Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|4393
Gene name
LocationContig_3:42042..42963
Strand+
Gene length (bp)921
Transcript length (bp)921
Coding sequence length (bp)921
Protein length (aa) 307

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03167 UDG Uracil DNA glycosylase superfamily 5.2E-21 111 284

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O59825|TDG_SCHPO G/U mismatch-specific uracil DNA glycosylase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=thp1 PE=3 SV=1 2 292 8.0E-38
sp|A8A4M5|MUG_ECOHS G/U mismatch-specific DNA glycosylase OS=Escherichia coli O9:H4 (strain HS) GN=mug PE=3 SV=1 108 221 4.0E-21
sp|Q13569|TDG_HUMAN G/T mismatch-specific thymine DNA glycosylase OS=Homo sapiens GN=TDG PE=1 SV=2 38 234 4.0E-21
sp|P56581|TDG_MOUSE G/T mismatch-specific thymine DNA glycosylase OS=Mus musculus GN=Tdg PE=1 SV=2 109 234 7.0E-21
sp|Q0TD38|MUG_ECOL5 G/U mismatch-specific DNA glycosylase OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=mug PE=3 SV=1 108 221 1.0E-20
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O59825|TDG_SCHPO G/U mismatch-specific uracil DNA glycosylase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=thp1 PE=3 SV=1 2 292 8.0E-38
sp|A8A4M5|MUG_ECOHS G/U mismatch-specific DNA glycosylase OS=Escherichia coli O9:H4 (strain HS) GN=mug PE=3 SV=1 108 221 4.0E-21
sp|Q13569|TDG_HUMAN G/T mismatch-specific thymine DNA glycosylase OS=Homo sapiens GN=TDG PE=1 SV=2 38 234 4.0E-21
sp|P56581|TDG_MOUSE G/T mismatch-specific thymine DNA glycosylase OS=Mus musculus GN=Tdg PE=1 SV=2 109 234 7.0E-21
sp|Q0TD38|MUG_ECOL5 G/U mismatch-specific DNA glycosylase OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=mug PE=3 SV=1 108 221 1.0E-20
sp|A7ZRV0|MUG_ECO24 G/U mismatch-specific DNA glycosylase OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=mug PE=3 SV=1 108 221 1.0E-20
sp|B1LF61|MUG_ECOSM G/U mismatch-specific DNA glycosylase OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=mug PE=3 SV=1 108 221 1.0E-20
sp|B7MB04|MUG_ECO45 G/U mismatch-specific DNA glycosylase OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=mug PE=3 SV=1 108 221 1.0E-20
sp|B7LH04|MUG_ECO55 G/U mismatch-specific DNA glycosylase OS=Escherichia coli (strain 55989 / EAEC) GN=mug PE=3 SV=1 108 221 1.0E-20
sp|B7NJT2|MUG_ECO7I G/U mismatch-specific DNA glycosylase OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=mug PE=3 SV=1 108 221 1.0E-20
sp|B7N0L8|MUG_ECO81 G/U mismatch-specific DNA glycosylase OS=Escherichia coli O81 (strain ED1a) GN=mug PE=3 SV=1 108 221 1.0E-20
sp|B7LZL8|MUG_ECO8A G/U mismatch-specific DNA glycosylase OS=Escherichia coli O8 (strain IAI1) GN=mug PE=3 SV=1 108 221 1.0E-20
sp|C4ZQY5|MUG_ECOBW G/U mismatch-specific DNA glycosylase OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=mug PE=3 SV=1 108 221 1.0E-20
sp|B1XG73|MUG_ECODH G/U mismatch-specific DNA glycosylase OS=Escherichia coli (strain K12 / DH10B) GN=mug PE=3 SV=1 108 221 1.0E-20
sp|A1AFY9|MUG_ECOK1 G/U mismatch-specific DNA glycosylase OS=Escherichia coli O1:K1 / APEC GN=mug PE=3 SV=1 108 221 1.0E-20
sp|P0A9H2|MUG_ECOL6 G/U mismatch-specific DNA glycosylase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=mug PE=3 SV=1 108 221 1.0E-20
sp|B1IRP8|MUG_ECOLC G/U mismatch-specific DNA glycosylase OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=mug PE=3 SV=1 108 221 1.0E-20
sp|P0A9H1|MUG_ECOLI G/U mismatch-specific DNA glycosylase OS=Escherichia coli (strain K12) GN=mug PE=1 SV=1 108 221 1.0E-20
sp|B7ND57|MUG_ECOLU G/U mismatch-specific DNA glycosylase OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=mug PE=3 SV=1 108 221 1.0E-20
sp|B6I441|MUG_ECOSE G/U mismatch-specific DNA glycosylase OS=Escherichia coli (strain SE11) GN=mug PE=3 SV=1 108 221 1.0E-20
sp|Q1R6R1|MUG_ECOUT G/U mismatch-specific DNA glycosylase OS=Escherichia coli (strain UTI89 / UPEC) GN=mug PE=3 SV=1 108 221 1.0E-20
sp|B2U1S3|MUG_SHIB3 G/U mismatch-specific DNA glycosylase OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=mug PE=3 SV=1 108 221 1.0E-20
sp|Q31WW5|MUG_SHIBS G/U mismatch-specific DNA glycosylase OS=Shigella boydii serotype 4 (strain Sb227) GN=mug PE=3 SV=1 108 221 1.0E-20
sp|Q0T0J4|MUG_SHIF8 G/U mismatch-specific DNA glycosylase OS=Shigella flexneri serotype 5b (strain 8401) GN=mug PE=3 SV=1 108 221 1.0E-20
sp|Q3YXH4|MUG_SHISS G/U mismatch-specific DNA glycosylase OS=Shigella sonnei (strain Ss046) GN=mug PE=3 SV=1 108 221 1.0E-20
sp|Q32BP9|MUG_SHIDS G/U mismatch-specific DNA glycosylase OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=mug PE=3 SV=1 108 221 2.0E-20
sp|B5YRA8|MUG_ECO5E G/U mismatch-specific DNA glycosylase OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=mug PE=3 SV=1 108 221 5.0E-20
sp|Q8XAN4|MUG_ECO57 G/U mismatch-specific DNA glycosylase OS=Escherichia coli O157:H7 GN=mug PE=3 SV=1 108 221 5.0E-20
sp|C6DKG5|MUG_PECCP G/U mismatch-specific DNA glycosylase OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=mug PE=3 SV=1 108 217 4.0E-19
sp|Q6D9D7|MUG_PECAS G/U mismatch-specific DNA glycosylase OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=mug PE=3 SV=1 108 217 7.0E-19
sp|B7LQE3|MUG_ESCF3 G/U mismatch-specific DNA glycosylase OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=mug PE=3 SV=1 108 221 2.0E-18
sp|P43343|MUG_SERMA G/U mismatch-specific DNA glycosylase OS=Serratia marcescens GN=mug PE=3 SV=1 111 228 2.0E-18
sp|A8GJV5|MUG_SERP5 G/U mismatch-specific DNA glycosylase OS=Serratia proteamaculans (strain 568) GN=mug PE=3 SV=1 111 228 1.0E-17
sp|A6TE50|MUG_KLEP7 G/U mismatch-specific DNA glycosylase OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=mug PE=3 SV=1 108 227 2.0E-17
sp|B5XU18|MUG_KLEP3 G/U mismatch-specific DNA glycosylase OS=Klebsiella pneumoniae (strain 342) GN=mug PE=3 SV=1 108 227 2.0E-17
sp|A4WEK3|MUG_ENT38 G/U mismatch-specific DNA glycosylase OS=Enterobacter sp. (strain 638) GN=mug PE=3 SV=1 108 227 4.0E-17
sp|B4TVU6|MUG_SALSV G/U mismatch-specific DNA glycosylase OS=Salmonella schwarzengrund (strain CVM19633) GN=mug PE=3 SV=1 108 221 5.0E-17
sp|B5F6A8|MUG_SALA4 G/U mismatch-specific DNA glycosylase OS=Salmonella agona (strain SL483) GN=mug PE=3 SV=1 108 221 5.0E-17
sp|A9MPV1|MUG_SALAR G/U mismatch-specific DNA glycosylase OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=mug PE=3 SV=1 108 221 5.0E-17
sp|B5QZ48|MUG_SALEP G/U mismatch-specific DNA glycosylase OS=Salmonella enteritidis PT4 (strain P125109) GN=mug PE=3 SV=1 108 221 5.0E-17
sp|B5REH0|MUG_SALG2 G/U mismatch-specific DNA glycosylase OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=mug PE=3 SV=1 108 221 5.0E-17
sp|B4TI63|MUG_SALHS G/U mismatch-specific DNA glycosylase OS=Salmonella heidelberg (strain SL476) GN=mug PE=3 SV=1 108 221 5.0E-17
sp|B4T682|MUG_SALNS G/U mismatch-specific DNA glycosylase OS=Salmonella newport (strain SL254) GN=mug PE=3 SV=1 108 221 5.0E-17
sp|Q5PKX5|MUG_SALPA G/U mismatch-specific DNA glycosylase OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=mug PE=3 SV=1 108 221 5.0E-17
sp|C0PYY5|MUG_SALPC G/U mismatch-specific DNA glycosylase OS=Salmonella paratyphi C (strain RKS4594) GN=mug PE=3 SV=1 108 221 5.0E-17
sp|B5BG24|MUG_SALPK G/U mismatch-specific DNA glycosylase OS=Salmonella paratyphi A (strain AKU_12601) GN=mug PE=3 SV=1 108 221 5.0E-17
sp|Q8XFG2|MUG_SALTI G/U mismatch-specific DNA glycosylase OS=Salmonella typhi GN=mug PE=3 SV=1 108 221 5.0E-17
sp|Q7CPR7|MUG_SALTY G/U mismatch-specific DNA glycosylase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=mug PE=3 SV=1 108 221 5.0E-17
sp|B5FHU7|MUG_SALDC G/U mismatch-specific DNA glycosylase OS=Salmonella dublin (strain CT_02021853) GN=mug PE=3 SV=1 108 221 5.0E-17
sp|A9N5Z1|MUG_SALPB G/U mismatch-specific DNA glycosylase OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=mug PE=3 SV=1 108 221 5.0E-17
sp|A7MJU3|MUG_CROS8 G/U mismatch-specific DNA glycosylase OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=mug PE=3 SV=1 108 227 2.0E-16
sp|A8APW0|MUG_CITK8 G/U mismatch-specific DNA glycosylase OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=mug PE=3 SV=1 108 221 5.0E-16
sp|Q57JP7|MUG_SALCH G/U mismatch-specific DNA glycosylase OS=Salmonella choleraesuis (strain SC-B67) GN=mug PE=3 SV=1 108 221 7.0E-16
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 23 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|4393
MEAQTPTFSGRLALDEFRYGKATETSVLRRSPRHKLSQPTRSLPKSSPKRKRTSSSQASARPEAIRPEPSARLDE
ANQEANGQTAPRKKKLRSAGGYAPPSTYAHLPLLPDALAPNLLVLFVGLNPGIQTARSGHAYAHPSNLFWKLLFS
SGITPRLCQPHEDRDMPALYALGHTNIVARPSRSGAELSRQELDNGVGVLEDKIRACRPRVVCIVGKGIWESIWR
VRHGRPVGNSFCYGWQDDGDNMGTIDGQWPGARVFVATSTSGLAASLSPAEKQAIWSQLGSWVKARRAEGMKQEA
HQEGSD*
Coding >OphauB2|4393
ATGGAAGCCCAGACGCCTACCTTTAGCGGTCGTCTTGCGCTTGATGAGTTTAGATATGGCAAGGCTACAGAGACT
TCAGTGCTGCGGCGTAGCCCGCGACACAAGTTGAGCCAGCCAACTAGGTCACTGCCCAAGAGCTCTCCCAAGCGC
AAACGGACCTCTTCAAGTCAGGCGTCGGCACGTCCCGAAGCCATCAGGCCAGAGCCTAGCGCGCGGCTAGATGAA
GCAAACCAAGAAGCAAATGGCCAGACAGCCCCGAGGAAGAAGAAGCTACGTTCAGCTGGCGGCTATGCGCCTCCC
TCAACCTATGCCCATCTCCCCTTGCTGCCCGACGCTCTGGCCCCCAACCTGCTTGTTCTCTTTGTCGGCCTGAAT
CCAGGCATTCAGACAGCGCGCTCCGGCCATGCCTATGCTCACCCGTCAAACCTCTTTTGGAAGCTGCTCTTTTCT
AGCGGCATTACGCCTCGCCTCTGTCAGCCGCACGAGGATCGTGATATGCCCGCCCTGTATGCCCTTGGCCATACA
AACATTGTTGCTCGTCCCTCACGCTCCGGGGCTGAGCTGAGTCGGCAAGAGCTCGACAATGGCGTTGGCGTGCTC
GAGGACAAGATACGAGCCTGTCGCCCTCGAGTGGTTTGCATCGTGGGCAAGGGCATATGGGAGAGTATCTGGCGA
GTGCGCCACGGCCGGCCTGTTGGCAATAGCTTTTGCTACGGCTGGCAAGACGACGGTGACAACATGGGCACTATA
GATGGCCAGTGGCCTGGAGCCCGTGTCTTTGTTGCTACCAGCACCAGTGGTCTCGCCGCCTCGCTGTCTCCAGCC
GAGAAGCAGGCCATCTGGTCACAGCTTGGCTCTTGGGTCAAGGCCAGACGGGCCGAAGGAATGAAGCAAGAGGCA
CATCAAGAGGGGTCTGACTAG
Transcript >OphauB2|4393
ATGGAAGCCCAGACGCCTACCTTTAGCGGTCGTCTTGCGCTTGATGAGTTTAGATATGGCAAGGCTACAGAGACT
TCAGTGCTGCGGCGTAGCCCGCGACACAAGTTGAGCCAGCCAACTAGGTCACTGCCCAAGAGCTCTCCCAAGCGC
AAACGGACCTCTTCAAGTCAGGCGTCGGCACGTCCCGAAGCCATCAGGCCAGAGCCTAGCGCGCGGCTAGATGAA
GCAAACCAAGAAGCAAATGGCCAGACAGCCCCGAGGAAGAAGAAGCTACGTTCAGCTGGCGGCTATGCGCCTCCC
TCAACCTATGCCCATCTCCCCTTGCTGCCCGACGCTCTGGCCCCCAACCTGCTTGTTCTCTTTGTCGGCCTGAAT
CCAGGCATTCAGACAGCGCGCTCCGGCCATGCCTATGCTCACCCGTCAAACCTCTTTTGGAAGCTGCTCTTTTCT
AGCGGCATTACGCCTCGCCTCTGTCAGCCGCACGAGGATCGTGATATGCCCGCCCTGTATGCCCTTGGCCATACA
AACATTGTTGCTCGTCCCTCACGCTCCGGGGCTGAGCTGAGTCGGCAAGAGCTCGACAATGGCGTTGGCGTGCTC
GAGGACAAGATACGAGCCTGTCGCCCTCGAGTGGTTTGCATCGTGGGCAAGGGCATATGGGAGAGTATCTGGCGA
GTGCGCCACGGCCGGCCTGTTGGCAATAGCTTTTGCTACGGCTGGCAAGACGACGGTGACAACATGGGCACTATA
GATGGCCAGTGGCCTGGAGCCCGTGTCTTTGTTGCTACCAGCACCAGTGGTCTCGCCGCCTCGCTGTCTCCAGCC
GAGAAGCAGGCCATCTGGTCACAGCTTGGCTCTTGGGTCAAGGCCAGACGGGCCGAAGGAATGAAGCAAGAGGCA
CATCAAGAGGGGTCTGACTAG
Gene >OphauB2|4393
ATGGAAGCCCAGACGCCTACCTTTAGCGGTCGTCTTGCGCTTGATGAGTTTAGATATGGCAAGGCTACAGAGACT
TCAGTGCTGCGGCGTAGCCCGCGACACAAGTTGAGCCAGCCAACTAGGTCACTGCCCAAGAGCTCTCCCAAGCGC
AAACGGACCTCTTCAAGTCAGGCGTCGGCACGTCCCGAAGCCATCAGGCCAGAGCCTAGCGCGCGGCTAGATGAA
GCAAACCAAGAAGCAAATGGCCAGACAGCCCCGAGGAAGAAGAAGCTACGTTCAGCTGGCGGCTATGCGCCTCCC
TCAACCTATGCCCATCTCCCCTTGCTGCCCGACGCTCTGGCCCCCAACCTGCTTGTTCTCTTTGTCGGCCTGAAT
CCAGGCATTCAGACAGCGCGCTCCGGCCATGCCTATGCTCACCCGTCAAACCTCTTTTGGAAGCTGCTCTTTTCT
AGCGGCATTACGCCTCGCCTCTGTCAGCCGCACGAGGATCGTGATATGCCCGCCCTGTATGCCCTTGGCCATACA
AACATTGTTGCTCGTCCCTCACGCTCCGGGGCTGAGCTGAGTCGGCAAGAGCTCGACAATGGCGTTGGCGTGCTC
GAGGACAAGATACGAGCCTGTCGCCCTCGAGTGGTTTGCATCGTGGGCAAGGGCATATGGGAGAGTATCTGGCGA
GTGCGCCACGGCCGGCCTGTTGGCAATAGCTTTTGCTACGGCTGGCAAGACGACGGTGACAACATGGGCACTATA
GATGGCCAGTGGCCTGGAGCCCGTGTCTTTGTTGCTACCAGCACCAGTGGTCTCGCCGCCTCGCTGTCTCCAGCC
GAGAAGCAGGCCATCTGGTCACAGCTTGGCTCTTGGGTCAAGGCCAGACGGGCCGAAGGAATGAAGCAAGAGGCA
CATCAAGAGGGGTCTGACTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail