Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|4386
Gene name
LocationContig_3:29015..30834
Strand+
Gene length (bp)1819
Transcript length (bp)1614
Coding sequence length (bp)1614
Protein length (aa) 538

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00478 IMPDH IMP dehydrogenase / GMP reductase domain 1.0E-127 42 526
PF00571 CBS CBS domain 2.3E-03 130 176
PF00571 CBS CBS domain 4.6E-06 186 238
PF01070 FMN_dh FMN-dependent dehydrogenase 7.9E-07 282 400

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q7SFX7|IMDH_NEUCR Inosine-5'-monophosphate dehydrogenase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=NCU03117 PE=3 SV=1 2 537 0.0E+00
sp|Q4WHZ9|IMDH_ASPFU Inosine-5'-monophosphate dehydrogenase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=AFUA_2G03610 PE=3 SV=1 8 537 0.0E+00
sp|P50094|IMDH4_YEAST Inosine-5'-monophosphate dehydrogenase 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=IMD4 PE=1 SV=1 6 536 0.0E+00
sp|Q5KP44|IMDH_CRYNJ Inosine-5'-monophosphate dehydrogenase OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=CNA04240 PE=3 SV=1 1 537 0.0E+00
sp|O00086|IMDH_CANAX Inosine-5'-monophosphate dehydrogenase OS=Candida albicans GN=IMH3 PE=2 SV=1 10 536 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q7SFX7|IMDH_NEUCR Inosine-5'-monophosphate dehydrogenase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=NCU03117 PE=3 SV=1 2 537 0.0E+00
sp|Q4WHZ9|IMDH_ASPFU Inosine-5'-monophosphate dehydrogenase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=AFUA_2G03610 PE=3 SV=1 8 537 0.0E+00
sp|P50094|IMDH4_YEAST Inosine-5'-monophosphate dehydrogenase 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=IMD4 PE=1 SV=1 6 536 0.0E+00
sp|Q5KP44|IMDH_CRYNJ Inosine-5'-monophosphate dehydrogenase OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=CNA04240 PE=3 SV=1 1 537 0.0E+00
sp|O00086|IMDH_CANAX Inosine-5'-monophosphate dehydrogenase OS=Candida albicans GN=IMH3 PE=2 SV=1 10 536 0.0E+00
sp|Q59Q46|IMDH_CANAL Inosine-5'-monophosphate dehydrogenase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=IMH3 PE=1 SV=2 10 536 0.0E+00
sp|P50095|IMDH3_YEAST Inosine-5'-monophosphate dehydrogenase 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=IMD3 PE=1 SV=1 8 536 0.0E+00
sp|P38697|IMDH2_YEAST Inosine-5'-monophosphate dehydrogenase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=IMD2 PE=1 SV=1 8 536 0.0E+00
sp|Q12658|IMDH_PNECA Inosine-5'-monophosphate dehydrogenase OS=Pneumocystis carinii GN=GUA1 PE=1 SV=2 18 537 0.0E+00
sp|O14344|IMDH_SCHPO Inosine-5'-monophosphate dehydrogenase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gua1 PE=2 SV=1 13 536 0.0E+00
sp|P20839|IMDH1_HUMAN Inosine-5'-monophosphate dehydrogenase 1 OS=Homo sapiens GN=IMPDH1 PE=1 SV=2 23 536 0.0E+00
sp|A0JNA3|IMDH1_BOVIN Inosine-5'-monophosphate dehydrogenase 1 OS=Bos taurus GN=IMPDH1 PE=2 SV=2 23 536 0.0E+00
sp|P50096|IMDH1_MOUSE Inosine-5'-monophosphate dehydrogenase 1 OS=Mus musculus GN=Impdh1 PE=1 SV=2 23 536 0.0E+00
sp|D3ZLZ7|IMDH1_RAT Inosine-5'-monophosphate dehydrogenase 1 OS=Rattus norvegicus GN=Impdh1 PE=3 SV=1 23 536 0.0E+00
sp|Q5RGV1|IMDH3_DANRE Inosine-5'-monophosphate dehydrogenase 1b OS=Danio rerio GN=impdh1b PE=2 SV=1 23 536 0.0E+00
sp|P12268|IMDH2_HUMAN Inosine-5'-monophosphate dehydrogenase 2 OS=Homo sapiens GN=IMPDH2 PE=1 SV=2 21 536 0.0E+00
sp|F6S675|IMDH1_XENTR Inosine-5'-monophosphate dehydrogenase 1 OS=Xenopus tropicalis GN=impdh1 PE=3 SV=1 23 536 0.0E+00
sp|P24547|IMDH2_MOUSE Inosine-5'-monophosphate dehydrogenase 2 OS=Mus musculus GN=Impdh2 PE=1 SV=2 21 536 0.0E+00
sp|Q3SWY3|IMDH2_BOVIN Inosine-5'-monophosphate dehydrogenase 2 OS=Bos taurus GN=IMPDH2 PE=2 SV=1 21 536 0.0E+00
sp|E9PU28|IMDH2_RAT Inosine-5'-monophosphate dehydrogenase 2 OS=Rattus norvegicus GN=Impdh2 PE=1 SV=1 21 536 0.0E+00
sp|P12269|IMDH2_CRIGR Inosine-5'-monophosphate dehydrogenase 2 OS=Cricetulus griseus GN=IMPDH2 PE=1 SV=1 21 536 0.0E+00
sp|B0UXP9|IMDH2_DANRE Inosine-5'-monophosphate dehydrogenase 2 OS=Danio rerio GN=impdh2 PE=3 SV=1 23 536 0.0E+00
sp|Q6GMG5|IMDH1_DANRE Inosine-5'-monophosphate dehydrogenase 1a OS=Danio rerio GN=impdh1a PE=2 SV=1 23 527 0.0E+00
sp|Q07152|IMDH_DROME Inosine-5'-monophosphate dehydrogenase OS=Drosophila melanogaster GN=ras PE=1 SV=1 24 536 0.0E+00
sp|F7CYY5|IMDH2_XENTR Inosine-5'-monophosphate dehydrogenase 2 OS=Xenopus tropicalis GN=impdh2 PE=3 SV=1 21 536 0.0E+00
sp|Q54QQ0|IMDH_DICDI Inosine-5'-monophosphate dehydrogenase OS=Dictyostelium discoideum GN=impdh PE=1 SV=1 21 535 0.0E+00
sp|Q8F4Q4|IMDH_LEPIN Inosine-5'-monophosphate dehydrogenase OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601) GN=guaB PE=3 SV=1 21 527 1.0E-179
sp|Q4VRV8|IMDH_TOXGO Inosine-5'-monophosphate dehydrogenase OS=Toxoplasma gondii PE=1 SV=1 27 537 2.0E-178
sp|P39567|IMDH1_YEAST Putative inosine-5'-monophosphate dehydrogenase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=IMD1 PE=5 SV=1 8 378 8.0E-161
sp|P21620|IMDH_LEIDO Inosine-5'-monophosphate dehydrogenase OS=Leishmania donovani PE=1 SV=1 26 537 8.0E-160
sp|P50098|IMDH_TRYBB Inosine-5'-monophosphate dehydrogenase OS=Trypanosoma brucei brucei PE=3 SV=1 26 537 7.0E-156
sp|Q9GZH3|IMDH_CAEEL Inosine-5'-monophosphate dehydrogenase OS=Caenorhabditis elegans GN=T22D1.3 PE=3 SV=2 27 536 2.0E-155
sp|Q84XA3|IMDH_VIGUN Inosine-5'-monophosphate dehydrogenase OS=Vigna unguiculata GN=impdh PE=1 SV=1 44 536 2.0E-124
sp|Q9SA34|IMDH2_ARATH Inosine-5'-monophosphate dehydrogenase 2 OS=Arabidopsis thaliana GN=At1g16350 PE=1 SV=1 44 536 3.0E-122
sp|P47996|IMDH1_ARATH Inosine-5'-monophosphate dehydrogenase 1 OS=Arabidopsis thaliana GN=IMPDH PE=2 SV=1 44 536 3.0E-115
sp|O67820|IMDH_AQUAE Inosine-5'-monophosphate dehydrogenase OS=Aquifex aeolicus (strain VF5) GN=guaB PE=3 SV=1 42 506 2.0E-108
sp|O50316|IMDH_CHLP8 Inosine-5'-monophosphate dehydrogenase OS=Chlorobaculum parvum (strain NCIB 8327) GN=guaB PE=3 SV=3 35 522 3.0E-105
sp|Q9KGN8|IMDH_BACHD Inosine-5'-monophosphate dehydrogenase OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=guaB PE=3 SV=1 42 505 4.0E-103
sp|P21879|IMDH_BACSU Inosine-5'-monophosphate dehydrogenase OS=Bacillus subtilis (strain 168) GN=guaB PE=1 SV=2 42 506 3.0E-102
sp|Q8CMQ7|IMDH_STAES Inosine-5'-monophosphate dehydrogenase OS=Staphylococcus epidermidis (strain ATCC 12228) GN=guaB PE=3 SV=1 43 506 2.0E-101
sp|Q5HRX2|IMDH_STAEQ Inosine-5'-monophosphate dehydrogenase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=guaB PE=3 SV=1 43 506 2.0E-101
sp|Q6GC82|IMDH_STAAS Inosine-5'-monophosphate dehydrogenase OS=Staphylococcus aureus (strain MSSA476) GN=guaB PE=3 SV=1 43 506 2.0E-99
sp|Q6GJQ7|IMDH_STAAR Inosine-5'-monophosphate dehydrogenase OS=Staphylococcus aureus (strain MRSA252) GN=guaB PE=3 SV=1 43 506 2.0E-99
sp|P99106|IMDH_STAAN Inosine-5'-monophosphate dehydrogenase OS=Staphylococcus aureus (strain N315) GN=guaB PE=1 SV=1 43 506 2.0E-99
sp|P65169|IMDH_STAAM Inosine-5'-monophosphate dehydrogenase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=guaB PE=3 SV=1 43 506 2.0E-99
sp|Q5HIQ7|IMDH_STAAC Inosine-5'-monophosphate dehydrogenase OS=Staphylococcus aureus (strain COL) GN=guaB PE=3 SV=1 43 506 2.0E-99
sp|Q2YVL6|IMDH_STAAB Inosine-5'-monophosphate dehydrogenase OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=guaB PE=3 SV=1 43 506 2.0E-99
sp|Q2G0Y7|IMDH_STAA8 Inosine-5'-monophosphate dehydrogenase OS=Staphylococcus aureus (strain NCTC 8325) GN=guaB PE=3 SV=1 43 506 2.0E-99
sp|Q2FJM6|IMDH_STAA3 Inosine-5'-monophosphate dehydrogenase OS=Staphylococcus aureus (strain USA300) GN=guaB PE=3 SV=1 43 506 2.0E-99
sp|Q8NY70|IMDH_STAAW Inosine-5'-monophosphate dehydrogenase OS=Staphylococcus aureus (strain MW2) GN=guaB PE=3 SV=1 43 506 1.0E-98
sp|Q7UJL3|IMDH_RHOBA Inosine-5'-monophosphate dehydrogenase OS=Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1) GN=guaB PE=3 SV=1 42 525 1.0E-98
sp|Q49UU8|IMDH_STAS1 Inosine-5'-monophosphate dehydrogenase OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=guaB PE=3 SV=1 43 506 2.0E-98
sp|Q4L385|IMDH_STAHJ Inosine-5'-monophosphate dehydrogenase OS=Staphylococcus haemolyticus (strain JCSC1435) GN=guaB PE=3 SV=1 43 506 4.0E-98
sp|Q8KCW4|IMDH_CHLTE Inosine-5'-monophosphate dehydrogenase OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) GN=guaB PE=3 SV=1 35 522 3.0E-97
sp|Q8G3N6|IMDH_BIFLO Inosine-5'-monophosphate dehydrogenase OS=Bifidobacterium longum (strain NCC 2705) GN=guaB PE=3 SV=1 42 504 6.0E-96
sp|P0DB89|IMDH_STRPQ Inosine-5'-monophosphate dehydrogenase OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=guaB PE=3 SV=1 42 506 1.0E-92
sp|P0DB88|IMDH_STRP3 Inosine-5'-monophosphate dehydrogenase OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=guaB PE=3 SV=1 42 506 1.0E-92
sp|P0C0H6|IMDH_STRPY Inosine-5'-monophosphate dehydrogenase OS=Streptococcus pyogenes GN=guaB PE=1 SV=2 42 506 1.0E-92
sp|P68839|IMDH_STRP8 Inosine-5'-monophosphate dehydrogenase OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=guaB PE=3 SV=2 42 506 1.0E-92
sp|Q5X9A3|IMDH_STRP6 Inosine-5'-monophosphate dehydrogenase OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=guaB PE=1 SV=3 42 506 1.0E-92
sp|P0C0H7|IMDH_STRP1 Inosine-5'-monophosphate dehydrogenase OS=Streptococcus pyogenes serotype M1 GN=guaB PE=3 SV=2 42 506 1.0E-92
sp|P56088|IMDH_HELPY Inosine-5'-monophosphate dehydrogenase OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=guaB PE=3 SV=1 43 506 5.0E-92
sp|Q9ZL14|IMDH_HELPJ Inosine-5'-monophosphate dehydrogenase OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=guaB PE=3 SV=1 43 506 2.0E-91
sp|Q9HLK8|IMDH_THEAC Inosine-5'-monophosphate dehydrogenase OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=guaB PE=3 SV=1 42 505 2.0E-91
sp|P31002|IMDH_ACICA Inosine-5'-monophosphate dehydrogenase OS=Acinetobacter calcoaceticus GN=guaB PE=3 SV=1 35 527 5.0E-90
sp|P9WKI7|IMDH_MYCTU Inosine-5'-monophosphate dehydrogenase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=guaB PE=1 SV=1 42 505 3.0E-89
sp|P9WKI6|IMDH_MYCTO Inosine-5'-monophosphate dehydrogenase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=guaB PE=3 SV=1 42 505 3.0E-89
sp|P65168|IMDH_MYCBO Inosine-5'-monophosphate dehydrogenase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=guaB PE=3 SV=1 42 505 3.0E-89
sp|A9A5Y7|IMDH_NITMS Inosine-5'-monophosphate dehydrogenase OS=Nitrosopumilus maritimus (strain SCM1) GN=guaB PE=3 SV=1 42 506 2.0E-88
sp|Q49729|IMDH_MYCLE Inosine-5'-monophosphate dehydrogenase OS=Mycobacterium leprae (strain TN) GN=guaB PE=3 SV=1 42 505 7.0E-87
sp|Q9L6B7|IMDH_PASMU Inosine-5'-monophosphate dehydrogenase OS=Pasteurella multocida (strain Pm70) GN=guaB PE=3 SV=1 43 506 3.0E-83
sp|Q9KH33|IMDH_RHITR Inosine-5'-monophosphate dehydrogenase OS=Rhizobium tropici GN=guaB PE=3 SV=1 24 506 4.0E-82
sp|E9BDA8|GMPR_LEIDB GMP reductase OS=Leishmania donovani (strain BPK282A1) GN=GMPR PE=1 SV=1 42 523 8.0E-81
sp|Q4QEB3|GMPR_LEIMA GMP reductase OS=Leishmania major GN=GMPR PE=1 SV=2 42 523 4.0E-80
sp|Q0WD32|IMDH_YERPE Inosine-5'-monophosphate dehydrogenase OS=Yersinia pestis GN=guaB PE=3 SV=1 43 506 7.0E-80
sp|Q59011|IMDH_METJA Inosine-5'-monophosphate dehydrogenase OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=guaB PE=3 SV=1 44 525 1.0E-79
sp|P44334|IMDH_HAEIN Inosine-5'-monophosphate dehydrogenase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=guaB PE=3 SV=1 39 506 1.0E-78
sp|Q9UY49|IMDH_PYRAB Inosine-5'-monophosphate dehydrogenase OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=guaB PE=3 SV=1 42 505 5.0E-78
sp|O58045|IMDH_PYRHO Inosine-5'-monophosphate dehydrogenase OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=guaB PE=1 SV=1 42 505 1.0E-77
sp|P42851|IMDH_PYRFU Inosine-5'-monophosphate dehydrogenase OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=guaB PE=3 SV=1 42 505 4.0E-77
sp|P0ADG9|IMDH_SHIFL Inosine-5'-monophosphate dehydrogenase OS=Shigella flexneri GN=guaB PE=3 SV=1 43 506 1.0E-75
sp|P0ADG7|IMDH_ECOLI Inosine-5'-monophosphate dehydrogenase OS=Escherichia coli (strain K12) GN=guaB PE=1 SV=1 43 506 1.0E-75
sp|P0ADG8|IMDH_ECO57 Inosine-5'-monophosphate dehydrogenase OS=Escherichia coli O157:H7 GN=guaB PE=3 SV=1 43 506 1.0E-75
sp|B1L5U5|IMDH_KORCO Inosine-5'-monophosphate dehydrogenase OS=Korarchaeum cryptofilum (strain OPF8) GN=guaB PE=3 SV=1 43 511 1.0E-71
sp|Q9HQU4|IMDH_HALSA Inosine-5'-monophosphate dehydrogenase OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=guaB PE=3 SV=2 43 525 3.0E-58
sp|O42831|YA075_YEAST Putative inosine-5'-monophosphate dehydrogenase-like protein YAR075W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YAR075W PE=5 SV=1 378 536 8.0E-54
sp|P50097|IMDH_TRIFO Inosine-5'-monophosphate dehydrogenase OS=Tritrichomonas foetus GN=IMPDH PE=1 SV=1 44 506 9.0E-51
sp|Q8T6T2|IMDH_CRYPV Inosine-5'-monophosphate dehydrogenase OS=Cryptosporidium parvum GN=56k.02 PE=1 SV=1 253 507 9.0E-46
sp|P49058|IMDH_BORBU Inosine-5'-monophosphate dehydrogenase OS=Borrelia burgdorferi (strain ATCC 35210 / B31 / CIP 102532 / DSM 4680) GN=guaB PE=1 SV=1 225 502 4.0E-43
sp|P65173|Y1874_MYCBO Uncharacterized oxidoreductase Mb1874c OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=Mb1874c PE=3 SV=1 43 510 5.0E-35
sp|P9WKI3|Y1843_MYCTU Uncharacterized oxidoreductase Rv1843c OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=guaB1 PE=1 SV=1 43 510 5.0E-35
sp|P9WKI2|Y1843_MYCTO Uncharacterized oxidoreductase MT1891 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=guaB1 PE=3 SV=1 43 510 5.0E-35
sp|O32912|Y2066_MYCLE Uncharacterized oxidoreductase ML2066 OS=Mycobacterium leprae (strain TN) GN=ML2066 PE=3 SV=1 43 510 7.0E-32
sp|Q9NJD8|GMPR_ONCVO GMP reductase OS=Onchocerca volvulus GN=gmr-1 PE=2 SV=1 239 506 7.0E-27
sp|Q04CB0|GUAC_LACDB GMP reductase OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC BAA-365) GN=guaC PE=3 SV=1 233 427 1.0E-26
sp|Q1GBV3|GUAC_LACDA GMP reductase OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC 11842 / DSM 20081 / JCM 1002 / NBRC 13953 / NCIMB 11778) GN=guaC PE=3 SV=1 233 427 1.0E-26
sp|Q9P2T1|GMPR2_HUMAN GMP reductase 2 OS=Homo sapiens GN=GMPR2 PE=1 SV=1 257 458 5.0E-26
sp|Q99L27|GMPR2_MOUSE GMP reductase 2 OS=Mus musculus GN=Gmpr2 PE=1 SV=2 225 437 6.0E-26
sp|Q9DCZ1|GMPR1_MOUSE GMP reductase 1 OS=Mus musculus GN=Gmpr PE=1 SV=1 244 506 2.0E-25
sp|P36959|GMPR1_HUMAN GMP reductase 1 OS=Homo sapiens GN=GMPR PE=1 SV=1 225 506 2.0E-25
sp|Q5WD10|GUAC_BACSK GMP reductase OS=Bacillus clausii (strain KSM-K16) GN=guaC PE=3 SV=1 217 441 2.0E-25
sp|Q32L93|GMPR2_BOVIN GMP reductase 2 OS=Bos taurus GN=GMPR2 PE=2 SV=1 239 458 3.0E-25
sp|Q814I1|GUAC_BACCR GMP reductase OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=guaC PE=3 SV=1 215 441 5.0E-25
sp|P59075|GMPR_PHYIN GMP reductase OS=Phytophthora infestans PE=2 SV=1 261 499 5.0E-25
sp|Q630E8|GUAC_BACCZ GMP reductase OS=Bacillus cereus (strain ZK / E33L) GN=guaC PE=3 SV=1 215 441 1.0E-24
sp|Q6HAI0|GUAC_BACHK GMP reductase OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=guaC PE=3 SV=1 215 441 1.0E-24
sp|Q72WY4|GUAC_BACC1 GMP reductase OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=guaC PE=3 SV=1 215 441 1.0E-24
sp|Q81JJ9|GUAC_BACAN GMP reductase OS=Bacillus anthracis GN=guaC PE=1 SV=1 215 441 1.0E-24
sp|Q5FHY3|GUAC_LACAC GMP reductase OS=Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM) GN=guaC PE=3 SV=1 247 427 1.0E-24
sp|Q8ERJ2|GUAC_OCEIH GMP reductase OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=guaC PE=3 SV=1 217 441 2.0E-24
sp|A0RLN5|GUAC_BACAH GMP reductase OS=Bacillus thuringiensis (strain Al Hakam) GN=guaC PE=3 SV=1 215 441 2.0E-24
sp|C4LAB3|GUAC_TOLAT GMP reductase OS=Tolumonas auensis (strain DSM 9187 / TA4) GN=guaC PE=3 SV=1 256 437 2.0E-24
sp|O05269|GUAC_BACSU GMP reductase OS=Bacillus subtilis (strain 168) GN=guaC PE=2 SV=2 217 441 3.0E-24
sp|B9DP67|GUAC_STACT GMP reductase OS=Staphylococcus carnosus (strain TM300) GN=guaC PE=3 SV=1 214 504 3.0E-24
sp|Q04GD9|GUAC_OENOB GMP reductase OS=Oenococcus oeni (strain ATCC BAA-331 / PSU-1) GN=guaC PE=3 SV=1 217 427 3.0E-24
sp|Q9Z244|GMPR1_RAT GMP reductase 1 OS=Rattus norvegicus GN=Gmpr PE=2 SV=1 240 506 5.0E-24
sp|Q65LF6|GUAC_BACLD GMP reductase OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=guaC PE=3 SV=1 217 441 5.0E-24
sp|P27442|GMPR_ASCSU GMP reductase OS=Ascaris suum PE=2 SV=1 253 506 6.0E-24
sp|Q03TT0|GUAC_LACBA GMP reductase OS=Lactobacillus brevis (strain ATCC 367 / JCM 1170) GN=guaC PE=3 SV=1 251 427 7.0E-24
sp|A7Z8C3|GUAC_BACMF GMP reductase OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=guaC PE=3 SV=1 217 441 7.0E-24
sp|Q97DK4|GUAC_CLOAB GMP reductase OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=guaC PE=3 SV=1 251 441 1.0E-23
sp|B5Z7L6|GUAC_HELPG GMP reductase OS=Helicobacter pylori (strain G27) GN=guaC PE=3 SV=1 217 441 2.0E-23
sp|Q6GH69|GUAC_STAAR GMP reductase OS=Staphylococcus aureus (strain MRSA252) GN=guaC PE=3 SV=1 214 502 3.0E-23
sp|O16294|GMPR_CAEEL GMP reductase OS=Caenorhabditis elegans GN=F32D1.5 PE=3 SV=1 257 506 4.0E-23
sp|B1HNS5|GUAC_LYSSC GMP reductase OS=Lysinibacillus sphaericus (strain C3-41) GN=guaC PE=3 SV=1 217 441 5.0E-23
sp|A6QGN9|GUAC_STAAE GMP reductase OS=Staphylococcus aureus (strain Newman) GN=guaC PE=3 SV=1 214 502 5.0E-23
sp|Q5HG83|GUAC_STAAC GMP reductase OS=Staphylococcus aureus (strain COL) GN=guaC PE=3 SV=1 214 502 5.0E-23
sp|Q2FYU4|GUAC_STAA8 GMP reductase OS=Staphylococcus aureus (strain NCTC 8325) GN=guaC PE=3 SV=1 214 502 5.0E-23
sp|Q2FH96|GUAC_STAA3 GMP reductase OS=Staphylococcus aureus (strain USA300) GN=guaC PE=3 SV=1 214 502 5.0E-23
sp|P60564|GUAC_STAAW GMP reductase OS=Staphylococcus aureus (strain MW2) GN=guaC PE=3 SV=1 214 502 6.0E-23
sp|Q6G9M1|GUAC_STAAS GMP reductase OS=Staphylococcus aureus (strain MSSA476) GN=guaC PE=3 SV=1 214 502 6.0E-23
sp|P60563|GUAC_STAAN GMP reductase OS=Staphylococcus aureus (strain N315) GN=guaC PE=1 SV=1 214 502 6.0E-23
sp|P60562|GUAC_STAAM GMP reductase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=guaC PE=3 SV=1 214 502 6.0E-23
sp|A5ISL9|GUAC_STAA9 GMP reductase OS=Staphylococcus aureus (strain JH9) GN=guaC PE=3 SV=1 214 502 6.0E-23
sp|A6U1F7|GUAC_STAA2 GMP reductase OS=Staphylococcus aureus (strain JH1) GN=guaC PE=3 SV=1 214 502 6.0E-23
sp|A7X1Z1|GUAC_STAA1 GMP reductase OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=guaC PE=3 SV=1 214 502 6.0E-23
sp|Q045S8|GUAC_LACGA GMP reductase OS=Lactobacillus gasseri (strain ATCC 33323 / DSM 20243 / JCM 1131 / NCIMB 11718 / AM63) GN=guaC PE=3 SV=1 247 427 6.0E-23
sp|O25525|GUAC_HELPY GMP reductase OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=guaC PE=3 SV=1 217 441 6.0E-23
sp|P60565|GUAC_LACJO GMP reductase OS=Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533) GN=guaC PE=3 SV=1 233 427 7.0E-23
sp|B8D7A8|GUAC_BUCAT GMP reductase OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain Tuc7) GN=guaC PE=3 SV=1 259 502 9.0E-23
sp|Q2YXS9|GUAC_STAAB GMP reductase OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=guaC PE=3 SV=1 214 502 9.0E-23
sp|P0DB91|GUAC_STRPQ GMP reductase OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=guaC PE=3 SV=1 182 427 1.0E-22
sp|Q1JGV8|GUAC_STRPD GMP reductase OS=Streptococcus pyogenes serotype M2 (strain MGAS10270) GN=guaC PE=3 SV=2 182 427 1.0E-22
sp|P0DB90|GUAC_STRP3 GMP reductase OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=guaC PE=3 SV=1 182 427 1.0E-22
sp|Q9ZKZ2|GUAC_HELPJ GMP reductase OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=guaC PE=3 SV=1 217 441 1.0E-22
sp|B0TQE1|GUAC_SHEHH GMP reductase OS=Shewanella halifaxensis (strain HAW-EB4) GN=guaC PE=3 SV=1 261 502 1.0E-22
sp|Q99ZQ1|GUAC_STRP1 GMP reductase OS=Streptococcus pyogenes serotype M1 GN=guaC PE=3 SV=1 182 427 1.0E-22
sp|B5XLI1|GUAC_STRPZ GMP reductase OS=Streptococcus pyogenes serotype M49 (strain NZ131) GN=guaC PE=3 SV=1 182 427 1.0E-22
sp|Q1J6M7|GUAC_STRPF GMP reductase OS=Streptococcus pyogenes serotype M4 (strain MGAS10750) GN=guaC PE=3 SV=2 182 441 2.0E-22
sp|Q1JLQ8|GUAC_STRPC GMP reductase OS=Streptococcus pyogenes serotype M12 (strain MGAS9429) GN=guaC PE=3 SV=2 182 441 2.0E-22
sp|Q1JBS5|GUAC_STRPB GMP reductase OS=Streptococcus pyogenes serotype M12 (strain MGAS2096) GN=guaC PE=3 SV=2 182 441 2.0E-22
sp|Q5XC75|GUAC_STRP6 GMP reductase OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=guaC PE=3 SV=2 182 441 2.0E-22
sp|Q48TL6|GUAC_STRPM GMP reductase OS=Streptococcus pyogenes serotype M28 (strain MGAS6180) GN=guaC PE=3 SV=2 182 427 2.0E-22
sp|B2USX4|GUAC_HELPS GMP reductase OS=Helicobacter pylori (strain Shi470) GN=guaC PE=3 SV=1 217 441 2.0E-22
sp|A8HAF6|GUAC_SHEPA GMP reductase OS=Shewanella pealeana (strain ATCC 700345 / ANG-SQ1) GN=guaC PE=3 SV=1 261 502 3.0E-22
sp|Q1WT04|GUAC_LACS1 GMP reductase OS=Lactobacillus salivarius (strain UCC118) GN=guaC PE=3 SV=1 195 427 3.0E-22
sp|Q8DZL4|GUAC_STRA5 GMP reductase OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=guaC PE=3 SV=1 252 427 3.0E-22
sp|Q8P129|GUAC_STRP8 GMP reductase OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=guaC PE=3 SV=1 217 441 4.0E-22
sp|P57300|GUAC_BUCAI GMP reductase OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=guaC PE=3 SV=1 259 502 4.0E-22
sp|B8D903|GUAC_BUCA5 GMP reductase OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain 5A) GN=guaC PE=3 SV=1 259 502 4.0E-22
sp|Q1CT17|GUAC_HELPH GMP reductase OS=Helicobacter pylori (strain HPAG1) GN=guaC PE=3 SV=1 241 441 6.0E-22
sp|C0MF02|GUAC_STRS7 GMP reductase OS=Streptococcus equi subsp. zooepidemicus (strain H70) GN=guaC PE=3 SV=1 182 427 6.0E-22
sp|B1YH73|GUAC_EXIS2 GMP reductase OS=Exiguobacterium sibiricum (strain DSM 17290 / JCM 13490 / 255-15) GN=guaC PE=3 SV=1 214 441 6.0E-22
sp|C0MAM1|GUAC_STRE4 GMP reductase OS=Streptococcus equi subsp. equi (strain 4047) GN=guaC PE=3 SV=1 182 427 6.0E-22
sp|Q5DZN1|GUAC_VIBF1 GMP reductase OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=guaC PE=3 SV=1 278 502 7.0E-22
sp|B6ERC3|GUAC_ALISL GMP reductase OS=Aliivibrio salmonicida (strain LFI1238) GN=guaC PE=3 SV=1 278 502 7.0E-22
sp|Q3K110|GUAC_STRA1 GMP reductase OS=Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700) GN=guaC PE=3 SV=1 182 427 8.0E-22
sp|Q8E578|GUAC_STRA3 GMP reductase OS=Streptococcus agalactiae serotype III (strain NEM316) GN=guaC PE=3 SV=1 252 427 9.0E-22
sp|B5EUG3|GUAC_VIBFM GMP reductase OS=Vibrio fischeri (strain MJ11) GN=guaC PE=3 SV=1 278 502 9.0E-22
sp|A2REI5|GUAC_STRPG GMP reductase OS=Streptococcus pyogenes serotype M5 (strain Manfredo) GN=guaC PE=3 SV=1 182 427 1.0E-21
sp|A4VUJ2|GUAC_STRSY GMP reductase OS=Streptococcus suis (strain 05ZYH33) GN=guaC PE=3 SV=2 182 427 1.0E-21
sp|A4W0T4|GUAC_STRS2 GMP reductase OS=Streptococcus suis (strain 98HAH33) GN=guaC PE=3 SV=2 182 427 1.0E-21
sp|Q7NTY1|GUAC_CHRVO GMP reductase OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=guaC PE=3 SV=1 254 504 1.0E-21
sp|B7VS90|GUAC_VIBTL GMP reductase OS=Vibrio tasmaniensis (strain LGP32) GN=guaC PE=3 SV=1 259 502 1.0E-21
sp|Q03GJ0|GUAC_PEDPA GMP reductase OS=Pediococcus pentosaceus (strain ATCC 25745 / 183-1w) GN=guaC PE=3 SV=1 252 427 2.0E-21
sp|Q831S1|GUAC_ENTFA GMP reductase OS=Enterococcus faecalis (strain ATCC 700802 / V583) GN=guaC PE=3 SV=1 217 441 2.0E-21
sp|Q8K9U0|GUAC_BUCAP GMP reductase OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=guaC PE=3 SV=1 258 432 2.0E-21
sp|Q87H06|GUAC_VIBPA GMP reductase OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=guaC PE=3 SV=1 278 502 2.0E-21
sp|A4W6K6|GUAC_ENT38 GMP reductase OS=Enterobacter sp. (strain 638) GN=guaC PE=3 SV=1 266 437 2.0E-21
sp|Q38YF0|GUAC_LACSS GMP reductase OS=Lactobacillus sakei subsp. sakei (strain 23K) GN=guaC PE=3 SV=1 213 504 2.0E-21
sp|B9DS39|GUAC_STRU0 GMP reductase OS=Streptococcus uberis (strain ATCC BAA-854 / 0140J) GN=guaC PE=3 SV=1 182 427 3.0E-21
sp|B1IC44|GUAC_STRPI GMP reductase OS=Streptococcus pneumoniae (strain Hungary19A-6) GN=guaC PE=3 SV=1 182 427 3.0E-21
sp|A8AXD6|GUAC_STRGC GMP reductase OS=Streptococcus gordonii (strain Challis / ATCC 35105 / CH1 / DL1 / V288) GN=guaC PE=3 SV=1 217 427 3.0E-21
sp|Q6LGK4|GUAC_PHOPR GMP reductase OS=Photobacterium profundum GN=guaC PE=3 SV=1 278 506 3.0E-21
sp|B8ZJR9|GUAC_STRPJ GMP reductase OS=Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1) GN=guaC PE=3 SV=1 182 427 4.0E-21
sp|Q21U05|GUAC_RHOFT GMP reductase OS=Rhodoferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118) GN=guaC PE=3 SV=1 251 427 4.0E-21
sp|C1CR55|GUAC_STRZT GMP reductase OS=Streptococcus pneumoniae (strain Taiwan19F-14) GN=guaC PE=3 SV=1 182 427 4.0E-21
sp|C1CKY8|GUAC_STRZP GMP reductase OS=Streptococcus pneumoniae (strain P1031) GN=guaC PE=3 SV=1 182 427 4.0E-21
sp|P59443|GUAC_BUCBP GMP reductase OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=guaC PE=3 SV=1 261 502 5.0E-21
sp|Q49XD2|GUAC_STAS1 GMP reductase OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=guaC PE=3 SV=1 217 504 7.0E-21
sp|Q8DPJ7|GUAC_STRR6 GMP reductase OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=guaC PE=3 SV=1 182 427 7.0E-21
sp|C1C7M7|GUAC_STRP7 GMP reductase OS=Streptococcus pneumoniae (strain 70585) GN=guaC PE=3 SV=1 182 427 7.0E-21
sp|Q04K71|GUAC_STRP2 GMP reductase OS=Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) GN=guaC PE=3 SV=1 182 427 7.0E-21
sp|C1CEK5|GUAC_STRZJ GMP reductase OS=Streptococcus pneumoniae (strain JJA) GN=guaC PE=3 SV=1 182 427 8.0E-21
sp|C4L088|GUAC_EXISA GMP reductase OS=Exiguobacterium sp. (strain ATCC BAA-1283 / AT1b) GN=guaC PE=3 SV=1 217 441 8.0E-21
sp|A7N204|GUAC_VIBCB GMP reductase OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120) GN=guaC PE=3 SV=1 280 502 1.0E-20
sp|Q97QG5|GUAC_STRPN GMP reductase OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=guaC PE=3 SV=1 182 427 1.0E-20
sp|Q8CPC9|GUAC_STAES GMP reductase OS=Staphylococcus epidermidis (strain ATCC 12228) GN=guaC PE=3 SV=1 217 441 1.0E-20
sp|Q5HPK5|GUAC_STAEQ GMP reductase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=guaC PE=3 SV=1 217 441 1.0E-20
sp|A8G9U1|GUAC_SERP5 GMP reductase OS=Serratia proteamaculans (strain 568) GN=guaC PE=3 SV=1 225 437 1.0E-20
sp|B5E4Y3|GUAC_STRP4 GMP reductase OS=Streptococcus pneumoniae serotype 19F (strain G54) GN=guaC PE=3 SV=1 182 427 1.0E-20
sp|Q7MD57|GUAC_VIBVY GMP reductase OS=Vibrio vulnificus (strain YJ016) GN=guaC PE=3 SV=2 278 502 1.0E-20
sp|Q8D632|GUAC_VIBVU GMP reductase OS=Vibrio vulnificus (strain CMCP6) GN=guaC PE=3 SV=1 278 502 1.0E-20
sp|B2IPN4|GUAC_STRPS GMP reductase OS=Streptococcus pneumoniae (strain CGSP14) GN=guaC PE=3 SV=1 182 427 2.0E-20
sp|A1VMA8|GUAC_POLNA GMP reductase OS=Polaromonas naphthalenivorans (strain CJ2) GN=guaC PE=3 SV=1 251 427 2.0E-20
sp|C3LUL9|GUAC_VIBCM GMP reductase OS=Vibrio cholerae serotype O1 (strain M66-2) GN=guaC PE=3 SV=1 278 502 2.0E-20
sp|Q9KMW9|GUAC_VIBCH GMP reductase OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=guaC PE=3 SV=1 278 502 2.0E-20
sp|A5EYL9|GUAC_VIBC3 GMP reductase OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=guaC PE=3 SV=1 278 502 2.0E-20
sp|Q4L646|GUAC_STAHJ GMP reductase OS=Staphylococcus haemolyticus (strain JCSC1435) GN=guaC PE=3 SV=1 214 427 2.0E-20
sp|A0KN65|GUAC_AERHH GMP reductase OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=guaC PE=3 SV=1 259 502 2.0E-20
sp|A6T4P6|GUAC_KLEP7 GMP reductase OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=guaC PE=3 SV=1 259 431 2.0E-20
sp|B1XWM8|GUAC_LEPCP GMP reductase OS=Leptothrix cholodnii (strain ATCC 51168 / LMG 8142 / SP-6) GN=guaC PE=3 SV=1 214 427 3.0E-20
sp|Q03AR1|GUAC_LACC3 GMP reductase OS=Lactobacillus casei (strain ATCC 334) GN=guaC PE=3 SV=1 254 427 3.0E-20
sp|B5Y1T3|GUAC_KLEP3 GMP reductase OS=Klebsiella pneumoniae (strain 342) GN=guaC PE=3 SV=1 259 431 4.0E-20
sp|B3WCK9|GUAC_LACCB GMP reductase OS=Lactobacillus casei (strain BL23) GN=guaC PE=3 SV=1 254 427 7.0E-20
sp|Q02Z38|GUAC_LACLS GMP reductase OS=Lactococcus lactis subsp. cremoris (strain SK11) GN=guaC PE=3 SV=1 217 427 7.0E-20
sp|Q12CT8|GUAC_POLSJ GMP reductase OS=Polaromonas sp. (strain JS666 / ATCC BAA-500) GN=guaC PE=3 SV=1 251 427 8.0E-20
sp|A4SJY8|GUAC_AERS4 GMP reductase OS=Aeromonas salmonicida (strain A449) GN=guaC PE=3 SV=1 259 502 9.0E-20
sp|Q9CGF1|GUAC_LACLA GMP reductase OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=guaC PE=3 SV=1 217 427 1.0E-19
sp|A2RL29|GUAC_LACLM GMP reductase OS=Lactococcus lactis subsp. cremoris (strain MG1363) GN=guaC PE=3 SV=1 217 427 1.0E-19
sp|Q88SV5|GUAC_LACPL GMP reductase OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=guaC PE=3 SV=1 214 427 2.0E-19
sp|B5YZD9|GUAC_ECO5E GMP reductase OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=guaC PE=3 SV=1 259 437 3.0E-19
sp|Q8X984|GUAC_ECO57 GMP reductase OS=Escherichia coli O157:H7 GN=guaC PE=3 SV=1 259 437 3.0E-19
sp|B7MNW1|GUAC_ECO81 GMP reductase OS=Escherichia coli O81 (strain ED1a) GN=guaC PE=3 SV=1 259 437 3.0E-19
sp|B7LWQ6|GUAC_ESCF3 GMP reductase OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=guaC PE=3 SV=1 225 437 4.0E-19
sp|A1JJK8|GUAC_YERE8 GMP reductase OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=guaC PE=3 SV=1 225 502 4.0E-19
sp|C5B9H0|GUAC_EDWI9 GMP reductase OS=Edwardsiella ictaluri (strain 93-146) GN=guaC PE=3 SV=1 261 502 5.0E-19
sp|B2U2A9|GUAC_SHIB3 GMP reductase OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=guaC PE=3 SV=1 259 437 5.0E-19
sp|B7N7X5|GUAC_ECOLU GMP reductase OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=guaC PE=3 SV=1 259 437 5.0E-19
sp|B7NI65|GUAC_ECO7I GMP reductase OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=guaC PE=3 SV=1 259 437 5.0E-19
sp|B1JK64|GUAC_YERPY GMP reductase OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=guaC PE=3 SV=1 225 502 5.0E-19
sp|Q66EJ0|GUAC_YERPS GMP reductase OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=guaC PE=3 SV=1 225 502 5.0E-19
sp|A4TPS6|GUAC_YERPP GMP reductase OS=Yersinia pestis (strain Pestoides F) GN=guaC PE=3 SV=1 225 502 5.0E-19
sp|Q1CLY8|GUAC_YERPN GMP reductase OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=guaC PE=3 SV=1 225 502 5.0E-19
sp|A9R1J4|GUAC_YERPG GMP reductase OS=Yersinia pestis bv. Antiqua (strain Angola) GN=guaC PE=3 SV=1 225 502 5.0E-19
sp|Q8ZBI2|GUAC_YERPE GMP reductase OS=Yersinia pestis GN=guaC PE=3 SV=1 225 502 5.0E-19
sp|B2K4G3|GUAC_YERPB GMP reductase OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=guaC PE=3 SV=1 225 502 5.0E-19
sp|Q1C3T0|GUAC_YERPA GMP reductase OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=guaC PE=3 SV=1 225 502 5.0E-19
sp|A7FM52|GUAC_YERP3 GMP reductase OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=guaC PE=3 SV=1 225 502 5.0E-19
sp|Q0T894|GUAC_SHIF8 GMP reductase OS=Shigella flexneri serotype 5b (strain 8401) GN=guaC PE=3 SV=1 259 437 5.0E-19
sp|Q326D1|GUAC_SHIBS GMP reductase OS=Shigella boydii serotype 4 (strain Sb227) GN=guaC PE=3 SV=1 259 437 5.0E-19
sp|Q8Z9F9|GUAC_SALTI GMP reductase OS=Salmonella typhi GN=guaC PE=3 SV=1 278 502 5.0E-19
sp|Q32JY8|GUAC_SHIDS GMP reductase OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=guaC PE=3 SV=1 259 437 6.0E-19
sp|B1LG40|GUAC_ECOSM GMP reductase OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=guaC PE=3 SV=1 259 432 6.0E-19
sp|Q3Z5Q5|GUAC_SHISS GMP reductase OS=Shigella sonnei (strain Ss046) GN=guaC PE=3 SV=1 259 437 6.0E-19
sp|Q1RG92|GUAC_ECOUT GMP reductase OS=Escherichia coli (strain UTI89 / UPEC) GN=guaC PE=3 SV=1 259 437 6.0E-19
sp|B6HZ81|GUAC_ECOSE GMP reductase OS=Escherichia coli (strain SE11) GN=guaC PE=3 SV=1 259 437 6.0E-19
sp|P60560|GUAC_ECOLI GMP reductase OS=Escherichia coli (strain K12) GN=guaC PE=1 SV=1 259 437 6.0E-19
sp|B1IQN5|GUAC_ECOLC GMP reductase OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=guaC PE=3 SV=1 259 437 6.0E-19
sp|P60561|GUAC_ECOL6 GMP reductase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=guaC PE=3 SV=1 259 437 6.0E-19
sp|Q0TLN6|GUAC_ECOL5 GMP reductase OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=guaC PE=3 SV=1 259 437 6.0E-19
sp|A1A7E7|GUAC_ECOK1 GMP reductase OS=Escherichia coli O1:K1 / APEC GN=guaC PE=3 SV=1 259 437 6.0E-19
sp|A7ZW55|GUAC_ECOHS GMP reductase OS=Escherichia coli O9:H4 (strain HS) GN=guaC PE=3 SV=1 259 437 6.0E-19
sp|B1XC80|GUAC_ECODH GMP reductase OS=Escherichia coli (strain K12 / DH10B) GN=guaC PE=3 SV=1 259 437 6.0E-19
sp|C4ZRJ8|GUAC_ECOBW GMP reductase OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=guaC PE=3 SV=1 259 437 6.0E-19
sp|B7M145|GUAC_ECO8A GMP reductase OS=Escherichia coli O8 (strain IAI1) GN=guaC PE=3 SV=1 259 437 6.0E-19
sp|B7LFX2|GUAC_ECO55 GMP reductase OS=Escherichia coli (strain 55989 / EAEC) GN=guaC PE=3 SV=1 259 437 6.0E-19
sp|B7MAM6|GUAC_ECO45 GMP reductase OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=guaC PE=3 SV=1 259 437 6.0E-19
sp|B7UIF3|GUAC_ECO27 GMP reductase OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=guaC PE=3 SV=1 259 437 6.0E-19
sp|B5RH79|GUAC_SALG2 GMP reductase OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=guaC PE=3 SV=1 278 502 6.0E-19
sp|C5CT60|GUAC_VARPS GMP reductase OS=Variovorax paradoxus (strain S110) GN=guaC PE=3 SV=1 251 427 6.0E-19
sp|B4TXJ0|GUAC_SALSV GMP reductase OS=Salmonella schwarzengrund (strain CVM19633) GN=guaC PE=3 SV=1 274 502 6.0E-19
sp|A9MZN3|GUAC_SALPB GMP reductase OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=guaC PE=3 SV=1 274 502 6.0E-19
sp|A9MQA3|GUAC_SALAR GMP reductase OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=guaC PE=3 SV=1 278 502 6.0E-19
sp|Q8ZRT5|GUAC_SALTY GMP reductase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=guaC PE=3 SV=1 278 502 6.0E-19
sp|B5BLD7|GUAC_SALPK GMP reductase OS=Salmonella paratyphi A (strain AKU_12601) GN=guaC PE=3 SV=1 278 502 6.0E-19
sp|Q5PDH8|GUAC_SALPA GMP reductase OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=guaC PE=3 SV=1 278 502 6.0E-19
sp|B4SU63|GUAC_SALNS GMP reductase OS=Salmonella newport (strain SL254) GN=guaC PE=3 SV=1 278 502 6.0E-19
sp|B4TJA0|GUAC_SALHS GMP reductase OS=Salmonella heidelberg (strain SL476) GN=guaC PE=3 SV=1 278 502 6.0E-19
sp|B5R2N9|GUAC_SALEP GMP reductase OS=Salmonella enteritidis PT4 (strain P125109) GN=guaC PE=3 SV=1 278 502 6.0E-19
sp|B5FI86|GUAC_SALDC GMP reductase OS=Salmonella dublin (strain CT_02021853) GN=guaC PE=3 SV=1 278 502 6.0E-19
sp|B5F7X8|GUAC_SALA4 GMP reductase OS=Salmonella agona (strain SL483) GN=guaC PE=3 SV=1 278 502 6.0E-19
sp|Q83SM9|GUAC_SHIFL GMP reductase OS=Shigella flexneri GN=guaC PE=3 SV=1 259 437 7.0E-19
sp|C0Q5K1|GUAC_SALPC GMP reductase OS=Salmonella paratyphi C (strain RKS4594) GN=guaC PE=3 SV=1 278 502 7.0E-19
sp|A7ZHJ5|GUAC_ECO24 GMP reductase OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=guaC PE=3 SV=1 259 437 8.0E-19
sp|A1TNF7|GUAC_ACIAC GMP reductase OS=Acidovorax citrulli (strain AAC00-1) GN=guaC PE=3 SV=1 256 427 2.0E-18
sp|A1WIJ3|GUAC_VEREI GMP reductase OS=Verminephrobacter eiseniae (strain EF01-2) GN=guaC PE=3 SV=1 256 427 2.0E-18
sp|A1WB23|GUAC_ACISJ GMP reductase OS=Acidovorax sp. (strain JS42) GN=guaC PE=3 SV=1 256 427 2.0E-18
sp|B9ME75|GUAC_ACIET GMP reductase OS=Acidovorax ebreus (strain TPSY) GN=guaC PE=3 SV=1 256 427 3.0E-18
sp|Q57TB5|GUAC_SALCH GMP reductase OS=Salmonella choleraesuis (strain SC-B67) GN=guaC PE=3 SV=1 278 502 6.0E-18
sp|A8ALJ2|GUAC_CITK8 GMP reductase OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=guaC PE=3 SV=1 259 431 6.0E-18
sp|A9BNR6|GUAC_DELAS GMP reductase OS=Delftia acidovorans (strain DSM 14801 / SPH-1) GN=guaC PE=3 SV=1 256 427 8.0E-18
sp|Q6F1U6|GUAC_MESFL GMP reductase OS=Mesoplasma florum (strain ATCC 33453 / NBRC 100688 / NCTC 11704 / L1) GN=guaC PE=3 SV=1 185 442 2.0E-17
sp|Q6MUI1|GUAC_MYCMS GMP reductase OS=Mycoplasma mycoides subsp. mycoides SC (strain PG1) GN=guaC PE=3 SV=1 217 442 4.0E-17
sp|Q8T6T2|IMDH_CRYPV Inosine-5'-monophosphate dehydrogenase OS=Cryptosporidium parvum GN=56k.02 PE=1 SV=1 42 123 8.0E-17
sp|P49058|IMDH_BORBU Inosine-5'-monophosphate dehydrogenase OS=Borrelia burgdorferi (strain ATCC 35210 / B31 / CIP 102532 / DSM 4680) GN=guaB PE=1 SV=1 42 124 7.0E-15
sp|P54606|YHCV_BACSU CBS domain-containing protein YhcV OS=Bacillus subtilis (strain 168) GN=yhcV PE=3 SV=1 139 240 2.0E-09
sp|Q57647|Y188_METJA Uncharacterized protein MJ0188 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ0188 PE=3 SV=1 132 240 2.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0003824 catalytic activity Yes
GO:0016491 oxidoreductase activity Yes
GO:0003674 molecular_function No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup3649
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|765
Ophiocordyceps australis map64 (Brazil) OphauB2|4386 (this protein)
Ophiocordyceps camponoti-floridani Ophcf2|02277
Ophiocordyceps camponoti-rufipedis Ophun1|3180
Ophiocordyceps kimflemingae Ophio5|5102
Ophiocordyceps subramaniannii Hirsu2|7045

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|4386
MVAANSHAPVLDYRTAVEKLSEYETRDGLDIHQLMDTTKHGGLTFNDFLLLPGYIGFPASEVVLDSPITKRITLK
TPFVSSPMDTVTEHEMAIHMALQGGLGVIHHNCSPDAQADMVRNVKRYENGFILDPVVINRSLTVGEVKALKEQW
GFGGFPVTENGKLGSKLLGIVTNRDLQFEEANDSPVSSVMVTNLITAPNGVTLAEANKILAKSKKGKLPIVDKDF
NLVSMISRSDLTKNQHFPLASKLPASKQLICAAAIGTRPEDKTRLQKLVEAGLDIVVLDSSQGNSMYQVDMVKWI
KSNFPDLDVIGGNVVTREQAASLIAAGVDGLRIGMGSGSACITQEVMAVGRPQAAAVYAVSHFAARFGVPCIADG
GVQNVGHIVKGLSLGASTVMMGGLLAGTTESPGTSFVSREGKLVKAYRGMGSIDAMQDKKAGDGGKDSQKSNAGT
ARYFSEGDSVLVAQGVSGSVAHRGSVGKFVPYLAAGLKHSMQDCGMKSLSGLHESAANGLLRFELRTSSAQLEGN
VNMEAYEKKLYA*
Coding >OphauB2|4386
ATGGTGGCAGCCAATTCGCATGCCCCGGTGCTCGATTACCGCACAGCCGTCGAGAAGCTGTCCGAGTACGAGACG
CGCGATGGTCTCGACATCCACCAGCTCATGGACACGACCAAGCATGGCGGCTTGACCTTTAACGACTTCCTGCTG
CTCCCGGGCTATATTGGCTTCCCTGCCTCTGAAGTGGTACTCGACTCGCCAATCACGAAGCGCATCACGCTCAAA
ACGCCCTTTGTCTCCTCTCCCATGGACACGGTGACGGAGCACGAAATGGCCATTCACATGGCTCTTCAGGGCGGT
CTTGGAGTCATCCACCACAATTGCTCTCCAGATGCTCAGGCCGACATGGTGCGCAACGTCAAGCGCTACGAAAAC
GGCTTTATTCTCGACCCCGTCGTCATCAATCGCAGCCTCACCGTTGGAGAAGTCAAGGCCCTCAAGGAGCAATGG
GGCTTTGGTGGCTTTCCAGTGACTGAAAATGGAAAACTCGGCTCCAAGCTCCTGGGCATTGTTACTAACCGCGAC
CTTCAGTTCGAGGAGGCCAATGACTCGCCCGTATCGAGCGTCATGGTGACAAACCTCATCACGGCTCCCAACGGC
GTCACGCTTGCCGAGGCAAACAAGATTCTCGCAAAGTCCAAAAAGGGCAAGCTGCCCATTGTGGACAAGGATTTC
AACCTTGTGTCTATGATATCCCGCTCCGACCTCACCAAGAACCAACATTTTCCTTTGGCCTCCAAGTTGCCAGCC
AGCAAACAGCTCATCTGCGCCGCTGCCATTGGCACACGCCCCGAAGACAAGACACGGCTTCAGAAGCTTGTCGAA
GCTGGCCTCGACATTGTTGTTCTTGACAGCTCTCAGGGAAACAGCATGTACCAGGTTGACATGGTGAAATGGATA
AAGTCCAATTTCCCCGATCTCGATGTGATTGGAGGCAATGTTGTCACACGCGAACAGGCCGCGTCCCTCATCGCC
GCTGGCGTTGACGGCTTGCGAATCGGTATGGGGAGCGGCTCAGCCTGCATTACGCAAGAGGTGATGGCTGTGGGC
CGGCCCCAGGCTGCTGCTGTGTATGCCGTTAGCCACTTTGCCGCTCGGTTCGGTGTGCCTTGCATCGCTGATGGT
GGCGTGCAAAACGTTGGCCATATTGTCAAGGGCCTGTCTTTGGGTGCCTCGACCGTCATGATGGGCGGACTATTG
GCCGGCACCACCGAGTCTCCCGGTACCTCGTTTGTTTCGCGAGAGGGCAAGCTGGTCAAGGCCTACAGGGGCATG
GGCAGCATCGATGCCATGCAGGACAAGAAGGCGGGCGACGGCGGCAAGGACAGCCAAAAGAGCAATGCCGGCACT
GCTCGATACTTCTCAGAGGGCGACAGCGTGCTTGTGGCGCAGGGCGTCTCGGGGTCTGTAGCACACCGGGGCTCA
GTCGGCAAATTCGTGCCCTATCTGGCTGCTGGACTGAAGCACTCGATGCAAGACTGTGGCATGAAGAGCCTCTCC
GGGCTGCACGAGTCGGCGGCCAATGGCCTCCTTCGCTTCGAGCTGCGCACTTCAAGCGCCCAGCTCGAGGGCAAT
GTCAACATGGAGGCATATGAGAAGAAGCTTTACGCTTAA
Transcript >OphauB2|4386
ATGGTGGCAGCCAATTCGCATGCCCCGGTGCTCGATTACCGCACAGCCGTCGAGAAGCTGTCCGAGTACGAGACG
CGCGATGGTCTCGACATCCACCAGCTCATGGACACGACCAAGCATGGCGGCTTGACCTTTAACGACTTCCTGCTG
CTCCCGGGCTATATTGGCTTCCCTGCCTCTGAAGTGGTACTCGACTCGCCAATCACGAAGCGCATCACGCTCAAA
ACGCCCTTTGTCTCCTCTCCCATGGACACGGTGACGGAGCACGAAATGGCCATTCACATGGCTCTTCAGGGCGGT
CTTGGAGTCATCCACCACAATTGCTCTCCAGATGCTCAGGCCGACATGGTGCGCAACGTCAAGCGCTACGAAAAC
GGCTTTATTCTCGACCCCGTCGTCATCAATCGCAGCCTCACCGTTGGAGAAGTCAAGGCCCTCAAGGAGCAATGG
GGCTTTGGTGGCTTTCCAGTGACTGAAAATGGAAAACTCGGCTCCAAGCTCCTGGGCATTGTTACTAACCGCGAC
CTTCAGTTCGAGGAGGCCAATGACTCGCCCGTATCGAGCGTCATGGTGACAAACCTCATCACGGCTCCCAACGGC
GTCACGCTTGCCGAGGCAAACAAGATTCTCGCAAAGTCCAAAAAGGGCAAGCTGCCCATTGTGGACAAGGATTTC
AACCTTGTGTCTATGATATCCCGCTCCGACCTCACCAAGAACCAACATTTTCCTTTGGCCTCCAAGTTGCCAGCC
AGCAAACAGCTCATCTGCGCCGCTGCCATTGGCACACGCCCCGAAGACAAGACACGGCTTCAGAAGCTTGTCGAA
GCTGGCCTCGACATTGTTGTTCTTGACAGCTCTCAGGGAAACAGCATGTACCAGGTTGACATGGTGAAATGGATA
AAGTCCAATTTCCCCGATCTCGATGTGATTGGAGGCAATGTTGTCACACGCGAACAGGCCGCGTCCCTCATCGCC
GCTGGCGTTGACGGCTTGCGAATCGGTATGGGGAGCGGCTCAGCCTGCATTACGCAAGAGGTGATGGCTGTGGGC
CGGCCCCAGGCTGCTGCTGTGTATGCCGTTAGCCACTTTGCCGCTCGGTTCGGTGTGCCTTGCATCGCTGATGGT
GGCGTGCAAAACGTTGGCCATATTGTCAAGGGCCTGTCTTTGGGTGCCTCGACCGTCATGATGGGCGGACTATTG
GCCGGCACCACCGAGTCTCCCGGTACCTCGTTTGTTTCGCGAGAGGGCAAGCTGGTCAAGGCCTACAGGGGCATG
GGCAGCATCGATGCCATGCAGGACAAGAAGGCGGGCGACGGCGGCAAGGACAGCCAAAAGAGCAATGCCGGCACT
GCTCGATACTTCTCAGAGGGCGACAGCGTGCTTGTGGCGCAGGGCGTCTCGGGGTCTGTAGCACACCGGGGCTCA
GTCGGCAAATTCGTGCCCTATCTGGCTGCTGGACTGAAGCACTCGATGCAAGACTGTGGCATGAAGAGCCTCTCC
GGGCTGCACGAGTCGGCGGCCAATGGCCTCCTTCGCTTCGAGCTGCGCACTTCAAGCGCCCAGCTCGAGGGCAAT
GTCAACATGGAGGCATATGAGAAGAAGCTTTACGCTTAA
Gene >OphauB2|4386
ATGGTGGCAGCCAATTCGCATGCCCCGGTGCTCGATTACCGCACAGCCGTCGAGAAGCTGTCCGAGTACGAGACG
CGCGATGGTCTCGACATCCACCAGCTCATGGACACGACCAAGCATGGCGGCTTGACCTTTAACGACTTCCTGCTG
CTCCCGGGCTATATTGGCTTCCCTGCCTCTGAAGTGGTACTCGACTCGCCAATCACGAAGCGCATCACGCTCAAA
ACGCCCTTTGTCTCCTCTCCCATGGACACGGTGACGGAGCACGAAATGGCCATTCACATGGCTCTTCAGGGCGGT
CTTGGAGTCATCCACCACAATTGCTCTCCAGATGCTCAGGCCGACATGGTGCGCAACGTCAAGCGCTACGAAAAC
GGCTTTATTCTCGACCCCGTCGTCATCAATCGCAGCCTCACCGTTGGAGAAGTCAAGGCCCTCAAGGAGCAATGG
GGCTTTGGTGGCTTTCCAGTGACTGGTTAGTAGTACTTTTGCTCTTTTCCTTGCTTTCTGGCCTCTATACTGCAT
GATTATAATCCATACATCATAACTTTCGTTCCACCGAGTATACAAGGCTTTGCCTTTATGTGGACACTCTTGAAT
ATGACGCTGCCTCATACACCACTACTACTACTACTCAGCTACCAAGCCCTGCTACCAAATGCTAACTTTGCCTTT
TGAAGAAAATGGAAAACTCGGCTCCAAGCTCCTGGGCATTGTTACTAACCGCGACCTTCAGTTCGAGGAGGCCAA
TGACTCGCCCGTATCGAGCGTCATGGTGACAAACCTCATCACGGCTCCCAACGGCGTCACGCTTGCCGAGGCAAA
CAAGATTCTCGCAAAGTCCAAAAAGGGCAAGCTGCCCATTGTGGACAAGGATTTCAACCTTGTGTCTATGATATC
CCGCTCCGACCTCACCAAGAACCAACATTTTCCTTTGGCCTCCAAGTTGCCAGCCAGCAAACAGCTCATCTGCGC
CGCTGCCATTGGCACACGCCCCGAAGACAAGACACGGCTTCAGAAGCTTGTCGAAGCTGGCCTCGACATTGTTGT
TCTTGACAGCTCTCAGGGAAACAGCATGTACCAGGTTGACATGGTGAAATGGATAAAGTCCAATTTCCCCGATCT
CGATGTGATTGGAGGCAATGTTGTCACACGCGAACAGGCCGCGTCCCTCATCGCCGCTGGCGTTGACGGCTTGCG
AATCGGTATGGGGAGCGGCTCAGCCTGCATTACGCAAGAGGTGATGGCTGTGGGCCGGCCCCAGGCTGCTGCTGT
GTATGCCGTTAGCCACTTTGCCGCTCGGTTCGGTGTGCCTTGCATCGCTGATGGTGGCGTGCAAAACGTTGGCCA
TATTGTCAAGGGCCTGTCTTTGGGTGCCTCGACCGTCATGATGGGCGGACTATTGGCCGGCACCACCGAGTCTCC
CGGTACCTCGTTTGTTTCGCGAGAGGGCAAGCTGGTCAAGGCCTACAGGGGCATGGGCAGCATCGATGCCATGCA
GGACAAGAAGGCGGGCGACGGCGGCAAGGACAGCCAAAAGAGCAATGCCGGCACTGCTCGATACTTCTCAGAGGG
CGACAGCGTGCTTGTGGCGCAGGGCGTCTCGGGGTCTGTAGCACACCGGGGCTCAGTCGGCAAATTCGTGCCCTA
TCTGGCTGCTGGACTGAAGCACTCGATGCAAGACTGTGGCATGAAGAGCCTCTCCGGGCTGCACGAGTCGGCGGC
CAATGGCCTCCTTCGCTTCGAGCTGCGCACTTCAAGCGCCCAGCTCGAGGGCAATGTCAACATGGAGGCATATGA
GAAGAAGCTTTACGCTTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail