tRNA ligase OS=Leuconostoc citreum (strain KM20) GN=lysS PE=3 SV=1 63 548 1.0E-60
sp|Q8A5W4|SYK_BACTN Lysine--tRNA ligase OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482) GN=lysS PE=3 SV=1 63 548 1.0E-60
sp|Q9KU60|SYK_VIBCH Lysine--tRNA ligase OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=lysS PE=3 SV=2 54 548 1.0E-60
sp|Q7VLU5|SYK_HAEDU Lysine--tRNA ligase OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=lysS PE=3 SV=1 63 549 1.0E-60
sp|A3CP17|SYK_STRSV Lysine--tRNA ligase OS=Streptococcus sanguinis (strain SK36) GN=lysS PE=3 SV=1 65 548 1.0E-60
sp|Q7N1C8|SYK_PHOLL Lysine--tRNA ligase OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=lysS PE=3 SV=1 39 548 1.0E-60
sp|A5GI38|SYK_SYNPW Lysine--tRNA ligase OS=Synechococcus sp. (strain WH7803) GN=lysS PE=3 SV=1 63 548 1.0E-60
sp|Q87SB1|SYK_VIBPA Lysine--tRNA ligase OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=lysS PE=3 SV=1 61 548 2.0E-60
sp|Q3JQP3|SYK_BURP1 Lysine--tRNA ligase OS=Burkholderia pseudomallei (strain 1710b) GN=lysS PE=3 SV=1 63 548 2.0E-60
sp|B0RSQ8|SYK_XANCB Lysine--tRNA ligase OS=Xanthomonas campestris pv. campestris (strain B100) GN=lysS PE=3 SV=1 58 548 2.0E-60
sp|Q98QG4|SYK2_MYCPU Lysine--tRNA ligase 2 OS=Mycoplasma pulmonis (strain UAB CTIP) GN=lysS2 PE=3 SV=1 117 548 2.0E-60
sp|Q5WLU5|SYK_BACSK Lysine--tRNA ligase OS=Bacillus clausii (strain KSM-K16) GN=lysS PE=3 SV=1 60 549 2.0E-60
sp|Q65SB0|SYK_MANSM Lysine--tRNA ligase OS=Mannheimia succiniciproducens (strain MBEL55E) GN=lysS PE=3 SV=1 55 549 2.0E-60
sp|C1DB68|SYK_LARHH Lysine--tRNA ligase OS=Laribacter hongkongensis (strain HLHK9) GN=lysS PE=3 SV=1 63 548 3.0E-60
sp|Q8DEQ9|SYK_VIBVU Lysine--tRNA ligase OS=Vibrio vulnificus (strain CMCP6) GN=lysS PE=3 SV=1 11 548 3.0E-60
sp|A1S9M3|SYK_SHEAM Lysine--tRNA ligase OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) GN=lysS PE=3 SV=1 64 548 3.0E-60
sp|A0M5H8|SYK_GRAFK Lysine--tRNA ligase OS=Gramella forsetii (strain KT0803) GN=lysS PE=3 SV=1 63 548 3.0E-60
sp|Q89AC5|SYK_BUCBP Lysine--tRNA ligase OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=lysS PE=3 SV=1 43 548 4.0E-60
sp|Q7MNP6|SYK_VIBVY Lysine--tRNA ligase OS=Vibrio vulnificus (strain YJ016) GN=lysS PE=3 SV=1 11 548 5.0E-60
sp|Q63SN9|SYK_BURPS Lysine--tRNA ligase OS=Burkholderia pseudomallei (strain K96243) GN=lysS PE=3 SV=1 63 548 5.0E-60
sp|Q7VRF5|SYK_BLOFL Lysine--tRNA ligase OS=Blochmannia floridanus GN=lysS PE=3 SV=1 39 549 6.0E-60
sp|A3NX27|SYK_BURP0 Lysine--tRNA ligase OS=Burkholderia pseudomallei (strain 1106a) GN=lysS PE=3 SV=1 63 548 6.0E-60
sp|A1V5L6|SYK_BURMS Lysine--tRNA ligase OS=Burkholderia mallei (strain SAVP1) GN=lysS PE=3 SV=1 63 548 6.0E-60
sp|Q62IZ9|SYK_BURMA Lysine--tRNA ligase OS=Burkholderia mallei (strain ATCC 23344) GN=lysS PE=3 SV=1 63 548 6.0E-60
sp|A2SAT3|SYK_BURM9 Lysine--tRNA ligase OS=Burkholderia mallei (strain NCTC 10229) GN=lysS PE=3 SV=1 63 548 6.0E-60
sp|A3ML91|SYK_BURM7 Lysine--tRNA ligase OS=Burkholderia mallei (strain NCTC 10247) GN=lysS PE=3 SV=1 63 548 6.0E-60
sp|A5N4L1|SYK_CLOK5 Lysine--tRNA ligase OS=Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680) GN=lysS PE=3 SV=1 63 548 6.0E-60
sp|Q9L3G6|SYK_XANCP Lysine--tRNA ligase OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=lysS PE=3 SV=1 58 548 8.0E-60
sp|Q4UU84|SYK_XANC8 Lysine--tRNA ligase OS=Xanthomonas campestris pv. campestris (strain 8004) GN=lysS PE=3 SV=1 58 548 8.0E-60
sp|A3NB96|SYK_BURP6 Lysine--tRNA ligase OS=Burkholderia pseudomallei (strain 668) GN=lysS PE=3 SV=1 63 548 8.0E-60
sp|Q3B365|SYK_CHLL7 Lysine--tRNA ligase OS=Chlorobium luteolum (strain DSM 273 / 2530) GN=lysS PE=3 SV=1 51 548 8.0E-60
sp|B5ZAP2|SYK_UREU1 Lysine--tRNA ligase OS=Ureaplasma urealyticum serovar 10 (strain ATCC 33699 / Western) GN=lysS PE=3 SV=1 14 549 1.0E-59
sp|Q7MUV7|SYK_PORGI Lysine--tRNA ligase OS=Porphyromonas gingivalis (strain ATCC BAA-308 / W83) GN=lysS PE=3 SV=1 63 548 1.0E-59
sp|Q98QH1|SYK1_MYCPU Lysine--tRNA ligase 1 OS=Mycoplasma pulmonis (strain UAB CTIP) GN=lysS1 PE=3 SV=2 117 548 1.0E-59
sp|Q9ZMP8|SYK_HELPJ Lysine--tRNA ligase OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=lysS PE=3 SV=1 49 550 1.0E-59
sp|B4SB22|SYK_PELPB Lysine--tRNA ligase OS=Pelodictyon phaeoclathratiforme (strain DSM 5477 / BU-1) GN=lysS PE=3 SV=1 8 548 2.0E-59
sp|Q4A8F8|SYK_MYCH7 Lysine--tRNA ligase OS=Mycoplasma hyopneumoniae (strain 7448) GN=lysS PE=3 SV=2 33 548 2.0E-59
sp|Q9RHV9|SYK_GEOSE Lysine--tRNA ligase OS=Geobacillus stearothermophilus GN=lysS PE=1 SV=1 63 549 2.0E-59
sp|Q8EI58|SYK_SHEON Lysine--tRNA ligase OS=Shewanella oneidensis (strain MR-1) GN=lysS PE=3 SV=1 64 548 2.0E-59
sp|P43825|SYK_HAEIN Lysine--tRNA ligase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=lysS PE=3 SV=1 63 548 2.0E-59
sp|Q4AAC7|SYK_MYCHJ Lysine--tRNA ligase OS=Mycoplasma hyopneumoniae (strain J / ATCC 25934 / NCTC 10110) GN=lysS PE=3 SV=2 33 548 2.0E-59
sp|P37477|SYK_BACSU Lysine--tRNA ligase OS=Bacillus subtilis (strain 168) GN=lysS PE=3 SV=1 63 548 3.0E-59
sp|Q2RM49|SYK_MOOTA Lysine--tRNA ligase OS=Moorella thermoacetica (strain ATCC 39073) GN=lysS PE=3 SV=1 63 548 3.0E-59
sp|A1RGF1|SYK_SHESW Lysine--tRNA ligase OS=Shewanella sp. (strain W3-18-1) GN=lysS PE=3 SV=1 64 548 4.0E-59
sp|A4Y9X9|SYK_SHEPC Lysine--tRNA ligase OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=lysS PE=3 SV=1 64 548 4.0E-59
sp|Q5NY31|SYK_AROAE Lysine--tRNA ligase OS=Aromatoleum aromaticum (strain EbN1) GN=lysS PE=3 SV=1 58 548 4.0E-59
sp|Q0HRS5|SYK_SHESR Lysine--tRNA ligase OS=Shewanella sp. (strain MR-7) GN=lysS PE=3 SV=1 64 548 4.0E-59
sp|Q0HM10|SYK_SHESM Lysine--tRNA ligase OS=Shewanella sp. (strain MR-4) GN=lysS PE=3 SV=1 64 548 4.0E-59
sp|A0L0F1|SYK_SHESA Lysine--tRNA ligase OS=Shewanella sp. (strain ANA-3) GN=lysS PE=3 SV=1 64 548 4.0E-59
sp|A9IQY2|SYK_BORPD Lysine--tRNA ligase OS=Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448) GN=lysS PE=3 SV=1 48 548 4.0E-59
sp|Q4KHL4|SYK_PSEF5 Lysine--tRNA ligase OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=lysS PE=3 SV=1 63 548 5.0E-59
sp|Q6MUG2|SYK_MYCMS Lysine--tRNA ligase OS=Mycoplasma mycoides subsp. mycoides SC (strain PG1) GN=lysS PE=3 SV=1 59 548 5.0E-59
sp|A7MXL2|SYK_VIBCB Lysine--tRNA ligase OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120) GN=lysS PE=3 SV=1 61 548 6.0E-59
sp|Q7NG18|SYK_GLOVI Lysine--tRNA ligase OS=Gloeobacter violaceus (strain PCC 7421) GN=lysS PE=3 SV=1 33 552 7.0E-59
sp|A4SYX2|SYK_POLSQ Lysine--tRNA ligase OS=Polynucleobacter necessarius subsp. asymbioticus (strain DSM 18221 / CIP 109841 / QLW-P1DMWA-1) GN=lysS PE=3 SV=1 54 548 8.0E-59
sp|Q7NC34|SYK_MYCGA Lysine--tRNA ligase OS=Mycoplasma gallisepticum (strain R(low / passage 15 / clone 2)) GN=lysS PE=3 SV=2 43 548 9.0E-59
sp|Q8DUW8|SYK_STRMU Lysine--tRNA ligase OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=lysS PE=3 SV=1 64 548 9.0E-59
sp|Q6YPY6|SYK_ONYPE Lysine--tRNA ligase OS=Onion yellows phytoplasma (strain OY-M) GN=lysS PE=3 SV=1 45 549 9.0E-59
sp|B1XTS4|SYK_POLNS Lysine--tRNA ligase OS=Polynucleobacter necessarius subsp. necessarius (strain STIR1) GN=lysS PE=3 SV=1 50 548 1.0E-58
sp|B4UGU5|SYK_ANASK Lysine--tRNA ligase OS=Anaeromyxobacter sp. (strain K) GN=lysS PE=3 SV=1 43 549 1.0E-58
sp|B8JFW2|SYK_ANAD2 Lysine--tRNA ligase OS=Anaeromyxobacter dehalogenans (strain 2CP-1 / ATCC BAA-258) GN=lysS PE=3 SV=1 43 549 1.0E-58
sp|Q83E97|SYK_COXBU Lysine--tRNA ligase OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=lysS PE=3 SV=1 63 549 1.0E-58
sp|A9NBP7|SYK_COXBR Lysine--tRNA ligase OS=Coxiella burnetii (strain RSA 331 / Henzerling II) GN=lysS PE=3 SV=1 63 549 1.0E-58
sp|A9KEG1|SYK_COXBN Lysine--tRNA ligase OS=Coxiella burnetii (strain Dugway 5J108-111) GN=lysS PE=3 SV=1 63 549 1.0E-58
sp|B6J1P6|SYK_COXB2 Lysine--tRNA ligase OS=Coxiella burnetii (strain CbuG_Q212) GN=lysS PE=3 SV=1 63 549 1.0E-58
sp|B6J8K2|SYK_COXB1 Lysine--tRNA ligase OS=Coxiella burnetii (strain CbuK_Q154) GN=lysS PE=3 SV=1 63 549 1.0E-58
sp|A5WFG0|SYK_PSYWF Lysine--tRNA ligase OS=Psychrobacter sp. (strain PRwf-1) GN=lysS PE=3 SV=1 51 548 1.0E-58
sp|A8F4K1|SYK_PSELT Lysine--tRNA ligase OS=Pseudothermotoga lettingae (strain ATCC BAA-301 / DSM 14385 / NBRC 107922 / TMO) GN=lysS PE=3 SV=1 33 544 1.0E-58
sp|Q7NZ62|SYK_CHRVO Lysine--tRNA ligase OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=lysS PE=3 SV=1 63 548 2.0E-58
sp|B0U572|SYK_XYLFM Lysine--tRNA ligase OS=Xylella fastidiosa (strain M12) GN=lysS PE=3 SV=1 58 548 2.0E-58
sp|A7GJY9|SYK_BACCN Lysine--tRNA ligase OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=lysS PE=3 SV=1 63 549 2.0E-58
sp|B5ZQW5|SYK_RHILW Lysine--tRNA ligase OS=Rhizobium leguminosarum bv. trifolii (strain WSM2304) GN=lysS PE=3 SV=1 51 549 2.0E-58
sp|A6VPH6|SYK_ACTSZ Lysine--tRNA ligase OS=Actinobacillus succinogenes (strain ATCC 55618 / 130Z) GN=lysS PE=3 SV=1 63 549 2.0E-58
sp|Q2NRG1|SYK_SODGM Lysine--tRNA ligase OS=Sodalis glossinidius (strain morsitans) GN=lysS PE=3 SV=1 63 548 2.0E-58
sp|Q2NJZ8|SYK_AYWBP Lysine--tRNA ligase OS=Aster yellows witches'-broom phytoplasma (strain AYWB) GN=lysS PE=3 SV=1 45 549 2.0E-58
sp|Q87EB3|SYK_XYLFT Lysine--tRNA ligase OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=lysS PE=3 SV=1 58 548 2.0E-58
sp|B2I848|SYK_XYLF2 Lysine--tRNA ligase OS=Xylella fastidiosa (strain M23) GN=lysS PE=3 SV=1 58 548 2.0E-58
sp|Q9PEB6|SYK_XYLFA Lysine--tRNA ligase OS=Xylella fastidiosa (strain 9a5c) GN=lysS PE=3 SV=1 58 548 2.0E-58
sp|Q2IPX5|SYK_ANADE Lysine--tRNA ligase OS=Anaeromyxobacter dehalogenans (strain 2CP-C) GN=lysS PE=3 SV=1 64 549 3.0E-58
sp|C5BAR6|SYK_EDWI9 Lysine--tRNA ligase OS=Edwardsiella ictaluri (strain 93-146) GN=lysS PE=3 SV=1 63 548 3.0E-58
sp|Q3KHF3|SYK_PSEPF Lysine--tRNA ligase OS=Pseudomonas fluorescens (strain Pf0-1) GN=lysS PE=3 SV=1 48 548 3.0E-58
sp|Q4FSV2|SYK_PSYA2 Lysine--tRNA ligase OS=Psychrobacter arcticus (strain DSM 17307 / 273-4) GN=lysS PE=3 SV=1 63 548 4.0E-58
sp|B2JIY1|SYK_BURP8 Lysine--tRNA ligase OS=Burkholderia phymatum (strain DSM 17167 / STM815) GN=lysS PE=3 SV=1 48 548 4.0E-58
sp|A9L1I0|SYK_SHEB9 Lysine--tRNA ligase OS=Shewanella baltica (strain OS195) GN=lysS PE=3 SV=1 64 548 5.0E-58
sp|A6WS29|SYK_SHEB8 Lysine--tRNA ligase OS=Shewanella baltica (strain OS185) GN=lysS PE=3 SV=1 64 548 5.0E-58
sp|A3D0Y5|SYK_SHEB5 Lysine--tRNA ligase OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=lysS PE=3 SV=1 64 548 5.0E-58
sp|Q2SR35|SYK_MYCCT Lysine--tRNA ligase OS=Mycoplasma capricolum subsp. capricolum (strain California kid / ATCC 27343 / NCTC 10154) GN=lysS PE=3 SV=1 59 548 6.0E-58
sp|A1KUN1|SYK_NEIMF Lysine--tRNA ligase OS=Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18) GN=lysS PE=3 SV=1 63 548 7.0E-58
sp|Q5F6U2|SYK_NEIG1 Lysine--tRNA ligase OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) GN=lysS PE=3 SV=1 34 548 7.0E-58
sp|B2SXV7|SYK_BURPP Lysine--tRNA ligase OS=Burkholderia phytofirmans (strain DSM 17436 / PsJN) GN=lysS PE=3 SV=1 2 548 8.0E-58
sp|Q8D2B3|SYK_WIGBR Lysine--tRNA ligase OS=Wigglesworthia glossinidia brevipalpis GN=lysS PE=3 SV=1 73 549 8.0E-58
sp|B4RP57|SYK_NEIG2 Lysine--tRNA ligase OS=Neisseria gonorrhoeae (strain NCCP11945) GN=lysS PE=3 SV=1 34 548 9.0E-58
sp|Q03Z44|SYK_LEUMM Lysine--tRNA ligase OS=Leuconostoc mesenteroides subsp. mesenteroides (strain ATCC 8293 / NCDO 523) GN=lysS PE=3 SV=1 63 548 9.0E-58
sp|Q13WZ5|SYK_BURXL Lysine--tRNA ligase OS=Burkholderia xenovorans (strain LB400) GN=lysS PE=3 SV=1 48 548 9.0E-58
sp|Q8EU10|SYK_OCEIH Lysine--tRNA ligase OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=lysS PE=3 SV=1 54 548 9.0E-58
sp|B1HSY5|SYK_LYSSC Lysine--tRNA ligase OS=Lysinibacillus sphaericus (strain C3-41) GN=lysS PE=3 SV=1 48 550 9.0E-58
sp|Q1MBK9|SYK_RHIL3 Lysine--tRNA ligase OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=lysS PE=3 SV=1 48 549 1.0E-57
sp|B6EMX2|SYK_ALISL Lysine--tRNA ligase OS=Aliivibrio salmonicida (strain LFI1238) GN=lysS PE=3 SV=1 61 548 1.0E-57
sp|Q5E7P8|SYK_VIBF1 Lysine--tRNA ligase OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=lysS PE=3 SV=1 61 548 1.0E-57
sp|Q48F26|SYK_PSE14 Lysine--tRNA ligase OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=lysS PE=3 SV=1 48 548 1.0E-57
sp|A5W890|SYK_PSEP1 Lysine--tRNA ligase OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=lysS PE=3 SV=1 63 548 2.0E-57
sp|Q9JTT7|SYK_NEIMA Lysine--tRNA ligase OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=lysS PE=3 SV=1 63 548 2.0E-57
sp|Q1IDW1|SYK_PSEE4 Lysine--tRNA ligase OS=Pseudomonas entomophila (strain L48) GN=lysS PE=3 SV=1 63 548 2.0E-57
sp|Q4ZWW0|SYK_PSEU2 Lysine--tRNA ligase OS=Pseudomonas syringae pv. syringae (strain B728a) GN=lysS PE=3 SV=1 48 548 2.0E-57
sp|B0KRL5|SYK_PSEPG Lysine--tRNA ligase OS=Pseudomonas putida (strain GB-1) GN=lysS PE=3 SV=1 63 548 2.0E-57
sp|A6UDA0|SYK_SINMW Lysine--tRNA ligase OS=Sinorhizobium medicae (strain WSM419) GN=lysS PE=3 SV=1 59 549 2.0E-57
sp|Q8KCM7|SYK_CHLTE Lysine--tRNA ligase OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) GN=lysS PE=3 SV=1 63 548 2.0E-57
sp|B3Q0S4|SYK_RHIE6 Lysine--tRNA ligase OS=Rhizobium etli (strain CIAT 652) GN=lysS PE=3 SV=1 51 549 2.0E-57
sp|Q7VZ37|SYK_BORPE Lysine--tRNA ligase OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=lysS PE=3 SV=1 63 548 3.0E-57
sp|B5F9U5|SYK_VIBFM Lysine--tRNA ligase OS=Vibrio fischeri (strain MJ11) GN=lysS PE=3 SV=1 61 548 3.0E-57
sp|Q7WK46|SYK_BORBR Lysine--tRNA ligase OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=lysS PE=3 SV=1 63 548 3.0E-57
sp|A8ESJ5|SYK_ARCB4 Lysine--tRNA ligase OS=Arcobacter butzleri (strain RM4018) GN=lysS PE=3 SV=1 64 550 3.0E-57
sp|Q88MS3|SYK_PSEPK Lysine--tRNA ligase OS=Pseudomonas putida (strain KT2440) GN=lysS PE=3 SV=1 63 548 3.0E-57
sp|A1K5J9|SYK_AZOSB Lysine--tRNA ligase OS=Azoarcus sp. (strain BH72) GN=lysS PE=3 SV=1 63 548 3.0E-57
sp|B1JD39|SYK_PSEPW Lysine--tRNA ligase OS=Pseudomonas putida (strain W619) GN=lysS PE=3 SV=1 63 548 4.0E-57
sp|Q9JYU6|SYK_NEIMB Lysine--tRNA ligase OS=Neisseria meningitidis serogroup B (strain MC58) GN=lysS PE=3 SV=1 63 548 4.0E-57
sp|Q3SKD9|SYK_THIDA Lysine--tRNA ligase OS=Thiobacillus denitrificans (strain ATCC 25259) GN=lysS PE=3 SV=1 63 548 5.0E-57
sp|Q886S6|SYK_PSESM Lysine--tRNA ligase OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=lysS PE=3 SV=1 48 548 6.0E-57
sp|B7JK84|SYK_BACC0 Lysine--tRNA ligase OS=Bacillus cereus (strain AH820) GN=lysS PE=3 SV=1 63 549 6.0E-57
sp|B7HPY8|SYK_BACC7 Lysine--tRNA ligase OS=Bacillus cereus (strain AH187) GN=lysS PE=3 SV=1 63 549 6.0E-57
sp|Q73FD1|SYK_BACC1 Lysine--tRNA ligase OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=lysS PE=3 SV=1 63 549 6.0E-57
sp|Q43990|SYK_ACIAD Lysine--tRNA ligase OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=lysS PE=3 SV=1 63 548 7.0E-57
sp|Q1LTU4|SYK_BAUCH Lysine--tRNA ligase OS=Baumannia cicadellinicola subsp. Homalodisca coagulata GN=lysS PE=3 SV=1 49 548 7.0E-57
sp|Q6HPU0|SYK_BACHK Lysine--tRNA ligase OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=lysS PE=3 SV=1 63 549 7.0E-57
sp|Q63HC2|SYK_BACCZ Lysine--tRNA ligase OS=Bacillus cereus (strain ZK / E33L) GN=lysS PE=3 SV=1 63 549 7.0E-57
sp|Q81VW3|SYK_BACAN Lysine--tRNA ligase OS=Bacillus anthracis GN=lysS PE=3 SV=1 63 549 7.0E-57
sp|A0R8E9|SYK_BACAH Lysine--tRNA ligase OS=Bacillus thuringiensis (strain Al Hakam) GN=lysS PE=3 SV=1 63 549 7.0E-57
sp|Q7W8T6|SYK_BORPA Lysine--tRNA ligase OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=lysS PE=3 SV=1 63 548 8.0E-57
sp|B6YRR7|SYK_AZOPC Lysine--tRNA ligase OS=Azobacteroides pseudotrichonymphae genomovar. CFP2 GN=lysS PE=3 SV=1 63 548 9.0E-57
sp|A4XXQ6|SYK_PSEMY Lysine--tRNA ligase OS=Pseudomonas mendocina (strain ymp) GN=lysS PE=3 SV=1 17 548 9.0E-57
sp|Q0SQ86|SYK_CLOPS Lysine--tRNA ligase OS=Clostridium perfringens (strain SM101 / Type A) GN=lysS PE=3 SV=1 63 548 9.0E-57
sp|Q0TMI7|SYK_CLOP1 Lysine--tRNA ligase OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) GN=lysS PE=3 SV=1 63 548 9.0E-57
sp|Q1H372|SYK_METFK Lysine--tRNA ligase OS=Methylobacillus flagellatus (strain KT / ATCC 51484 / DSM 6875) GN=lysS PE=3 SV=1 63 548 9.0E-57
sp|Q8XHL8|SYK_CLOPE Lysine--tRNA ligase OS=Clostridium perfringens (strain 13 / Type A) GN=lysS PE=3 SV=1 63 548 1.0E-56
sp|Q2SL47|SYK_HAHCH Lysine--tRNA ligase OS=Hahella chejuensis (strain KCTC 2396) GN=lysS PE=3 SV=1 81 548 1.0E-56
sp|A6V187|SYK_PSEA7 Lysine--tRNA ligase OS=Pseudomonas aeruginosa (strain PA7) GN=lysS PE=3 SV=1 63 548 1.0E-56
sp|Q3ARD7|SYK_CHLCH Lysine--tRNA ligase OS=Chlorobium chlorochromatii (strain CaD3) GN=lysS PE=3 SV=1 63 548 1.0E-56
sp|Q9HXU0|SYK_PSEAE Lysine--tRNA ligase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=lysS PE=3 SV=1 63 548 2.0E-56
sp|Q1QAW5|SYK_PSYCK Lysine--tRNA ligase OS=Psychrobacter cryohalolentis (strain K5) GN=lysS PE=3 SV=1 92 548 2.0E-56
sp|B7V0Z5|SYK_PSEA8 Lysine--tRNA ligase OS=Pseudomonas aeruginosa (strain LESB58) GN=lysS PE=3 SV=1 63 548 2.0E-56
sp|C5BRM0|SYK_TERTT Lysine--tRNA ligase OS=Teredinibacter turnerae (strain ATCC 39867 / T7901) GN=lysS PE=3 SV=1 118 548 2.0E-56
sp|B0V9L5|SYK_ACIBY Lysine--tRNA ligase OS=Acinetobacter baumannii (strain AYE) GN=lysS PE=3 SV=1 48 552 3.0E-56
sp|B0VSE0|SYK_ACIBS Lysine--tRNA ligase OS=Acinetobacter baumannii (strain SDF) GN=lysS PE=3 SV=1 48 552 3.0E-56
sp|B7GXW0|SYK_ACIB3 Lysine--tRNA ligase OS=Acinetobacter baumannii (strain AB307-0294) GN=lysS PE=3 SV=1 48 552 3.0E-56
sp|A3M3D6|SYK_ACIBT Lysine--tRNA ligase OS=Acinetobacter baumannii (strain ATCC 17978 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377) GN=lysS PE=3 SV=2 48 552 3.0E-56
sp|Q8EUS8|SYK_MYCPE Lysine--tRNA ligase OS=Mycoplasma penetrans (strain HF-2) GN=lysS PE=3 SV=1 59 549 5.0E-56
sp|Q2K424|SYK_RHIEC Lysine--tRNA ligase OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=lysS PE=3 SV=1 59 549 5.0E-56
sp|Q02RH2|SYK_PSEAB Lysine--tRNA ligase OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=lysS PE=3 SV=1 63 548 5.0E-56
sp|Q81J70|SYK_BACCR Lysine--tRNA ligase OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=lysS PE=3 SV=1 63 549 5.0E-56
sp|B7HJ16|SYK_BACC4 Lysine--tRNA ligase OS=Bacillus cereus (strain B4264) GN=lysS PE=3 SV=1 63 549 5.0E-56
sp|A6SXF3|SYK_JANMA Lysine--tRNA ligase OS=Janthinobacterium sp. (strain Marseille) GN=lysS PE=3 SV=1 63 548 7.0E-56
sp|B7ISY7|SYK_BACC2 Lysine--tRNA ligase OS=Bacillus cereus (strain G9842) GN=lysS PE=3 SV=1 63 549 1.0E-55
sp|C5CSG3|SYK_VARPS Lysine--tRNA ligase OS=Variovorax paradoxus (strain S110) GN=lysS PE=3 SV=1 63 548 1.0E-55
sp|A4G778|SYK_HERAR Lysine--tRNA ligase OS=Herminiimonas arsenicoxydans GN=lysS PE=3 SV=1 63 548 2.0E-55
sp|Q49V26|SYK_STAS1 Lysine--tRNA ligase OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=lysS PE=3 SV=1 63 548 2.0E-55
sp|Q4JCI5|SYK_SULAC Lysine--tRNA ligase OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=lysS PE=3 SV=1 63 547 3.0E-55
sp|Q8K9C5|SYK_BUCAP Lysine--tRNA ligase OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=lysS PE=3 SV=1 51 548 3.0E-55
sp|Q82SH1|SYK_NITEU Lysine--tRNA ligase OS=Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298) GN=lysS PE=3 SV=1 54 548 4.0E-55
sp|B1VA97|SYK_PHYAS Lysine--tRNA ligase OS=Phytoplasma australiense GN=lysS PE=3 SV=1 13 544 6.0E-55
sp|Q493E1|SYK_BLOPB Lysine--tRNA ligase OS=Blochmannia pennsylvanicus (strain BPEN) GN=lysS PE=3 SV=1 63 548 7.0E-55
sp|A9VN90|SYK_BACWK Lysine--tRNA ligase OS=Bacillus weihenstephanensis (strain KBAB4) GN=lysS PE=3 SV=1 63 549 9.0E-55
sp|P95970|SYK_SULSO Lysine--tRNA ligase OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=lysS PE=3 SV=1 63 556 1.0E-54
sp|A1T047|SYK_PSYIN Lysine--tRNA ligase OS=Psychromonas ingrahamii (strain 37) GN=lysS PE=3 SV=1 64 548 2.0E-54
sp|O87821|SYK_RHIME Lysine--tRNA ligase OS=Rhizobium meliloti (strain 1021) GN=lysS PE=3 SV=2 63 549 2.0E-54
sp|Q1QT66|SYK_CHRSD Lysine--tRNA ligase OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=lysS PE=3 SV=1 63 548 3.0E-54
sp|Q8U7H6|SYK_AGRFC Lysine--tRNA ligase OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=lysS PE=3 SV=1 45 549 4.0E-54
sp|Q47WT5|SYK_COLP3 Lysine--tRNA ligase OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=lysS PE=3 SV=1 73 548 9.0E-54
sp|A2SDC3|SYK_METPP Lysine--tRNA ligase OS=Methylibium petroleiphilum (strain PM1) GN=lysS PE=3 SV=1 65 548 2.0E-53
sp|P57512|SYK_BUCAI Lysine--tRNA ligase OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=lysS PE=3 SV=1 63 548 2.0E-53
sp|P75500|SYK_MYCPN Lysine--tRNA ligase OS=Mycoplasma pneumoniae (strain ATCC 29342 / M129) GN=lysS PE=3 SV=1 88 548 2.0E-52
sp|A4T9U2|LYSX_MYCGI Lysylphosphatidylglycerol biosynthesis bifunctional protein LysX OS=Mycobacterium gilvum (strain PYR-GCK) GN=lysX PE=3 SV=1 63 544 3.0E-52
sp|A6W5H6|SYK_KINRD Lysine--tRNA ligase OS=Kineococcus radiotolerans (strain ATCC BAA-149 / DSM 14245 / SRS30216) GN=lysS PE=3 SV=1 59 544 7.0E-52
sp|Q5Z3P6|LYSX_NOCFA Lysylphosphatidylglycerol biosynthesis bifunctional protein LysX OS=Nocardia farcinica (strain IFM 10152) GN=lysX PE=3 SV=2 63 544 8.0E-52
sp|A5CWL4|SYK_VESOH Lysine--tRNA ligase OS=Vesicomyosocius okutanii subsp. Calyptogena okutanii (strain HA) GN=lysS PE=3 SV=1 42 548 1.0E-51
sp|A0QHC4|LYSX_MYCA1 Lysylphosphatidylglycerol biosynthesis bifunctional protein LysX OS=Mycobacterium avium (strain 104) GN=lysX PE=3 SV=2 63 544 9.0E-51
sp|Q740J9|LYSX_MYCPA Lysylphosphatidylglycerol biosynthesis bifunctional protein LysX OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=lysX PE=3 SV=1 63 544 1.0E-50
sp|P47382|SYK_MYCGE Lysine--tRNA ligase OS=Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195) GN=lysS PE=3 SV=1 48 548 1.0E-49
sp|Q5L545|SYK_CHLAB Lysine--tRNA ligase OS=Chlamydophila abortus (strain DSM 27085 / S26/3) GN=lysS PE=3 SV=1 63 550 3.0E-49
sp|A1TAC7|LYSX_MYCVP Lysylphosphatidylglycerol biosynthesis bifunctional protein LysX OS=Mycobacterium vanbaalenii (strain DSM 7251 / PYR-1) GN=lysX PE=3 SV=1 63 544 6.0E-49
sp|P46861|SYK_MYCLE Lysine--tRNA ligase OS=Mycobacterium leprae (strain TN) GN=lysS PE=3 SV=2 58 534 1.0E-48
sp|A0QYV1|LYSX_MYCS2 Lysylphosphatidylglycerol biosynthesis bifunctional protein LysX OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=lysX PE=3 SV=2 63 544 2.0E-48
sp|Q9Z6X5|SYK_CHLPN Lysine--tRNA ligase OS=Chlamydia pneumoniae GN=lysS PE=3 SV=1 63 548 3.0E-48
sp|C6DS31|LYSX_MYCTK Lysylphosphatidylglycerol biosynthesis bifunctional protein LysX OS=Mycobacterium tuberculosis (strain KZN 1435 / MDR) GN=lysX PE=3 SV=1 63 544 3.0E-48
sp|P9WFU7|LYSX_MYCTU Lysylphosphatidylglycerol biosynthesis bifunctional protein LysX OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=lysX PE=1 SV=1 63 544 3.0E-48
sp|P9WFU6|LYSX_MYCTO Lysylphosphatidylglycerol biosynthesis bifunctional protein LysX OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=lysX PE=3 SV=1 63 544 3.0E-48
sp|A5WMW1|LYSX_MYCTF Lysylphosphatidylglycerol biosynthesis bifunctional protein LysX OS=Mycobacterium tuberculosis (strain F11) GN=lysX PE=3 SV=1 63 544 3.0E-48
sp|A5U2Z7|LYSX_MYCTA Lysylphosphatidylglycerol biosynthesis bifunctional protein LysX OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=lysX PE=3 SV=1 63 544 3.0E-48
sp|C1ANR3|LYSX_MYCBT Lysylphosphatidylglycerol biosynthesis bifunctional protein LysX OS=Mycobacterium bovis (strain BCG / Tokyo 172 / ATCC 35737 / TMC 1019) GN=lysX PE=3 SV=1 63 544 3.0E-48
sp|A1KJ57|LYSX_MYCBP Lysylphosphatidylglycerol biosynthesis bifunctional protein LysX OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) GN=lysX PE=3 SV=1 63 544 3.0E-48
sp|Q7VEV7|LYSX_MYCBO Lysylphosphatidylglycerol biosynthesis bifunctional protein LysX OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=lysX PE=3 SV=1 63 544 4.0E-48
sp|Q0SAA3|LYSX_RHOJR Lysylphosphatidylglycerol biosynthesis bifunctional protein LysX OS=Rhodococcus jostii (strain RHA1) GN=lysX PE=3 SV=1 63 544 7.0E-48
sp|Q9PLE1|SYK_CHLMU Lysine--tRNA ligase OS=Chlamydia muridarum (strain MoPn / Nigg) GN=lysS PE=3 SV=1 63 550 8.0E-48
sp|Q821U6|SYK_CHLCV Lysine--tRNA ligase OS=Chlamydophila caviae (strain GPIC) GN=lysS PE=3 SV=1 63 550 1.0E-47
sp|C1B7Z5|LYSX_RHOOB Lysylphosphatidylglycerol biosynthesis bifunctional protein LysX OS=Rhodococcus opacus (strain B4) GN=lysX PE=3 SV=1 63 544 2.0E-47
sp|A4T5M9|SYK_MYCGI Lysine--tRNA ligase OS=Mycobacterium gilvum (strain PYR-GCK) GN=lysS PE=3 SV=1 32 534 2.0E-47
sp|Q1B7P4|LYSX_MYCSS Lysylphosphatidylglycerol biosynthesis bifunctional protein LysX OS=Mycobacterium sp. (strain MCS) GN=lysX PE=3 SV=1 65 544 2.0E-47
sp|A1UHB3|LYSX_MYCSK Lysylphosphatidylglycerol biosynthesis bifunctional protein LysX OS=Mycobacterium sp. (strain KMS) GN=lysX PE=3 SV=1 65 544 2.0E-47
sp|D0LB45|LYSX_GORB4 Lysylphosphatidylglycerol biosynthesis bifunctional protein LysX OS=Gordonia bronchialis (strain ATCC 25592 / DSM 43247 / JCM 3198 / NCTC 10667) GN=lysX PE=3 SV=1 32 544 2.0E-47
sp|A5U8S4|SYK_MYCTA Lysine--tRNA ligase OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=lysS PE=3 SV=1 58 534 4.0E-47
sp|C1AI57|SYK_MYCBT Lysine--tRNA ligase OS=Mycobacterium bovis (strain BCG / Tokyo 172 / ATCC 35737 / TMC 1019) GN=lysS PE=3 SV=1 58 534 4.0E-47
sp|A1KPT4|SYK_MYCBP Lysine--tRNA ligase OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) GN=lysS PE=3 SV=1 58 534 4.0E-47
sp|P9WFU9|SYK1_MYCTU Lysine--tRNA ligase 1 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=lysS1 PE=1 SV=1 58 534 4.0E-47
sp|P9WFU8|SYK1_MYCTO Lysine--tRNA ligase 1 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=lysS1 PE=3 SV=1 58 534 4.0E-47
sp|P67608|SYK1_MYCBO Lysine--tRNA ligase 1 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=lysS1 PE=3 SV=1 58 534 4.0E-47
sp|B0BAN6|SYK_CHLTB Lysine--tRNA ligase OS=Chlamydia trachomatis serovar L2b (strain UCH-1/proctitis) GN=lysS PE=3 SV=1 63 550 4.0E-47
sp|B0B907|SYK_CHLT2 Lysine--tRNA ligase OS=Chlamydia trachomatis serovar L2 (strain 434/Bu / ATCC VR-902B) GN=lysS PE=3 SV=1 63 550 4.0E-47
sp|A3Q0V0|LYSX_MYCSJ Lysylphosphatidylglycerol biosynthesis bifunctional protein LysX OS=Mycobacterium sp. (strain JLS) GN=lysX PE=3 SV=1 65 544 5.0E-47
sp|O84786|SYK_CHLTR Lysine--tRNA ligase OS=Chlamydia trachomatis (strain D/UW-3/Cx) GN=lysS PE=3 SV=1 63 550 5.0E-47
sp|Q3KKR1|SYK_CHLTA Lysine--tRNA ligase OS=Chlamydia trachomatis serovar A (strain ATCC VR-571B / DSM 19440 / HAR-13) GN=lysS PE=3 SV=1 63 550 5.0E-47
sp|C0ZL89|LYSX_RHOE4 Lysylphosphatidylglycerol biosynthesis bifunctional protein LysX OS=Rhodococcus erythropolis (strain PR4 / NBRC 100887) GN=lysX PE=3 SV=1 63 544 2.0E-46
sp|Q255U2|SYK_CHLFF Lysine--tRNA ligase OS=Chlamydophila felis (strain Fe/C-56) GN=lysS PE=3 SV=1 63 550 7.0E-46
sp|Q9CC23|LYSX_MYCLE Lysylphosphatidylglycerol biosynthesis bifunctional protein LysX OS=Mycobacterium leprae (strain TN) GN=lysX PE=3 SV=2 60 544 4.0E-45
sp|B8ZRJ4|LYSX_MYCLB Lysylphosphatidylglycerol biosynthesis bifunctional protein LysX OS=Mycobacterium leprae (strain Br4923) GN=lysX PE=3 SV=2 60 544 4.0E-45
sp|B2HR11|LYSX_MYCMM Lysylphosphatidylglycerol biosynthesis bifunctional protein LysX OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=lysX PE=3 SV=2 63 544 6.0E-45
sp|B1MAX9|LYSX_MYCA9 Lysylphosphatidylglycerol biosynthesis bifunctional protein LysX OS=Mycobacterium abscessus (strain ATCC 19977 / DSM 44196 / CIP 104536 / JCM 13569 / NCTC 13031 / TMC 1543) GN=lysX PE=3 SV=1 63 544 1.0E-44
sp|A0PP57|LYSX_MYCUA Lysylphosphatidylglycerol biosynthesis bifunctional protein LysX OS=Mycobacterium ulcerans (strain Agy99) GN=lysX PE=3 SV=2 63 544 1.0E-44
sp|C4K3U1|EPMA_HAMD5 Elongation factor P--(R)-beta-lysine ligase OS=Hamiltonella defensa subsp. Acyrthosiphon pisum (strain 5AT) GN=epmA PE=3 SV=1 187 544 2.0E-26
sp|B5R9A5|EPMA_SALG2 Elongation factor P--(R)-beta-lysine ligase OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=epmA PE=3 SV=1 187 544 1.0E-25
sp|B4TSD9|EPMA_SALSV Elongation factor P--(R)-beta-lysine ligase OS=Salmonella schwarzengrund (strain CVM19633) GN=epmA PE=3 SV=1 187 544 1.0E-25
sp|C0Q6B6|EPMA_SALPC Elongation factor P--(R)-beta-lysine ligase OS=Salmonella paratyphi C (strain RKS4594) GN=epmA PE=3 SV=1 187 544 1.0E-25
sp|A9N413|EPMA_SALPB Elongation factor P--(R)-beta-lysine ligase OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=epmA PE=3 SV=1 187 544 1.0E-25
sp|B4T2Q3|EPMA_SALNS Elongation factor P--(R)-beta-lysine ligase OS=Salmonella newport (strain SL254) GN=epmA PE=3 SV=1 187 544 1.0E-25
sp|Q57GN3|EPMA_SALCH Elongation factor P--(R)-beta-lysine ligase OS=Salmonella choleraesuis (strain SC-B67) GN=epmA PE=3 SV=1 187 544 1.0E-25
sp|B5Y345|EPMA_KLEP3 Elongation factor P--(R)-beta-lysine ligase OS=Klebsiella pneumoniae (strain 342) GN=epmA PE=3 SV=1 187 544 1.0E-25
sp|B5BKG8|EPMA_SALPK Elongation factor P--(R)-beta-lysine ligase OS=Salmonella paratyphi A (strain AKU_12601) GN=epmA PE=3 SV=1 187 544 1.0E-25
sp|Q5PLH2|EPMA_SALPA Elongation factor P--(R)-beta-lysine ligase OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=epmA PE=3 SV=1 187 544 1.0E-25
sp|B5FRL4|EPMA_SALDC Elongation factor P--(R)-beta-lysine ligase OS=Salmonella dublin (strain CT_02021853) GN=epmA PE=3 SV=1 187 544 1.0E-25
sp|Q9ZJ12|EPMA_SALTY Elongation factor P--(R)-beta-lysine ligase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=epmA PE=1 SV=2 187 544 2.0E-25
sp|B4TF92|EPMA_SALHS Elongation factor P--(R)-beta-lysine ligase OS=Salmonella heidelberg (strain SL476) GN=epmA PE=3 SV=1 187 544 2.0E-25
sp|B5R019|EPMA_SALEP Elongation factor P--(R)-beta-lysine ligase OS=Salmonella enteritidis PT4 (strain P125109) GN=epmA PE=3 SV=1 187 544 2.0E-25
sp|B5F2M2|EPMA_SALA4 Elongation factor P--(R)-beta-lysine ligase OS=Salmonella agona (strain SL483) GN=epmA PE=3 SV=1 187 544 2.0E-25
sp|A9MFQ6|EPMA_SALAR Elongation factor P--(R)-beta-lysine ligase OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=epmA PE=3 SV=1 187 544 2.0E-25
sp|A1JIQ4|EPMA_YERE8 Elongation factor P--(R)-beta-lysine ligase OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=epmA PE=3 SV=1 187 544 5.0E-25
sp|Q8Z197|EPMA_SALTI Elongation factor P--(R)-beta-lysine ligase OS=Salmonella typhi GN=epmA PE=3 SV=1 187 544 7.0E-25
sp|Q7MZY6|EPMA_PHOLL Elongation factor P--(R)-beta-lysine ligase OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=epmA PE=3 SV=1 187 544 1.0E-24
sp|B7LLT9|EPMA_ESCF3 Elongation factor P--(R)-beta-lysine ligase OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=epmA PE=3 SV=1 187 548 1.0E-24
sp|A8AMP1|EPMA_CITK8 Elongation factor P--(R)-beta-lysine ligase OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=epmA PE=3 SV=1 187 544 2.0E-24
sp|A8G8T8|EPMA_SERP5 Elongation factor P--(R)-beta-lysine ligase OS=Serratia proteamaculans (strain 568) GN=epmA PE=3 SV=1 187 544 2.0E-24
sp|B4EWY8|EPMA_PROMH Elongation factor P--(R)-beta-lysine ligase OS=Proteus mirabilis (strain HI4320) GN=epmA PE=3 SV=1 187 548 2.0E-24
sp|C5BDL9|EPMA_EDWI9 Elongation factor P--(R)-beta-lysine ligase OS=Edwardsiella ictaluri (strain 93-146) GN=epmA PE=3 SV=1 187 545 2.0E-24
sp|P0A8P0|EPMA_SHIFL Elongation factor P--(R)-beta-lysine ligase OS=Shigella flexneri GN=epmA PE=3 SV=1 187 545 2.0E-24
sp|Q0SXC1|EPMA_SHIF8 Elongation factor P--(R)-beta-lysine ligase OS=Shigella flexneri serotype 5b (strain 8401) GN=epmA PE=3 SV=1 187 545 2.0E-24
sp|B2TY33|EPMA_SHIB3 Elongation factor P--(R)-beta-lysine ligase OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=epmA PE=3 SV=1 187 545 2.0E-24
sp|Q1R3A2|EPMA_ECOUT Elongation factor P--(R)-beta-lysine ligase OS=Escherichia coli (strain UTI89 / UPEC) GN=epmA PE=3 SV=1 187 545 2.0E-24
sp|B1LQH8|EPMA_ECOSM Elongation factor P--(R)-beta-lysine ligase OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=epmA PE=3 SV=1 187 545 2.0E-24
sp|B6I264|EPMA_ECOSE Elongation factor P--(R)-beta-lysine ligase OS=Escherichia coli (strain SE11) GN=epmA PE=3 SV=1 187 545 2.0E-24
sp|B7NG94|EPMA_ECOLU Elongation factor P--(R)-beta-lysine ligase OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=epmA PE=3 SV=1 187 545 2.0E-24
sp|P0A8N7|EPMA_ECOLI Elongation factor P--(R)-beta-lysine ligase OS=Escherichia coli (strain K12) GN=epmA PE=1 SV=1 187 545 2.0E-24
sp|P0A8N8|EPMA_ECOL6 Elongation factor P--(R)-beta-lysine ligase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=epmA PE=3 SV=1 187 545 2.0E-24
sp|Q0T9N4|EPMA_ECOL5 Elongation factor P--(R)-beta-lysine ligase OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=epmA PE=3 SV=1 187 545 2.0E-24
sp|A8A7Q4|EPMA_ECOHS Elongation factor P--(R)-beta-lysine ligase OS=Escherichia coli O9:H4 (strain HS) GN=epmA PE=3 SV=1 187 545 2.0E-24
sp|B1XDQ9|EPMA_ECODH Elongation factor P--(R)-beta-lysine ligase OS=Escherichia coli (strain K12 / DH10B) GN=epmA PE=3 SV=1 187 545 2.0E-24
sp|C5A1E9|EPMA_ECOBW Elongation factor P--(R)-beta-lysine ligase OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=epmA PE=3 SV=1 187 545 2.0E-24
sp|B7M8S0|EPMA_ECO8A Elongation factor P--(R)-beta-lysine ligase OS=Escherichia coli O8 (strain IAI1) GN=epmA PE=3 SV=1 187 545 2.0E-24
sp|B7MSX2|EPMA_ECO81 Elongation factor P--(R)-beta-lysine ligase OS=Escherichia coli O81 (strain ED1a) GN=epmA PE=3 SV=1 187 545 2.0E-24
[Show less]

GO

GO Term Description Terminal node
GO:0003676 nucleic acid binding Yes
GO:0006418 tRNA aminoacylation for protein translation Yes
GO:0005524 ATP binding Yes
GO:0000166 nucleotide binding Yes
GO:0004812 aminoacyl-tRNA ligase activity Yes
GO:0016875 ligase activity, forming carbon-oxygen bonds No
GO:0097367 carbohydrate derivative binding No
GO:0006807 nitrogen compound metabolic process No
GO:0140101 catalytic activity, acting on a tRNA No
GO:0043436 oxoacid metabolic process No
GO:0043038 amino acid activation No
GO:0032553 ribonucleotide binding No
GO:0006520 cellular amino acid metabolic process No
GO:0140640 catalytic activity, acting on a nucleic acid No
GO:0043167 ion binding No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0003824 catalytic activity No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0003674 molecular_function No
GO:0005488 binding No
GO:0006399 tRNA metabolic process No
GO:0008150 biological_process No
GO:0006082 organic acid metabolic process No
GO:0019752 carboxylic acid metabolic process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0043170 macromolecule metabolic process No
GO:0140098 catalytic activity, acting on RNA No
GO:0036094 small molecule binding No
GO:0016070 RNA metabolic process No
GO:0034660 ncRNA metabolic process No
GO:0043168 anion binding No
GO:0046483 heterocycle metabolic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0030554 adenyl nucleotide binding No
GO:0043039 tRNA aminoacylation No
GO:0044238 primary metabolic process No
GO:0016874 ligase activity No
GO:0009987 cellular process No
GO:0008152 metabolic process No
GO:1901360 organic cyclic compound metabolic process No
GO:0032559 adenyl ribonucleotide binding No
GO:0044237 cellular metabolic process No
GO:0044281 small molecule metabolic process No
GO:0071704 organic substance metabolic process No
GO:1901363 heterocyclic compound binding No
GO:0032555 purine ribonucleotide binding No
GO:1901265 nucleoside phosphate binding No
GO:0097159 organic cyclic compound binding No
GO:0090304 nucleic acid metabolic process No
GO:0017076 purine nucleotide binding No
GO:0006139 nucleobase-containing compound metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 42 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|4395
MSKPEITSLFDHNKRQMAQDHEQQQEEPLVSEPYPRLESDDARESVPEFLQQYEEHLATENLVTLCGRVRNKRVF
GKGLMFLDIANEFQRVQVMLNRHKCFSGKVLRTERFELYKNLVQIGDHISVTGVATRTSSGEPTLEASDLPRLLS
PTMEQLPAKLVNETTRMHDRHVDMLVNREVLDVLRLKGEITKHMRRHFESKRFLEFQTPILAEDASGASARAFVT
ESVELRNKFLSLRIAPELWLKRLVVGGVDRVFEIGPAFRNEGLDATHNPEFTMCEFYSAYTNLTDLIKETEELIC
SLAKHCQECISTQLTSLPQVDLSRFARPFKQVEFVPALEKAIGVRLPKLTTETALAEVIATLKLGGIDVPGEVPS
TLVRLLDRLATLYLEPMSMTEPMFLMNHPACMSPLAKSFLCPKTYQLVSARAEFYCGGRELANMYEEENNPREQK
RKLKYHRLLVNKADGQPGFDPDERTKSRQRGGKGIEAQDQDPVVERDWAKKKLDESYVRALDHGLPPTGGWGCGL
ERLVMLFSGANRISDCLSFGSLRNVVGLAADAKAGGKARAAKTTEENDASTSQGESRG*
Coding >OphauB2|4395
ATGTCAAAGCCAGAAATCACTTCGTTGTTTGACCACAACAAGCGCCAAATGGCTCAAGACCATGAGCAGCAACAA
GAGGAGCCGCTTGTTTCAGAACCATATCCTCGGCTGGAATCCGATGACGCCCGGGAAAGTGTTCCCGAGTTTCTC
CAACAGTATGAGGAGCATCTCGCCACGGAGAACCTCGTTACCCTGTGTGGCCGTGTCAGGAATAAACGCGTCTTT
GGGAAAGGTCTCATGTTCCTCGACATTGCCAATGAGTTTCAGCGCGTCCAAGTCATGCTCAACAGGCACAAGTGT
TTCTCAGGCAAGGTGTTGCGGACTGAGAGATTTGAGCTGTACAAGAATCTGGTACAAATTGGCGATCACATATCT
GTCACTGGCGTGGCCACACGTACCAGCAGCGGCGAGCCAACCCTCGAAGCCTCGGATCTGCCGCGCCTCTTGTCA
CCAACCATGGAGCAGCTTCCAGCCAAGCTGGTCAATGAGACGACACGCATGCATGACCGCCATGTCGACATGCTT
GTGAATCGAGAGGTGCTGGACGTTTTGAGACTAAAGGGCGAAATCACCAAGCACATGCGCAGGCACTTTGAGTCG
AAACGCTTCCTCGAGTTTCAGACTCCCATCCTGGCTGAAGACGCAAGCGGCGCCTCTGCGCGTGCCTTTGTCACC
GAGTCGGTCGAGTTGCGAAACAAATTTTTGTCTCTTCGCATCGCGCCCGAGCTGTGGCTCAAGCGGCTCGTGGTG
GGCGGCGTTGACCGCGTCTTTGAAATTGGCCCAGCCTTTCGCAACGAGGGCCTTGATGCCACGCATAACCCCGAG
TTTACCATGTGCGAGTTTTATAGCGCCTATACTAACTTGACTGATCTCATCAAGGAGACGGAGGAACTCATTTGT
AGCCTAGCCAAGCACTGCCAGGAATGCATTTCGACACAGCTTACATCCTTGCCTCAAGTAGACCTGAGTCGCTTT
GCCCGGCCCTTTAAGCAAGTCGAGTTTGTGCCTGCCTTGGAAAAGGCCATCGGGGTTCGTCTGCCCAAGCTGACA
ACAGAAACGGCCCTTGCCGAGGTGATTGCCACTTTGAAGCTCGGTGGCATTGATGTTCCCGGTGAGGTCCCGTCT
ACTCTTGTCAGGCTGCTGGACCGACTAGCGACGCTTTATCTCGAACCCATGTCCATGACGGAGCCCATGTTTCTC
ATGAACCATCCGGCTTGCATGTCGCCCCTGGCCAAGTCGTTTCTTTGTCCCAAAACTTATCAACTAGTGTCGGCC
CGTGCCGAGTTTTACTGTGGTGGCAGAGAACTGGCCAACATGTATGAGGAGGAAAACAACCCTCGGGAGCAGAAA
CGCAAGTTGAAATATCATCGCCTCTTGGTCAACAAGGCAGACGGCCAACCCGGCTTTGACCCAGACGAGCGGACA
AAAAGCCGCCAGAGGGGTGGTAAAGGGATAGAAGCCCAAGACCAAGATCCAGTTGTAGAGCGTGACTGGGCGAAG
AAGAAGCTCGACGAAAGCTATGTCAGAGCCCTCGATCACGGACTACCCCCCACAGGAGGCTGGGGCTGTGGCCTG
GAGAGGCTCGTGATGCTCTTTTCTGGTGCAAATCGCATTAGTGACTGCCTGAGCTTTGGTTCGCTGCGCAATGTT
GTGGGCTTGGCTGCTGATGCAAAGGCTGGTGGCAAGGCGCGGGCGGCCAAGACGACTGAGGAGAATGACGCGTCG
ACGTCGCAAGGTGAATCTCGAGGCTGA
Transcript >OphauB2|4395
ATGTCAAAGCCAGAAATCACTTCGTTGTTTGACCACAACAAGCGCCAAATGGCTCAAGACCATGAGCAGCAACAA
GAGGAGCCGCTTGTTTCAGAACCATATCCTCGGCTGGAATCCGATGACGCCCGGGAAAGTGTTCCCGAGTTTCTC
CAACAGTATGAGGAGCATCTCGCCACGGAGAACCTCGTTACCCTGTGTGGCCGTGTCAGGAATAAACGCGTCTTT
GGGAAAGGTCTCATGTTCCTCGACATTGCCAATGAGTTTCAGCGCGTCCAAGTCATGCTCAACAGGCACAAGTGT
TTCTCAGGCAAGGTGTTGCGGACTGAGAGATTTGAGCTGTACAAGAATCTGGTACAAATTGGCGATCACATATCT
GTCACTGGCGTGGCCACACGTACCAGCAGCGGCGAGCCAACCCTCGAAGCCTCGGATCTGCCGCGCCTCTTGTCA
CCAACCATGGAGCAGCTTCCAGCCAAGCTGGTCAATGAGACGACACGCATGCATGACCGCCATGTCGACATGCTT
GTGAATCGAGAGGTGCTGGACGTTTTGAGACTAAAGGGCGAAATCACCAAGCACATGCGCAGGCACTTTGAGTCG
AAACGCTTCCTCGAGTTTCAGACTCCCATCCTGGCTGAAGACGCAAGCGGCGCCTCTGCGCGTGCCTTTGTCACC
GAGTCGGTCGAGTTGCGAAACAAATTTTTGTCTCTTCGCATCGCGCCCGAGCTGTGGCTCAAGCGGCTCGTGGTG
GGCGGCGTTGACCGCGTCTTTGAAATTGGCCCAGCCTTTCGCAACGAGGGCCTTGATGCCACGCATAACCCCGAG
TTTACCATGTGCGAGTTTTATAGCGCCTATACTAACTTGACTGATCTCATCAAGGAGACGGAGGAACTCATTTGT
AGCCTAGCCAAGCACTGCCAGGAATGCATTTCGACACAGCTTACATCCTTGCCTCAAGTAGACCTGAGTCGCTTT
GCCCGGCCCTTTAAGCAAGTCGAGTTTGTGCCTGCCTTGGAAAAGGCCATCGGGGTTCGTCTGCCCAAGCTGACA
ACAGAAACGGCCCTTGCCGAGGTGATTGCCACTTTGAAGCTCGGTGGCATTGATGTTCCCGGTGAGGTCCCGTCT
ACTCTTGTCAGGCTGCTGGACCGACTAGCGACGCTTTATCTCGAACCCATGTCCATGACGGAGCCCATGTTTCTC
ATGAACCATCCGGCTTGCATGTCGCCCCTGGCCAAGTCGTTTCTTTGTCCCAAAACTTATCAACTAGTGTCGGCC
CGTGCCGAGTTTTACTGTGGTGGCAGAGAACTGGCCAACATGTATGAGGAGGAAAACAACCCTCGGGAGCAGAAA
CGCAAGTTGAAATATCATCGCCTCTTGGTCAACAAGGCAGACGGCCAACCCGGCTTTGACCCAGACGAGCGGACA
AAAAGCCGCCAGAGGGGTGGTAAAGGGATAGAAGCCCAAGACCAAGATCCAGTTGTAGAGCGTGACTGGGCGAAG
AAGAAGCTCGACGAAAGCTATGTCAGAGCCCTCGATCACGGACTACCCCCCACAGGAGGCTGGGGCTGTGGCCTG
GAGAGGCTCGTGATGCTCTTTTCTGGTGCAAATCGCATTAGTGACTGCCTGAGCTTTGGTTCGCTGCGCAATGTT
GTGGGCTTGGCTGCTGATGCAAAGGCTGGTGGCAAGGCGCGGGCGGCCAAGACGACTGAGGAGAATGACGCGTCG
ACGTCGCAAGGTGAATCTCGAGGCTGA
Gene >OphauB2|4395
ATGTCAAAGCCAGAAATCACTTCGTTGTTTGACCACAACAAGCGCCAAATGGCTCAAGACGTTTAGAGATGAAGG
CGACAACAATACTAGAAAGGAATCCCGCTTCAAAGAAGAAAGAAGAATTTTCTTGCAGCATGAGCAGCAACAAGA
GGAGCCGCTTGTTTCAGAACCATATCCTCGGCTGGAATCCGATGACGCCCGGGAAAGTGTTCCCGAGTTTCTCCA
ACAGTATGAGGAGCATCTCGCCACGGAGAACCTCGTTACCCTGTGTGGCCGTGTCAGGAATAAACGCGTCTTTGG
GAAAGGTCTCATGTTCCTCGACATTGCCAATGAGTTTCAGCGCGTCCAAGTCATGCTCAACAGGCACAAGTGTTT
CTCAGGCAAGGTGTTGCGGACTGAGAGATTTGAGCTGTACAAGAATCTGGTACAAATTGGCGATCACATATGTAG
GAAGGCCTGGTTGTTTGTCGTTTTGTTGCGTCTTGAATATATTTGCTGACGGCTCGTGAAAGCTGTCACTGGCGT
GGCCACACGTACCAGCAGCGGCGAGCCAACCCTCGAAGCCTCGGATCTGCCGCGCCTCTTGTCACCAACCATGGA
GCAGCTTCCAGCCAAGCTGGTCAATGAGACGACACGCATGCATGACCGCCATGTCGACATGCTTGTGAATCGAGA
GGTGCTGGACGTTTTGAGACTAAAGGGCGAAATCACCAAGCACATGCGCAGGCACTTTGAGTCGAAACGCTTCCT
CGAGTTTCAGACTCCCATCCTGGCTGAAGACGCAAGCGGCGCCTCTGCGCGTGCCTTTGTCACCGAGTCGGTCGA
GTTGCGAAACAAATTTTTGTCTCTTCGCATCGCGCCCGAGCTGTGGCTCAAGCGGCTCGTGGTGGGCGGCGTTGA
CCGCGTCTTTGAAATTGGCCCAGCCTTTCGCAACGAGGGCCTTGATGCCACGCATAACCCCGAGTTTACCATGTG
CGAGTTTTATAGCGCCTATACTAACTTGACTGATCTCATCAAGGAGACGGAGGAACTCATTTGTAGCCTAGCCAA
GCACTGCCAGGAATGCATTTCGACACAGCTTACATCCTTGCCTCAAGTAGACCTGAGTCGCTTTGCCCGGCCCTT
TAAGCAAGTCGAGTTTGTGCCTGCCTTGGAAAAGGCCATCGGGGTTCGTCTGCCCAAGCTGACAACAGAAACGGC
CCTTGCCGAGGTGATTGCCACTTTGAAGCTCGGTGGCATTGATGTTCCCGGTGAGGTCCCGTCTACTCTTGTCAG
GCTGCTGGACCGACTAGCGACGCTTTATCTCGAACCCATGTCCATGACGGAGCCCATGTTTCTCATGAACCATCC
GGCTTGCATGTCGCCCCTGGCCAAGTCGTTTCTTTGTCCCAAAACTTATCAACTAGTGTCGGCCCGTGCCGAGTT
TTACTGTGGTGGCAGAGAACTGGCCAACATGTATGAGGAGGAAAACAACCCTCGGGAGCAGAAACGCAAGTTGAA
ATATCATCGCCTCTTGGTCAACAAGGCAGACGGCCAACCCGGCTTTGACCCAGACGAGCGGACAAAAAGCCGCCA
GAGGGGTGGTAAAGGGATAGAAGCCCAAGACCAAGATCCAGTTGTAGAGCGTGACTGGGCGAAGAAGAAGCTCGA
CGAAAGCTATGTCAGAGCCCTCGATCACGGACTACCCCCCACAGGAGGCTGGGGCTGTGGCCTGGAGAGGCTCGT
GATGCTCTTTTCTGGTGCAAATCGCATTAGTGACTGCCTGAGCTTTGGTTCGCTGCGCAATGTTGTGGGCTTGGC
TGCTGATGCAAAGGCTGGTGGCAAGGCGCGGGCGGCCAAGACGACTGAGGAGAATGACGCGTCGACGTCGCAAGG
TGAATCTCGAGGCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail