Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|4391
Gene name
LocationContig_3:37751..39308
Strand+
Gene length (bp)1557
Transcript length (bp)1125
Coding sequence length (bp)1125
Protein length (aa) 375

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07992 Pyr_redox_2 Pyridine nucleotide-disulphide oxidoreductase 3.5E-43 55 349
PF00070 Pyr_redox Pyridine nucleotide-disulphide oxidoreductase 9.6E-15 205 279
PF13738 Pyr_redox_3 Pyridine nucleotide-disulphide oxidoreductase 9.8E-15 116 336

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P51978|TRXB_NEUCR Thioredoxin reductase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=cys-9 PE=3 SV=1 52 374 0.0E+00
sp|P43496|TRXB_PENCH Thioredoxin reductase OS=Penicillium chrysogenum GN=TRR1 PE=1 SV=3 52 374 2.0E-166
sp|Q6C7L4|TRXB_YARLI Thioredoxin reductase OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=TRR1 PE=3 SV=1 53 368 1.0E-157
sp|Q75CM8|TRXB_ASHGO Thioredoxin reductase OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=TRR1 PE=3 SV=2 52 368 2.0E-147
sp|P29509|TRXB1_YEAST Thioredoxin reductase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TRR1 PE=1 SV=3 52 368 1.0E-146
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P51978|TRXB_NEUCR Thioredoxin reductase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=cys-9 PE=3 SV=1 52 374 0.0E+00
sp|P43496|TRXB_PENCH Thioredoxin reductase OS=Penicillium chrysogenum GN=TRR1 PE=1 SV=3 52 374 2.0E-166
sp|Q6C7L4|TRXB_YARLI Thioredoxin reductase OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=TRR1 PE=3 SV=1 53 368 1.0E-157
sp|Q75CM8|TRXB_ASHGO Thioredoxin reductase OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=TRR1 PE=3 SV=2 52 368 2.0E-147
sp|P29509|TRXB1_YEAST Thioredoxin reductase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TRR1 PE=1 SV=3 52 368 1.0E-146
sp|P38816|TRXB2_YEAST Thioredoxin reductase 2, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TRR2 PE=1 SV=1 49 368 3.0E-146
sp|Q6HA24|TRXB_KLULA Thioredoxin reductase, mitochondrial OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=TRR1 PE=3 SV=1 50 368 4.0E-146
sp|Q6FR39|TRXB_CANGA Thioredoxin reductase OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=TRR1 PE=3 SV=1 53 368 4.0E-145
sp|Q6BIS1|TRXB_DEBHA Thioredoxin reductase OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=TRR1 PE=3 SV=1 52 368 5.0E-145
sp|Q92375|TRXB_SCHPO Thioredoxin reductase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=trr1 PE=1 SV=1 53 368 8.0E-144
sp|Q7Z7S3|TRXB_PNECA Thioredoxin reductase OS=Pneumocystis carinii GN=TRR1 PE=2 SV=1 52 356 1.0E-140
sp|Q8J0U0|TRXB_PNEJI Thioredoxin reductase OS=Pneumocystis jiroveci GN=TRR1 PE=2 SV=1 52 356 4.0E-138
sp|Q39242|TRXB2_ARATH Thioredoxin reductase 2 OS=Arabidopsis thaliana GN=NTR2 PE=2 SV=2 55 373 1.0E-129
sp|Q54UU8|TRXB_DICDI Thioredoxin reductase OS=Dictyostelium discoideum GN=trrA PE=3 SV=1 55 365 2.0E-129
sp|Q6ZFU6|NTRB_ORYSJ Thioredoxin reductase NTRB OS=Oryza sativa subsp. japonica GN=NTRB PE=2 SV=1 52 366 2.0E-124
sp|Q39243|TRXB1_ARATH Thioredoxin reductase 1 OS=Arabidopsis thaliana GN=NTR1 PE=1 SV=3 27 366 3.0E-121
sp|Q69PS6|NTRA_ORYSJ Thioredoxin reductase NTRA OS=Oryza sativa subsp. japonica GN=Os06g0327300 PE=3 SV=2 47 373 8.0E-121
sp|O84101|TRXB_CHLTR Thioredoxin reductase OS=Chlamydia trachomatis (strain D/UW-3/Cx) GN=trxB PE=3 SV=2 53 366 3.0E-117
sp|Q9PKT7|TRXB_CHLMU Thioredoxin reductase OS=Chlamydia muridarum (strain MoPn / Nigg) GN=trxB PE=3 SV=1 53 364 1.0E-116
sp|Q9Z8M4|TRXB_CHLPN Thioredoxin reductase OS=Chlamydia pneumoniae GN=trxB PE=3 SV=1 52 364 2.0E-113
sp|Q70G58|NTRC_ORYSJ Thioredoxin reductase NTRC OS=Oryza sativa subsp. japonica GN=Os07g0657900 PE=1 SV=2 45 369 4.0E-111
sp|O22229|TRXB3_ARATH NADPH-dependent thioredoxin reductase 3 OS=Arabidopsis thaliana GN=NTRC PE=1 SV=2 54 369 6.0E-109
sp|Q1RJD8|TRXB_RICBR Thioredoxin reductase OS=Rickettsia bellii (strain RML369-C) GN=trxB PE=3 SV=1 51 364 4.0E-102
sp|P52215|TRXB_STRCO Thioredoxin reductase OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=trxB PE=2 SV=3 56 365 2.0E-96
sp|Q05741|TRXB_STRC2 Thioredoxin reductase OS=Streptomyces clavuligerus (strain ATCC 27064 / DSM 738 / JCM 4710 / NBRC 13307 / NCIMB 12785 / NRRL 3585 / VKM Ac-602) GN=trxB PE=1 SV=3 55 365 1.0E-95
sp|Q92I02|TRXB_RICCN Thioredoxin reductase OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) GN=trxB PE=3 SV=1 51 364 2.0E-95
sp|O30973|TRXB_MYCSM Thioredoxin reductase OS=Mycobacterium smegmatis GN=trxB PE=3 SV=1 52 368 2.0E-94
sp|Q4ULP1|TRXB_RICFE Thioredoxin reductase OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=trxB PE=3 SV=1 51 364 4.0E-94
sp|Q9ZD97|TRXB_RICPR Thioredoxin reductase OS=Rickettsia prowazekii (strain Madrid E) GN=trxB PE=3 SV=1 51 364 1.0E-91
sp|Q68WT3|TRXB_RICTY Thioredoxin reductase OS=Rickettsia typhi (strain ATCC VR-144 / Wilmington) GN=trxB PE=3 SV=1 51 364 4.0E-91
sp|P9WHH1|TRXB_MYCTU Thioredoxin reductase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=trxB PE=1 SV=1 45 367 9.0E-89
sp|P9WHH0|TRXB_MYCTO Thioredoxin reductase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=trxB PE=3 SV=1 45 367 9.0E-89
sp|P43788|TRXB_HAEIN Thioredoxin reductase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=trxB PE=3 SV=1 53 368 3.0E-87
sp|Q9KSS4|TRXB_VIBCH Thioredoxin reductase OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=trxB PE=3 SV=1 53 364 3.0E-87
sp|P39916|TRXB_COXBU Thioredoxin reductase OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=trxB PE=3 SV=2 53 364 5.0E-87
sp|P0A9P4|TRXB_ECOLI Thioredoxin reductase OS=Escherichia coli (strain K12) GN=trxB PE=1 SV=2 53 364 1.0E-85
sp|P0A9P5|TRXB_ECO57 Thioredoxin reductase OS=Escherichia coli O157:H7 GN=trxB PE=3 SV=2 53 364 1.0E-85
sp|P46843|TRXB_MYCLE Bifunctional thioredoxin reductase/thioredoxin OS=Mycobacterium leprae (strain TN) GN=trxB/A PE=3 SV=1 46 367 2.0E-85
sp|Q93HX6|GLCAL_PSEFL Glucosaminate ammonia-lyase OS=Pseudomonas fluorescens PE=1 SV=2 53 364 5.0E-84
sp|Q8T6Z1|TRXB_SPIBA Thioredoxin reductase (Fragment) OS=Spironucleus barkhanus GN=TRXB PE=2 SV=1 56 367 5.0E-80
sp|P81433|TRXB_BUCAP Thioredoxin reductase OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=trxB PE=3 SV=1 51 364 4.0E-77
sp|Q89AJ2|TRXB_BUCBP Thioredoxin reductase OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=trxB PE=3 SV=1 53 364 5.0E-75
sp|P57399|TRXB_BUCAI Thioredoxin reductase OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=trxB PE=3 SV=1 53 364 6.0E-71
sp|O32823|TRXB_LISMO Thioredoxin reductase OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=trxB PE=3 SV=1 47 364 6.0E-64
sp|Q928B5|TRXB_LISIN Thioredoxin reductase OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=trxB PE=3 SV=1 47 364 1.0E-63
sp|P94284|TRXB_BORBU Thioredoxin reductase OS=Borrelia burgdorferi (strain ATCC 35210 / B31 / CIP 102532 / DSM 4680) GN=trxB PE=3 SV=2 54 364 2.0E-62
sp|P66011|TRXB_STAAW Thioredoxin reductase OS=Staphylococcus aureus (strain MW2) GN=trxB PE=1 SV=1 56 364 1.0E-60
sp|Q6GB66|TRXB_STAAS Thioredoxin reductase OS=Staphylococcus aureus (strain MSSA476) GN=trxB PE=3 SV=1 56 364 1.0E-60
sp|P99101|TRXB_STAAN Thioredoxin reductase OS=Staphylococcus aureus (strain N315) GN=trxB PE=1 SV=1 56 364 1.0E-60
sp|P66010|TRXB_STAAM Thioredoxin reductase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=trxB PE=3 SV=1 56 364 1.0E-60
sp|Q5HHQ4|TRXB_STAAC Thioredoxin reductase OS=Staphylococcus aureus (strain COL) GN=trxB PE=3 SV=1 56 364 1.0E-60
sp|Q6GIM7|TRXB_STAAR Thioredoxin reductase OS=Staphylococcus aureus (strain MRSA252) GN=trxB PE=3 SV=1 56 364 6.0E-60
sp|Q8CPY8|TRXB_STAES Thioredoxin reductase OS=Staphylococcus epidermidis (strain ATCC 12228) GN=trxB PE=3 SV=1 56 366 4.0E-58
sp|Q5HQW4|TRXB_STAEQ Thioredoxin reductase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=trxB PE=3 SV=1 56 366 4.0E-58
sp|P80880|TRXB_BACSU Thioredoxin reductase OS=Bacillus subtilis (strain 168) GN=trxB PE=1 SV=3 50 366 1.0E-56
sp|P23160|R34K_CLOPA 34.2 kDa protein in rubredoxin operon OS=Clostridium pasteurianum PE=3 SV=1 56 364 1.0E-54
sp|P52213|TRXB_CLOLI Thioredoxin reductase OS=Clostridium litorale GN=trxB PE=3 SV=1 56 366 4.0E-54
sp|O83790|TRXB_TREPA Thioredoxin reductase OS=Treponema pallidum (strain Nichols) GN=trxB PE=3 SV=1 56 353 9.0E-54
sp|P50971|TRXB_EUBAC Thioredoxin reductase OS=Eubacterium acidaminophilum GN=trxB PE=1 SV=1 58 364 8.0E-52
sp|Q58931|TRXB_METJA Putative thioredoxin reductase OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ1536 PE=3 SV=1 52 364 1.0E-45
sp|Q9ZL18|TRXB_HELPJ Thioredoxin reductase OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=trxB PE=3 SV=1 58 367 3.0E-45
sp|P56431|TRXB_HELPY Thioredoxin reductase OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=trxB PE=1 SV=1 58 367 2.0E-44
sp|O66790|TRXB_AQUAE Thioredoxin reductase OS=Aquifex aeolicus (strain VF5) GN=trxB PE=3 SV=1 51 365 9.0E-44
sp|Q98PK9|TRXB_MYCPU Thioredoxin reductase OS=Mycoplasma pulmonis (strain UAB CTIP) GN=trxB PE=3 SV=1 51 356 2.0E-37
sp|Q8CMQ1|AHPF_STAES Alkyl hydroperoxide reductase subunit F OS=Staphylococcus epidermidis (strain ATCC 12228) GN=ahpF PE=3 SV=1 49 349 2.0E-34
sp|Q5HRY2|AHPF_STAEQ Alkyl hydroperoxide reductase subunit F OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=ahpF PE=3 SV=1 49 349 2.0E-34
sp|Q9PR71|TRXB_UREPA Thioredoxin reductase OS=Ureaplasma parvum serovar 3 (strain ATCC 700970) GN=trxB PE=3 SV=1 50 364 2.0E-34
sp|Q6GC92|AHPF_STAAS Alkyl hydroperoxide reductase subunit F OS=Staphylococcus aureus (strain MSSA476) GN=ahpF PE=3 SV=1 56 349 3.0E-33
sp|P66013|AHPF_STAAW Alkyl hydroperoxide reductase subunit F OS=Staphylococcus aureus (strain MW2) GN=ahpF PE=3 SV=1 56 349 4.0E-33
sp|P99118|AHPF_STAAN Alkyl hydroperoxide reductase subunit F OS=Staphylococcus aureus (strain N315) GN=ahpF PE=1 SV=1 56 349 4.0E-33
sp|P66012|AHPF_STAAM Alkyl hydroperoxide reductase subunit F OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=ahpF PE=3 SV=1 56 349 4.0E-33
sp|Q5HIR6|AHPF_STAAC Alkyl hydroperoxide reductase subunit F OS=Staphylococcus aureus (strain COL) GN=ahpF PE=3 SV=1 56 349 1.0E-32
sp|O05204|AHPF_STAA8 Alkyl hydroperoxide reductase subunit F OS=Staphylococcus aureus (strain NCTC 8325) GN=ahpF PE=3 SV=1 56 349 1.0E-32
sp|Q6GJR8|AHPF_STAAR Alkyl hydroperoxide reductase subunit F OS=Staphylococcus aureus (strain MRSA252) GN=ahpF PE=3 SV=1 56 349 2.0E-32
sp|P26829|DHNA_BACYN NADH dehydrogenase OS=Bacillus sp. (strain YN-1) GN=ahpF PE=1 SV=1 49 364 2.0E-30
sp|P35340|AHPF_ECOLI Alkyl hydroperoxide reductase subunit F OS=Escherichia coli (strain K12) GN=ahpF PE=1 SV=2 34 364 3.0E-30
sp|P47348|TRXB_MYCGE Thioredoxin reductase OS=Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195) GN=trxB PE=3 SV=1 56 358 7.0E-30
sp|P19480|AHPF_SALTY Alkyl hydroperoxide reductase subunit F OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=ahpF PE=1 SV=1 34 369 1.0E-29
sp|P42974|DHNA_BACSU NADH dehydrogenase OS=Bacillus subtilis (strain 168) GN=ahpF PE=1 SV=2 56 364 5.0E-28
sp|Q9I6Z2|AHPF_PSEAE Alkyl hydroperoxide reductase subunit F OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=ahpF PE=3 SV=1 93 360 1.0E-27
sp|P75531|TRXB_MYCPN Thioredoxin reductase OS=Mycoplasma pneumoniae (strain ATCC 29342 / M129) GN=trxB PE=3 SV=1 56 358 2.0E-26
sp|O06465|AHPF_XANCH Alkyl hydroperoxide reductase subunit F OS=Xanthomonas campestris pv. phaseoli GN=ahpF PE=3 SV=1 93 360 9.0E-26
sp|P0A156|AHPF_PSEPU Alkyl hydroperoxide reductase subunit F OS=Pseudomonas putida GN=ahpF PE=3 SV=1 161 360 3.0E-23
sp|P0A155|AHPF_PSEPK Alkyl hydroperoxide reductase subunit F OS=Pseudomonas putida (strain KT2440) GN=ahpF PE=3 SV=1 161 360 3.0E-23
sp|B2IHR5|FENR_BEII9 Ferredoxin--NADP reductase OS=Beijerinckia indica subsp. indica (strain ATCC 9039 / DSM 1715 / NCIB 8712) GN=Bind_2345 PE=3 SV=1 56 364 7.0E-18
sp|A4ISE6|FENR_GEOTN Ferredoxin--NADP reductase OS=Geobacillus thermodenitrificans (strain NG80-2) GN=GTNG_2905 PE=3 SV=1 50 338 3.0E-16
sp|O05268|FENR2_BACSU Ferredoxin--NADP reductase 2 OS=Bacillus subtilis (strain 168) GN=yumC PE=1 SV=2 51 353 6.0E-16
sp|Q5WDV1|FENR2_BACSK Ferredoxin--NADP reductase 2 OS=Bacillus clausii (strain KSM-K16) GN=ABC2925 PE=3 SV=1 50 364 9.0E-16
sp|Q6L1Y6|FENR_PICTO Ferredoxin--NADP reductase OS=Picrophilus torridus (strain ATCC 700027 / DSM 9790 / JCM 10055 / NBRC 100828) GN=PTO0431 PE=3 SV=1 56 338 2.0E-15
sp|Q8DYW9|FENR_STRA5 Ferredoxin--NADP reductase OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=SAG1353 PE=3 SV=1 56 353 2.0E-15
sp|Q8E4H8|FENR_STRA3 Ferredoxin--NADP reductase OS=Streptococcus agalactiae serotype III (strain NEM316) GN=gbs1423 PE=3 SV=1 56 353 2.0E-15
sp|Q3K0F9|FENR_STRA1 Ferredoxin--NADP reductase OS=Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700) GN=SAK_1384 PE=3 SV=1 56 353 2.0E-15
sp|A0AL74|FENR2_LISW6 Ferredoxin--NADP reductase 2 OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=lwe2338 PE=3 SV=1 51 364 2.0E-15
sp|A7Z8C1|FENR2_BACMF Ferredoxin--NADP reductase 2 OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=RBAM_029160 PE=3 SV=1 51 353 4.0E-15
sp|Q71X35|FENR2_LISMF Ferredoxin--NADP reductase 2 OS=Listeria monocytogenes serotype 4b (strain F2365) GN=LMOf2365_2364 PE=3 SV=1 51 364 5.0E-15
sp|Q8DUN5|FENR_STRMU Ferredoxin--NADP reductase OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=SMU_869 PE=3 SV=1 50 353 9.0E-15
sp|Q5KVP7|FENR_GEOKA Ferredoxin--NADP reductase OS=Geobacillus kaustophilus (strain HTA426) GN=GK2954 PE=3 SV=1 50 353 1.0E-14
sp|Q928P3|FENR2_LISIN Ferredoxin--NADP reductase 2 OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=lin2489 PE=3 SV=1 51 364 1.0E-14
sp|Q8Y4P5|FENR2_LISMO Ferredoxin--NADP reductase 2 OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=lmo2390 PE=3 SV=1 51 364 2.0E-14
sp|Q03JS2|FENR_STRTD Ferredoxin--NADP reductase OS=Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9) GN=STER_1382 PE=3 SV=1 50 353 3.0E-14
sp|Q5M3J6|FENR_STRT2 Ferredoxin--NADP reductase OS=Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311) GN=stu1417 PE=3 SV=1 50 353 3.0E-14
sp|Q5LYY3|FENR_STRT1 Ferredoxin--NADP reductase OS=Streptococcus thermophilus (strain CNRZ 1066) GN=str1417 PE=3 SV=1 50 353 3.0E-14
sp|Q2W0C9|FENR_MAGSA Ferredoxin--NADP reductase OS=Magnetospirillum magneticum (strain AMB-1 / ATCC 700264) GN=amb3892 PE=3 SV=1 57 338 5.0E-14
sp|Q72LG3|FENR_THET2 Ferredoxin--NADP reductase OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=TT_C0096 PE=3 SV=1 53 338 6.0E-14
sp|A9NFF6|FENR_ACHLI Ferredoxin--NADP reductase OS=Acholeplasma laidlawii (strain PG-8A) GN=ACL_0467 PE=3 SV=2 55 356 2.0E-13
sp|Q5SL28|FENR_THET8 Ferredoxin--NADP reductase OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=TTHA0465 PE=1 SV=1 53 338 2.0E-13
sp|Q9K7F3|FENR_BACHD Ferredoxin--NADP reductase OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=BH3408 PE=3 SV=1 56 338 2.0E-13
sp|Q65FE0|FENR2_BACLD Ferredoxin--NADP reductase 2 OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=BLi03393 PE=3 SV=1 51 353 4.0E-13
sp|Q3YS71|FENR_EHRCJ Ferredoxin--NADP reductase OS=Ehrlichia canis (strain Jake) GN=Ecaj_0391 PE=3 SV=1 56 338 4.0E-13
sp|A4SVT8|FENR_POLSQ Ferredoxin--NADP reductase OS=Polynucleobacter necessarius subsp. asymbioticus (strain DSM 18221 / CIP 109841 / QLW-P1DMWA-1) GN=Pnuc_0382 PE=3 SV=1 57 338 6.0E-13
sp|A8AXQ6|FENR_STRGC Ferredoxin--NADP reductase OS=Streptococcus gordonii (strain Challis / ATCC 35105 / CH1 / DL1 / V288) GN=SGO_1284 PE=3 SV=1 56 353 7.0E-13
sp|A3CM39|FENR_STRSV Ferredoxin--NADP reductase OS=Streptococcus sanguinis (strain SK36) GN=SSA_0813 PE=3 SV=1 56 353 8.0E-13
sp|Q96YN9|FENR_SULTO Ferredoxin--NADP reductase OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=STK_21330 PE=3 SV=2 56 364 8.0E-13
sp|B4U394|FENR_STREM Ferredoxin--NADP reductase OS=Streptococcus equi subsp. zooepidemicus (strain MGCS10565) GN=Sez_1109 PE=3 SV=1 50 353 1.0E-12
sp|A8FH11|FENR2_BACP2 Ferredoxin--NADP reductase 2 OS=Bacillus pumilus (strain SAFR-032) GN=BPUM_2873 PE=3 SV=1 51 353 2.0E-12
sp|A4YER6|FENR_METS5 Ferredoxin--NADP reductase OS=Metallosphaera sedula (strain ATCC 51363 / DSM 5348) GN=Msed_0743 PE=3 SV=2 55 338 2.0E-12
sp|Q816D9|FENR_BACCR Ferredoxin--NADP reductase OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=BC_4926 PE=3 SV=1 47 249 3.0E-12
sp|Q632D6|FENR_BACCZ Ferredoxin--NADP reductase OS=Bacillus cereus (strain ZK / E33L) GN=BCE33L4658 PE=3 SV=1 47 249 3.0E-12
sp|Q6HBX6|FENR2_BACHK Ferredoxin--NADP reductase 2 OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=BT9727_4639 PE=3 SV=1 47 249 3.0E-12
sp|Q72YF6|FENR2_BACC1 Ferredoxin--NADP reductase 2 OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=BCE_5065 PE=3 SV=1 47 249 3.0E-12
sp|Q81XS0|FENR2_BACAN Ferredoxin--NADP reductase 2 OS=Bacillus anthracis GN=BA_5160 PE=3 SV=1 47 249 3.0E-12
sp|A0RKB9|FENR2_BACAH Ferredoxin--NADP reductase 2 OS=Bacillus thuringiensis (strain Al Hakam) GN=BALH_4465 PE=3 SV=1 47 249 3.0E-12
sp|Q8ENX4|FENR2_OCEIH Ferredoxin--NADP reductase 2 OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=OB2351 PE=3 SV=1 56 364 4.0E-12
sp|A7GUD5|FENR2_BACCN Ferredoxin--NADP reductase 2 OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=Bcer98_3539 PE=3 SV=1 56 249 6.0E-12
sp|B1MX70|FENR_LEUCK Ferredoxin--NADP reductase OS=Leuconostoc citreum (strain KM20) GN=LCK_00289 PE=3 SV=2 49 250 1.0E-11
sp|Q67QU3|FENR_SYMTH Ferredoxin--NADP reductase OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=STH965 PE=3 SV=1 47 364 1.0E-11
sp|B3R5L8|FENR2_CUPTR Ferredoxin--NADP reductase 2 OS=Cupriavidus taiwanensis (strain R1 / LMG 19424) GN=RALTA_A2094 PE=3 SV=1 46 351 2.0E-11
sp|A9VMZ3|FENR2_BACWK Ferredoxin--NADP reductase 2 OS=Bacillus weihenstephanensis (strain KBAB4) GN=BcerKBAB4_4748 PE=3 SV=1 50 353 2.0E-11
sp|Q4JCM0|FENR1_SULAC Ferredoxin--NADP reductase 1 OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=Saci_0029 PE=3 SV=1 56 357 3.0E-11
sp|Q97WJ5|FENR_SULSO Ferredoxin--NADP reductase OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=SSO2222 PE=3 SV=1 56 338 5.0E-11
sp|Q0K8J6|FENR2_CUPNH Ferredoxin--NADP reductase 2 OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=H16_A2592 PE=3 SV=1 32 351 5.0E-11
sp|B2GEF7|FENR_LACF3 Ferredoxin--NADP reductase OS=Lactobacillus fermentum (strain NBRC 3956 / LMG 18251) GN=LAF_1703 PE=3 SV=1 56 240 6.0E-11
sp|B1I067|FENR2_LYSSC Ferredoxin--NADP reductase 2 OS=Lysinibacillus sphaericus (strain C3-41) GN=Bsph_0993 PE=3 SV=1 56 366 9.0E-11
sp|A7GKN4|FENR1_BACCN Ferredoxin--NADP reductase 1 OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=Bcer98_0331 PE=3 SV=1 56 338 1.0E-10
sp|B1YKW2|FENR1_EXIS2 Ferredoxin--NADP reductase 1 OS=Exiguobacterium sibiricum (strain DSM 17290 / JCM 13490 / 255-15) GN=Exig_2313 PE=3 SV=1 56 371 1.0E-10
sp|Q2GCZ2|FENR_NEOSM Ferredoxin--NADP reductase OS=Neorickettsia sennetsu (strain Miyayama) GN=NSE_0779 PE=3 SV=1 52 354 1.0E-10
sp|B3QPZ8|FENR_CHLP8 Ferredoxin--NADP reductase OS=Chlorobaculum parvum (strain NCIB 8327) GN=Cpar_1603 PE=3 SV=1 56 338 2.0E-10
sp|Q46YY3|FENR2_CUPPJ Ferredoxin--NADP reductase 2 OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=Reut_A2287 PE=3 SV=1 47 351 3.0E-10
sp|A0LXL9|FENR1_GRAFK Ferredoxin--NADP reductase 1 OS=Gramella forsetii (strain KT0803) GN=GFO_0125 PE=3 SV=1 56 351 3.0E-10
sp|Q73GH2|FENR_WOLPM Ferredoxin--NADP reductase OS=Wolbachia pipientis wMel GN=WD_0982 PE=3 SV=1 52 374 3.0E-10
sp|Q04HB6|FENR_OENOB Ferredoxin--NADP reductase OS=Oenococcus oeni (strain ATCC BAA-331 / PSU-1) GN=OEOE_0163 PE=3 SV=1 56 248 4.0E-10
sp|Q2GGH5|FENR_EHRCR Ferredoxin--NADP reductase OS=Ehrlichia chaffeensis (strain ATCC CRL-10679 / Arkansas) GN=ECH_0649 PE=3 SV=1 56 338 4.0E-10
sp|Q8KCB2|FENR_CHLTE Ferredoxin--NADP reductase OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) GN=CT1512 PE=1 SV=1 56 338 5.0E-10
sp|Q98M06|FENR_RHILO Ferredoxin--NADP reductase OS=Rhizobium loti (strain MAFF303099) GN=mll0792 PE=3 SV=1 56 338 5.0E-10
sp|B3EKW5|FENR_CHLPB Ferredoxin--NADP reductase OS=Chlorobium phaeobacteroides (strain BS1) GN=Cphamn1_1733 PE=3 SV=1 56 338 5.0E-10
sp|B3QXR3|FENR2_CHLT3 Ferredoxin--NADP reductase 2 OS=Chloroherpeton thalassium (strain ATCC 35110 / GB-78) GN=Ctha_2529 PE=3 SV=1 56 338 1.0E-09
sp|A8AA47|FENR_IGNH4 Ferredoxin--NADP reductase OS=Ignicoccus hospitalis (strain KIN4/I / DSM 18386 / JCM 14125) GN=Igni_0617 PE=3 SV=1 52 364 1.0E-09
sp|B3CMJ8|FENR_WOLPP Ferredoxin--NADP reductase OS=Wolbachia pipientis subsp. Culex pipiens (strain wPip) GN=WP1010 PE=3 SV=1 52 338 1.0E-09
sp|B1ICY3|FENR_STRPI Ferredoxin--NADP reductase OS=Streptococcus pneumoniae (strain Hungary19A-6) GN=SPH_1677 PE=3 SV=1 51 337 1.0E-09
sp|Q1LKJ7|FENR2_CUPMC Ferredoxin--NADP reductase 2 OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) GN=Rmet_2452 PE=3 SV=1 32 351 1.0E-09
sp|Q6HP49|FENR1_BACHK Ferredoxin--NADP reductase 1 OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=BT9727_0321 PE=3 SV=1 56 338 2.0E-09
sp|Q81ZB7|FENR1_BACAN Ferredoxin--NADP reductase 1 OS=Bacillus anthracis GN=BA_0352 PE=3 SV=1 56 338 2.0E-09
sp|A0R951|FENR1_BACAH Ferredoxin--NADP reductase 1 OS=Bacillus thuringiensis (strain Al Hakam) GN=BALH_0343 PE=3 SV=1 56 338 2.0E-09
sp|Q4J6Z4|FENR2_SULAC Ferredoxin--NADP reductase 2 OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=Saci_2144 PE=3 SV=1 93 338 2.0E-09
sp|Q483W3|FENR_COLP3 Ferredoxin--NADP reductase OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=CPS_1923 PE=3 SV=1 56 338 2.0E-09
sp|A9VRK8|FENR1_BACWK Ferredoxin--NADP reductase 1 OS=Bacillus weihenstephanensis (strain KBAB4) GN=BcerKBAB4_0332 PE=3 SV=1 56 338 2.0E-09
sp|Q8DP13|FENR_STRR6 Ferredoxin--NADP reductase OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=spr1421 PE=3 SV=1 51 337 2.0E-09
sp|Q04JI5|FENR_STRP2 Ferredoxin--NADP reductase OS=Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) GN=SPD_1393 PE=3 SV=1 51 337 2.0E-09
sp|Q02XL9|FENR_LACLS Ferredoxin--NADP reductase OS=Lactococcus lactis subsp. cremoris (strain SK11) GN=LACR_1811 PE=3 SV=1 56 369 2.0E-09
sp|Q38YJ1|FENR2_LACSS Ferredoxin--NADP reductase 2 OS=Lactobacillus sakei subsp. sakei (strain 23K) GN=LCA_0435 PE=3 SV=1 56 353 2.0E-09
sp|Q5FT88|FENR_GLUOX Ferredoxin--NADP reductase OS=Gluconobacter oxydans (strain 621H) GN=GOX0631 PE=3 SV=2 50 338 3.0E-09
sp|Q1JHF5|FENR_STRPD Ferredoxin--NADP reductase OS=Streptococcus pyogenes serotype M2 (strain MGAS10270) GN=MGAS10270_Spy0716 PE=3 SV=1 93 353 3.0E-09
sp|A5EMW5|FENR_BRASB Ferredoxin--NADP reductase OS=Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182) GN=BBta_5550 PE=3 SV=1 56 339 3.0E-09
sp|Q03ZE9|FENR_LEUMM Ferredoxin--NADP reductase OS=Leuconostoc mesenteroides subsp. mesenteroides (strain ATCC 8293 / NCDO 523) GN=LEUM_0297 PE=3 SV=1 56 353 3.0E-09
sp|Q73EA6|FENR1_BACC1 Ferredoxin--NADP reductase 1 OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=BCE_0452 PE=3 SV=1 56 338 3.0E-09
sp|Q48U54|FENR_STRPM Ferredoxin--NADP reductase OS=Streptococcus pyogenes serotype M28 (strain MGAS6180) GN=M28_Spy0638 PE=3 SV=1 93 337 3.0E-09
sp|B1HW35|FENR3_LYSSC Ferredoxin--NADP reductase 3 OS=Lysinibacillus sphaericus (strain C3-41) GN=Bsph_2322 PE=3 SV=1 56 338 4.0E-09
sp|B3CTT3|FENR_ORITI Ferredoxin--NADP reductase OS=Orientia tsutsugamushi (strain Ikeda) GN=OTT_1322 PE=3 SV=1 56 338 4.0E-09
sp|A4VXW3|FENR_STRSY Ferredoxin--NADP reductase OS=Streptococcus suis (strain 05ZYH33) GN=SSU05_1986 PE=3 SV=1 56 337 5.0E-09
sp|A4W460|FENR_STRS2 Ferredoxin--NADP reductase OS=Streptococcus suis (strain 98HAH33) GN=SSU98_1991 PE=3 SV=2 56 337 5.0E-09
sp|P0DB07|FENR_STRPQ Ferredoxin--NADP reductase OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=SPs1279 PE=3 SV=1 93 337 6.0E-09
sp|P0DB06|FENR_STRP3 Ferredoxin--NADP reductase OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=SpyM3_0575 PE=3 SV=1 93 337 6.0E-09
sp|Q1J776|FENR_STRPF Ferredoxin--NADP reductase OS=Streptococcus pyogenes serotype M4 (strain MGAS10750) GN=MGAS10750_Spy0748 PE=3 SV=1 93 337 6.0E-09
sp|B3QXE1|FENR1_CHLT3 Ferredoxin--NADP reductase 1 OS=Chloroherpeton thalassium (strain ATCC 35110 / GB-78) GN=Ctha_0950 PE=3 SV=1 56 338 6.0E-09
sp|Q8ETS1|FENR1_OCEIH Ferredoxin--NADP reductase 1 OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=OB0186 PE=3 SV=1 56 338 7.0E-09
sp|Q5WAF1|FENR1_BACSK Ferredoxin--NADP reductase 1 OS=Bacillus clausii (strain KSM-K16) GN=ABC0094 PE=3 SV=2 50 338 8.0E-09
sp|A2RJC6|FENR_LACLM Ferredoxin--NADP reductase OS=Lactococcus lactis subsp. cremoris (strain MG1363) GN=llmg_0776 PE=3 SV=1 56 353 8.0E-09
sp|A7Z171|FENR1_BACMF Ferredoxin--NADP reductase 1 OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=RBAM_003480 PE=3 SV=1 56 337 8.0E-09
sp|Q9A0B5|FENR_STRP1 Ferredoxin--NADP reductase OS=Streptococcus pyogenes serotype M1 GN=SPy_0850 PE=3 SV=1 93 337 9.0E-09
sp|Q9CF34|FENR_LACLA Ferredoxin--NADP reductase OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=LL1647 PE=3 SV=1 56 369 9.0E-09
sp|Q0BQJ9|FENR_GRABC Ferredoxin--NADP reductase OS=Granulibacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1) GN=GbCGDNIH1_2006 PE=3 SV=2 45 338 1.0E-08
sp|B5E6K6|FENR_STRP4 Ferredoxin--NADP reductase OS=Streptococcus pneumoniae serotype 19F (strain G54) GN=SPG_1489 PE=3 SV=1 51 337 1.0E-08
sp|Q3AS18|FENR_CHLCH Ferredoxin--NADP reductase OS=Chlorobium chlorochromatii (strain CaD3) GN=Cag_0944 PE=3 SV=1 56 338 2.0E-08
sp|B5XKX5|FENR_STRPZ Ferredoxin--NADP reductase OS=Streptococcus pyogenes serotype M49 (strain NZ131) GN=Spy49_0668 PE=3 SV=1 93 337 2.0E-08
sp|A5CF57|FENR_ORITB Ferredoxin--NADP reductase OS=Orientia tsutsugamushi (strain Boryong) GN=OTBS_1841 PE=3 SV=1 56 338 2.0E-08
sp|Q0RRX8|FENR_FRAAA Ferredoxin--NADP reductase OS=Frankia alni (strain ACN14a) GN=FRAAL1022 PE=3 SV=2 56 356 3.0E-08
sp|A2RF47|FENR_STRPG Ferredoxin--NADP reductase OS=Streptococcus pyogenes serotype M5 (strain Manfredo) GN=SpyM51151 PE=3 SV=1 93 337 3.0E-08
sp|Q1JMB2|FENR_STRPC Ferredoxin--NADP reductase OS=Streptococcus pyogenes serotype M12 (strain MGAS9429) GN=MGAS9429_Spy0712 PE=3 SV=1 93 337 3.0E-08
sp|Q1JCC9|FENR_STRPB Ferredoxin--NADP reductase OS=Streptococcus pyogenes serotype M12 (strain MGAS2096) GN=MGAS2096_Spy0727 PE=3 SV=1 93 337 3.0E-08
sp|Q8P1F2|FENR_STRP8 Ferredoxin--NADP reductase OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=spyM18_0909 PE=3 SV=1 93 337 3.0E-08
sp|Q5XCQ2|FENR_STRP6 Ferredoxin--NADP reductase OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=M6_Spy0676 PE=3 SV=1 93 337 3.0E-08
sp|B2IR81|FENR_STRPS Ferredoxin--NADP reductase OS=Streptococcus pneumoniae (strain CGSP14) GN=SPCG_1548 PE=3 SV=1 51 337 3.0E-08
sp|Q97PP0|FENR_STRPN Ferredoxin--NADP reductase OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=SP_1563 PE=3 SV=1 51 337 3.0E-08
sp|A8F1N2|FENR_RICM5 Ferredoxin--NADP reductase OS=Rickettsia massiliae (strain Mtu5) GN=RMA_0647 PE=3 SV=2 56 338 3.0E-08
sp|A0AK73|FENR1_LISW6 Ferredoxin--NADP reductase 1 OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=lwe1987 PE=3 SV=1 56 364 3.0E-08
sp|Q8Y0A5|FENR_RALSO Ferredoxin--NADP reductase OS=Ralstonia solanacearum (strain GMI1000) GN=RSc1139 PE=3 SV=2 37 351 3.0E-08
sp|Q1QNQ1|FENR_NITHX Ferredoxin--NADP reductase OS=Nitrobacter hamburgensis (strain X14 / DSM 10229) GN=Nham_1321 PE=3 SV=1 56 364 3.0E-08
sp|Q89HV6|FENR_BRADU Ferredoxin--NADP reductase OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=bll5883 PE=3 SV=1 56 339 5.0E-08
sp|Q3STP0|FENR_NITWN Ferredoxin--NADP reductase OS=Nitrobacter winogradskyi (strain Nb-255 / ATCC 25391) GN=Nwi_1089 PE=3 SV=1 56 364 6.0E-08
sp|Q1LPH7|FENR1_CUPMC Ferredoxin--NADP reductase 1 OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) GN=Rmet_1063 PE=3 SV=1 56 351 7.0E-08
sp|O31475|FENR1_BACSU Ferredoxin--NADP reductase 1 OS=Bacillus subtilis (strain 168) GN=ycgT PE=3 SV=1 56 337 8.0E-08
sp|A4YXZ8|FENR_BRASO Ferredoxin--NADP reductase OS=Bradyrhizobium sp. (strain ORS278) GN=BRADO5079 PE=3 SV=1 56 339 8.0E-08
sp|Q8U195|SUDHA_PYRFU Sulfide dehydrogenase subunit alpha OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=sudA PE=1 SV=1 48 337 9.0E-08
sp|Q2GJY7|FENR_ANAPZ Ferredoxin--NADP reductase OS=Anaplasma phagocytophilum (strain HZ) GN=APH_0734 PE=3 SV=1 56 287 1.0E-07
sp|A8M2W8|FENR_SALAI Ferredoxin--NADP reductase OS=Salinispora arenicola (strain CNS-205) GN=Sare_0817 PE=3 SV=1 56 353 1.0E-07
sp|Q8Y5U4|FENR1_LISMO Ferredoxin--NADP reductase 1 OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=lmo1961 PE=3 SV=1 56 364 1.0E-07
sp|Q71Y53|FENR1_LISMF Ferredoxin--NADP reductase 1 OS=Listeria monocytogenes serotype 4b (strain F2365) GN=LMOf2365_1991 PE=3 SV=1 56 364 1.0E-07
sp|A9H9C9|FENR_GLUDA Ferredoxin--NADP reductase OS=Gluconacetobacter diazotrophicus (strain ATCC 49037 / DSM 5601 / PAl5) GN=GDI0711 PE=3 SV=2 56 338 2.0E-07
sp|B3R4A7|FENR1_CUPTR Ferredoxin--NADP reductase 1 OS=Cupriavidus taiwanensis (strain R1 / LMG 19424) GN=RALTA_A1176 PE=3 SV=1 56 351 2.0E-07
sp|Q473F6|FENR1_CUPPJ Ferredoxin--NADP reductase 1 OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=Reut_A1099 PE=3 SV=1 37 351 2.0E-07
sp|Q68WM0|FENR_RICTY Ferredoxin--NADP reductase OS=Rickettsia typhi (strain ATCC VR-144 / Wilmington) GN=RT0500 PE=3 SV=1 56 338 2.0E-07
sp|Q2ITC6|FENR_RHOP2 Ferredoxin--NADP reductase OS=Rhodopseudomonas palustris (strain HaA2) GN=RPB_3841 PE=3 SV=1 56 364 2.0E-07
sp|B0BXN8|FENR_RICRO Ferredoxin--NADP reductase OS=Rickettsia rickettsii (strain Iowa) GN=RrIowa_0762 PE=3 SV=1 52 338 2.0E-07
sp|B2G9D0|FENR_LACRJ Ferredoxin--NADP reductase OS=Lactobacillus reuteri (strain JCM 1112) GN=LAR_1546 PE=3 SV=1 49 353 3.0E-07
sp|A5VM22|FENR_LACRD Ferredoxin--NADP reductase OS=Lactobacillus reuteri (strain DSM 20016) GN=Lreu_1657 PE=3 SV=1 49 353 3.0E-07
sp|Q9ZD33|FENR_RICPR Ferredoxin--NADP reductase OS=Rickettsia prowazekii (strain Madrid E) GN=RP514 PE=3 SV=1 56 338 3.0E-07
sp|Q0KCD1|FENR1_CUPNH Ferredoxin--NADP reductase 1 OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=H16_A1199 PE=3 SV=1 56 351 3.0E-07
sp|A8GS72|FENR_RICRS Ferredoxin--NADP reductase OS=Rickettsia rickettsii (strain Sheila Smith) GN=A1G_03605 PE=3 SV=1 52 338 3.0E-07
sp|Q92A47|FENR1_LISIN Ferredoxin--NADP reductase 1 OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=lin2075 PE=3 SV=1 56 364 3.0E-07
sp|Q65GY3|FENR1_BACLD Ferredoxin--NADP reductase 1 OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=BLi02810 PE=3 SV=1 56 338 3.0E-07
sp|Q07946|BEDA_PSEPU Benzene 1,2-dioxygenase system ferredoxin--NAD(+) reductase subunit OS=Pseudomonas putida GN=bedA PE=1 SV=1 52 338 4.0E-07
sp|Q1RHV1|FENR_RICBR Ferredoxin--NADP reductase OS=Rickettsia bellii (strain RML369-C) GN=RBE_0982 PE=3 SV=1 52 338 5.0E-07
sp|A1VQ12|FENR_POLNA Ferredoxin--NADP reductase OS=Polaromonas naphthalenivorans (strain CJ2) GN=Pnap_2433 PE=3 SV=1 57 364 7.0E-07
sp|B1HZ05|FENR1_LYSSC Ferredoxin--NADP reductase 1 OS=Lysinibacillus sphaericus (strain C3-41) GN=Bsph_0789 PE=3 SV=2 50 338 8.0E-07
sp|A5FYH8|FENR_ACICJ Ferredoxin--NADP reductase OS=Acidiphilium cryptum (strain JF-5) GN=Acry_1452 PE=3 SV=1 56 338 9.0E-07
sp|A0LY71|FENR2_GRAFK Ferredoxin--NADP reductase 2 OS=Gramella forsetii (strain KT0803) GN=GFO_0330 PE=3 SV=1 56 351 9.0E-07
sp|Q4ULM2|FENR_RICFE Ferredoxin--NADP reductase OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=RF_0700 PE=3 SV=1 56 338 1.0E-06
sp|Q03AW0|FENR_LACC3 Ferredoxin--NADP reductase OS=Lactobacillus casei (strain ATCC 334) GN=LSEI_0826 PE=3 SV=1 55 353 1.0E-06
sp|Q92HY3|FENR_RICCN Ferredoxin--NADP reductase OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) GN=RC0637 PE=3 SV=1 56 338 1.0E-06
sp|Q13AK7|FENR_RHOPS Ferredoxin--NADP reductase OS=Rhodopseudomonas palustris (strain BisB5) GN=RPD_1645 PE=3 SV=1 56 364 1.0E-06
sp|A5W4E9|TODA_PSEP1 Toluene 1,2-dioxygenase system ferredoxin--NAD(+) reductase component OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=todA PE=1 SV=1 137 344 1.0E-06
sp|B2U9D2|FENR_RALPJ Ferredoxin--NADP reductase OS=Ralstonia pickettii (strain 12J) GN=Rpic_0981 PE=3 SV=1 56 351 2.0E-06
sp|B1YEQ1|FENR2_EXIS2 Ferredoxin--NADP reductase 2 OS=Exiguobacterium sibiricum (strain DSM 17290 / JCM 13490 / 255-15) GN=Exig_2773 PE=3 SV=1 56 338 2.0E-06
sp|A8GW75|FENR_RICB8 Ferredoxin--NADP reductase OS=Rickettsia bellii (strain OSU 85-389) GN=A1I_03745 PE=3 SV=1 52 338 2.0E-06
sp|A1BHP4|FENR_CHLPD Ferredoxin--NADP reductase OS=Chlorobium phaeobacteroides (strain DSM 266) GN=Cpha266_1905 PE=3 SV=1 40 338 2.0E-06
sp|A0LT79|FENR_ACIC1 Ferredoxin--NADP reductase OS=Acidothermus cellulolyticus (strain ATCC 43068 / 11B) GN=Acel_0866 PE=3 SV=2 56 353 2.0E-06
sp|A8EYV4|FENR_RICCK Ferredoxin--NADP reductase OS=Rickettsia canadensis (strain McKiel) GN=A1E_02985 PE=3 SV=1 56 338 2.0E-06
sp|B3WCB2|FENR_LACCB Ferredoxin--NADP reductase OS=Lactobacillus casei (strain BL23) GN=LCABL_08900 PE=3 SV=1 55 353 2.0E-06
sp|A2SFW9|FENR_METPP Ferredoxin--NADP reductase OS=Methylibium petroleiphilum (strain PM1) GN=Mpe_A1496 PE=3 SV=1 57 339 2.0E-06
sp|A6H064|FENR_FLAPJ Ferredoxin--NADP reductase OS=Flavobacterium psychrophilum (strain JIP02/86 / ATCC 49511) GN=FP1670 PE=3 SV=1 56 339 3.0E-06
sp|Q3B2Q8|FENR_CHLL7 Ferredoxin--NADP reductase OS=Chlorobium luteolum (strain DSM 273 / 2530) GN=Plut_1516 PE=3 SV=2 40 338 3.0E-06
sp|B3QJ15|FENR_RHOPT Ferredoxin--NADP reductase OS=Rhodopseudomonas palustris (strain TIE-1) GN=Rpal_4475 PE=3 SV=1 56 364 4.0E-06
sp|Q6N2U4|FENR_RHOPA Ferredoxin--NADP reductase OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=RPA3954 PE=3 SV=1 56 364 4.0E-06
sp|Q2RNR2|FENR_RHORT Ferredoxin--NADP reductase OS=Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1) GN=Rru_A3439 PE=3 SV=1 201 338 4.0E-06
sp|Q03H60|FENR_PEDPA Ferredoxin--NADP reductase OS=Pediococcus pentosaceus (strain ATCC 25745 / 183-1w) GN=PEPE_0366 PE=3 SV=1 52 239 5.0E-06
sp|Q219B6|FENR_RHOPB Ferredoxin--NADP reductase OS=Rhodopseudomonas palustris (strain BisB18) GN=RPC_1458 PE=3 SV=1 56 364 5.0E-06
sp|A7HW48|FENR_PARL1 Ferredoxin--NADP reductase OS=Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966) GN=Plav_2522 PE=3 SV=1 56 338 6.0E-06
sp|Q88UC0|FENR_LACPL Ferredoxin--NADP reductase OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=lp_2585 PE=3 SV=1 56 239 9.0E-06
sp|Q5PAR7|FENR_ANAMM Ferredoxin--NADP reductase OS=Anaplasma marginale (strain St. Maries) GN=AM617 PE=3 SV=2 58 369 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0016491 oxidoreductase activity Yes
GO:0003824 catalytic activity No
GO:0003674 molecular_function No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup4985
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|770
Ophiocordyceps australis map64 (Brazil) OphauB2|4391 (this protein)
Ophiocordyceps camponoti-floridani Ophcf2|02270
Ophiocordyceps kimflemingae Ophio5|5109
Ophiocordyceps subramaniannii Hirsu2|223

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|4391
MREAQTIKHNEADGLEIGSDPHFNQHVKKLRPAATTTTQSTKRVPPAGARRMHDKVVIIGSGPAAHTAAIYLSRA
ELKPVLYEGFLANGTAAGGQLTTTTEVENYPGFPKGIMGQELMDNMRAQSERFGTRIVTDTVNKLDLSSRPFKYS
TEFSPNETHTADAVIMATGASARRMGLAGEDKYWQNGISACAVCDGAVPIFRNKHLVVIGGGDSAAEEATFLTKY
ASHVTVLVRRDALRASRTMATRLLAHPKVTVRFKTQAVEVRGGEDGLMSHLVVSDANGKQEVLEANGLFYAIGHD
PATALVRNQVDMDADGYIKTTPGSTLTSVDGVFAAGDVQDKRYRQAITSAGTGCMAALDAEKFLADHEIDHRES*
Coding >OphauB2|4391
ATGAGAGAGGCGCAGACGATTAAACACAACGAGGCCGACGGCTTAGAAATCGGAAGCGACCCGCATTTCAACCAG
CACGTCAAAAAGCTCAGACCGGCGGCGACGACGACGACGCAGAGCACCAAGAGGGTACCGCCTGCTGGCGCCAGG
AGGATGCACGACAAGGTTGTCATCATTGGCTCTGGGCCAGCCGCCCACACAGCCGCCATTTATCTGAGCCGGGCA
GAACTGAAGCCGGTTCTGTATGAGGGATTCTTGGCCAACGGCACGGCGGCGGGCGGCCAGCTGACGACGACGACG
GAAGTCGAAAACTACCCTGGCTTCCCCAAGGGCATCATGGGCCAGGAACTAATGGATAATATGCGTGCGCAGTCG
GAGCGCTTTGGCACTCGCATCGTCACCGACACGGTCAACAAGCTCGACCTGTCGTCGCGGCCCTTCAAATACAGC
ACCGAGTTTAGCCCCAACGAGACACACACGGCCGACGCCGTCATCATGGCCACGGGCGCGTCGGCGCGGCGCATG
GGCCTGGCAGGCGAGGACAAGTACTGGCAAAACGGCATCTCTGCCTGTGCCGTGTGCGACGGCGCGGTGCCCATT
TTCCGCAACAAGCACCTCGTCGTCATTGGCGGCGGCGACTCGGCAGCCGAAGAGGCCACCTTTTTGACAAAGTAT
GCCAGCCACGTCACCGTCTTGGTGCGCCGCGACGCCCTGCGTGCCAGCCGCACCATGGCGACGCGCCTACTGGCC
CATCCCAAGGTGACGGTGCGCTTCAAGACGCAGGCCGTCGAGGTGCGCGGCGGAGAGGATGGCCTCATGAGCCAC
TTGGTTGTGAGCGACGCCAACGGCAAGCAAGAGGTGCTCGAGGCAAATGGCCTCTTTTACGCAATTGGCCACGAT
CCAGCTACGGCGCTTGTCCGCAATCAGGTCGACATGGATGCCGACGGCTACATCAAGACGACGCCGGGGTCTACG
CTGACGAGCGTCGACGGCGTCTTTGCGGCTGGCGACGTCCAGGACAAGCGTTATCGCCAGGCCATTACCAGCGCA
GGCACCGGATGCATGGCTGCCCTTGACGCTGAAAAGTTCTTGGCCGACCATGAAATCGACCACAGGGAATCCTAA
Transcript >OphauB2|4391
ATGAGAGAGGCGCAGACGATTAAACACAACGAGGCCGACGGCTTAGAAATCGGAAGCGACCCGCATTTCAACCAG
CACGTCAAAAAGCTCAGACCGGCGGCGACGACGACGACGCAGAGCACCAAGAGGGTACCGCCTGCTGGCGCCAGG
AGGATGCACGACAAGGTTGTCATCATTGGCTCTGGGCCAGCCGCCCACACAGCCGCCATTTATCTGAGCCGGGCA
GAACTGAAGCCGGTTCTGTATGAGGGATTCTTGGCCAACGGCACGGCGGCGGGCGGCCAGCTGACGACGACGACG
GAAGTCGAAAACTACCCTGGCTTCCCCAAGGGCATCATGGGCCAGGAACTAATGGATAATATGCGTGCGCAGTCG
GAGCGCTTTGGCACTCGCATCGTCACCGACACGGTCAACAAGCTCGACCTGTCGTCGCGGCCCTTCAAATACAGC
ACCGAGTTTAGCCCCAACGAGACACACACGGCCGACGCCGTCATCATGGCCACGGGCGCGTCGGCGCGGCGCATG
GGCCTGGCAGGCGAGGACAAGTACTGGCAAAACGGCATCTCTGCCTGTGCCGTGTGCGACGGCGCGGTGCCCATT
TTCCGCAACAAGCACCTCGTCGTCATTGGCGGCGGCGACTCGGCAGCCGAAGAGGCCACCTTTTTGACAAAGTAT
GCCAGCCACGTCACCGTCTTGGTGCGCCGCGACGCCCTGCGTGCCAGCCGCACCATGGCGACGCGCCTACTGGCC
CATCCCAAGGTGACGGTGCGCTTCAAGACGCAGGCCGTCGAGGTGCGCGGCGGAGAGGATGGCCTCATGAGCCAC
TTGGTTGTGAGCGACGCCAACGGCAAGCAAGAGGTGCTCGAGGCAAATGGCCTCTTTTACGCAATTGGCCACGAT
CCAGCTACGGCGCTTGTCCGCAATCAGGTCGACATGGATGCCGACGGCTACATCAAGACGACGCCGGGGTCTACG
CTGACGAGCGTCGACGGCGTCTTTGCGGCTGGCGACGTCCAGGACAAGCGTTATCGCCAGGCCATTACCAGCGCA
GGCACCGGATGCATGGCTGCCCTTGACGCTGAAAAGTTCTTGGCCGACCATGAAATCGACCACAGGGAATCCTAA
Gene >OphauB2|4391
ATGAGAGAGGCGCAGACGATTAAACACAACGAGGCCGACGGCTTAGAAATCGGAAGCGACCCGCATTTCAACCAG
CACGTCAAAAAGCTCAGACGTTTTTATAGCACGCTGGCTCGCTCTGTCGGACGCGCGCACATTTGGTGAAAAAAA
AAAAAACCGCCAAACTGTCTTCCTCACGGCTCTTTGGGCGGACGCTGAGATCGAGCGCTGGGCTATTTTCCATTG
CGACAGCGGCGGCGACGACGACGACGCAGAGCACCAAGAGGGTACCGCCTGCTGGCGCCAGGAGGATGCACGACA
AGGTTGTCAGTGCGTTTTTGCTCCGAGTCTGGGTGGTTTATACAATTTGTTGATTCCGCAATGGCTGACGCACCA
TATTTGTAGTCATTGGCTCTGGGCCAGCCGCCCACACAGCCGCCATTTATCTGAGCCGGGCAGAACTGAAGCGTG
AGTCGGCTCGTGTTTTGGGTGGCATGGCCGTCTGTTGACAAGAGGCGCTGTGGATAGCGGTTCTGTATGAGGGAT
TCTTGGCCAACGGCACGGCGGCGGGCGGCCAGCTGACGACGACGACGGAAGTCGAAAACTACCCTGGCTTCCCCA
AGGGCATCATGGGCCAGGAACTAATGGTGAGGACTGCGCTGCGTGTGGCAATGCTGGCTCAACCTTGCAGCTGCC
AAAGCCGTCTGGTGCTAATACTCGAGGGAAAAAAAAAAAACAGGATAATATGCGTGCGCAGTCGGAGCGCTTTGG
CACTCGCATCGTCACCGACACGGTCAACAAGCTCGACCTGTCGTCGCGGCCCTTCAAATACAGCACCGAGTTTAG
CCCCAACGAGACACACACGGCCGACGCCGTCATCATGGCCACGGGCGCGTCGGCGCGGCGCATGGGCCTGGCAGG
CGAGGACAAGTACTGGCAAAACGGCATCTCTGCCTGTGCCGTGTGCGACGGCGCGGTGCCCATTTTCCGCAACAA
GCACCTCGTCGTCATTGGCGGCGGCGACTCGGCAGCCGAAGAGGCCACCTTTTTGACAAAGTATGCCAGCCACGT
CACCGTCTTGGTGCGCCGCGACGCCCTGCGTGCCAGCCGCACCATGGCGACGCGCCTACTGGCCCATCCCAAGGT
GACGGTGCGCTTCAAGACGCAGGCCGTCGAGGTGCGCGGCGGAGAGGATGGCCTCATGAGCCACTTGGTTGTGAG
CGACGCCAACGGCAAGCAAGAGGTGCTCGAGGCAAATGGCCTCTTTTACGCAATTGGCCACGATCCAGCTACGGC
GCTTGTCCGCAATCAGGTCGACATGGATGCCGACGGCTACATCAAGACGACGCCGGGGTCTACGCTGACGAGCGT
CGACGGCGTCTTTGCGGCTGGCGACGTCCAGGACAAGCGTTATCGCCAGGCCATTACCAGCGCAGGTATGTCGCC
CTCTGCCTTGTCACCCTGCCGTGTCGCCCCTCTTGTTGGCTAACCGTCCATGTGCCAGGCACCGGATGCATGGCT
GCCCTTGACGCTGAAAAGTTCTTGGCCGACCATGAAATCGACCACAGGGAATCCTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail