Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|4383
Gene name
LocationContig_3:17230..18935
Strand-
Gene length (bp)1705
Transcript length (bp)1581
Coding sequence length (bp)1581
Protein length (aa) 527

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13450 NAD_binding_8 NAD(P)-binding Rossmann-like domain 9.0E-10 15 93

Swissprot hits

(None)

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

Domain # Start End Length
1 140 162 22

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup3453
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|762
Ophiocordyceps australis map64 (Brazil) OphauB2|4383 (this protein)
Ophiocordyceps camponoti-floridani Ophcf2|06050
Ophiocordyceps camponoti-rufipedis Ophun1|3149
Ophiocordyceps kimflemingae Ophio5|2523
Ophiocordyceps subramaniannii Hirsu2|6581

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|4383
MATPSDDIKKRHIAIIGGGAAGMASRALHPSCAATLAQHPEKFKVTLLERADVVGGQATSISLDKQRHGASWMNN
GVQGGSQIFKHTFNFFREQGFPPHQVQLQVAFGKGQDGFWTNVFPTKLVERYAADIRKFGYFLRLIKWTMPILGL
VPISIMLRVFFFSKDFGDKMVYPLIALFLGTGNQTPNVPSAIVERLFDDPNMKLWDYDAVTLLPNLPTMYTFDHL
DAFYKSWRSHLEGQGVTMRTGTEVSQVLSRSKEGVLLSIKDLASGNSTEEAFDDMVLCTLADDSLRILGKQASWR
EKMVLGGAAFFDDLTVTHSDSKYFEQHYETRFKQELCAEPSSDQQKKQVAFAKGQGQDADGFKPMYYTFSYQRDP
RLIEMSFNCSNYQHQLKQANAESQRTLEPVYQTIFLNKKLKDMWTLDSINEDKVIKKNWWHQLGHRWQHYLRVVP
GMMFLHGKQHTYFAGSWTLVNMHELACVSGIAAAYHLGADYVKIDDFAQDFFSKYLLLSHGMVFSREEKRRRRTR
S*
Coding >OphauB2|4383
ATGGCAACGCCTTCAGATGACATCAAGAAGCGACATATTGCCATTATTGGCGGAGGAGCCGCGGGCATGGCAAGT
CGTGCTCTGCACCCATCTTGCGCAGCCACCTTGGCCCAGCATCCTGAAAAGTTCAAAGTAACGCTGTTGGAGCGA
GCAGACGTTGTTGGCGGCCAGGCAACGTCGATATCTCTGGACAAGCAGCGCCATGGCGCTTCGTGGATGAACAAT
GGCGTTCAGGGCGGATCTCAAATCTTCAAGCACACGTTCAACTTTTTCCGCGAACAAGGCTTTCCGCCCCACCAG
GTACAGCTTCAGGTAGCCTTTGGCAAAGGGCAAGATGGGTTCTGGACCAATGTCTTTCCTACCAAGCTTGTGGAG
CGCTATGCTGCCGACATTCGCAAATTTGGCTATTTCTTGCGCCTCATCAAATGGACCATGCCGATCCTGGGCCTG
GTGCCCATTTCCATCATGCTGCGCGTCTTTTTCTTTAGTAAAGACTTTGGCGACAAGATGGTGTATCCTCTTATT
GCTCTCTTTCTCGGCACCGGCAACCAGACGCCCAATGTGCCCTCTGCCATTGTCGAGCGCCTCTTTGACGACCCC
AACATGAAGCTGTGGGACTATGATGCCGTTACCTTGCTGCCTAACCTGCCCACCATGTACACCTTTGACCATCTC
GATGCCTTTTACAAGTCTTGGAGGAGCCATCTCGAGGGCCAGGGCGTAACCATGAGGACGGGGACCGAGGTCTCG
CAAGTGCTCTCGAGGAGTAAAGAGGGAGTTTTGCTCAGCATCAAAGACTTGGCCTCGGGCAACTCGACAGAGGAA
GCCTTTGACGACATGGTGCTCTGCACTCTGGCCGACGACAGTCTTCGCATTCTAGGCAAACAGGCAAGCTGGCGC
GAGAAAATGGTGCTCGGCGGCGCTGCCTTTTTCGACGACTTGACCGTGACACACAGCGACAGCAAATACTTTGAA
CAGCACTACGAAACGCGCTTCAAGCAAGAGCTCTGTGCCGAGCCTTCATCAGACCAGCAAAAGAAGCAGGTGGCC
TTTGCCAAGGGCCAGGGCCAAGACGCCGACGGCTTCAAGCCCATGTATTACACGTTTTCCTACCAGCGCGATCCG
CGCCTCATTGAAATGTCCTTCAACTGCAGCAACTACCAGCACCAGCTTAAACAGGCCAATGCCGAGTCTCAACGG
ACCCTGGAACCCGTATACCAAACCATTTTCCTAAACAAGAAGCTCAAGGACATGTGGACGCTGGACAGCATTAAC
GAGGACAAGGTGATTAAAAAGAATTGGTGGCACCAGTTGGGCCATCGGTGGCAGCACTATCTCCGCGTTGTCCCC
GGCATGATGTTTCTCCACGGCAAGCAGCATACCTATTTCGCCGGCTCTTGGACGCTCGTGAACATGCATGAGCTG
GCGTGTGTCAGTGGTATTGCAGCTGCCTACCATCTTGGGGCAGACTATGTCAAGATTGACGACTTTGCTCAAGAC
TTTTTTTCAAAGTACTTGCTACTCTCGCACGGCATGGTGTTTTCTCGCGAGGAAAAGAGGAGACGTCGTACAAGG
TCTTGA
Transcript >OphauB2|4383
ATGGCAACGCCTTCAGATGACATCAAGAAGCGACATATTGCCATTATTGGCGGAGGAGCCGCGGGCATGGCAAGT
CGTGCTCTGCACCCATCTTGCGCAGCCACCTTGGCCCAGCATCCTGAAAAGTTCAAAGTAACGCTGTTGGAGCGA
GCAGACGTTGTTGGCGGCCAGGCAACGTCGATATCTCTGGACAAGCAGCGCCATGGCGCTTCGTGGATGAACAAT
GGCGTTCAGGGCGGATCTCAAATCTTCAAGCACACGTTCAACTTTTTCCGCGAACAAGGCTTTCCGCCCCACCAG
GTACAGCTTCAGGTAGCCTTTGGCAAAGGGCAAGATGGGTTCTGGACCAATGTCTTTCCTACCAAGCTTGTGGAG
CGCTATGCTGCCGACATTCGCAAATTTGGCTATTTCTTGCGCCTCATCAAATGGACCATGCCGATCCTGGGCCTG
GTGCCCATTTCCATCATGCTGCGCGTCTTTTTCTTTAGTAAAGACTTTGGCGACAAGATGGTGTATCCTCTTATT
GCTCTCTTTCTCGGCACCGGCAACCAGACGCCCAATGTGCCCTCTGCCATTGTCGAGCGCCTCTTTGACGACCCC
AACATGAAGCTGTGGGACTATGATGCCGTTACCTTGCTGCCTAACCTGCCCACCATGTACACCTTTGACCATCTC
GATGCCTTTTACAAGTCTTGGAGGAGCCATCTCGAGGGCCAGGGCGTAACCATGAGGACGGGGACCGAGGTCTCG
CAAGTGCTCTCGAGGAGTAAAGAGGGAGTTTTGCTCAGCATCAAAGACTTGGCCTCGGGCAACTCGACAGAGGAA
GCCTTTGACGACATGGTGCTCTGCACTCTGGCCGACGACAGTCTTCGCATTCTAGGCAAACAGGCAAGCTGGCGC
GAGAAAATGGTGCTCGGCGGCGCTGCCTTTTTCGACGACTTGACCGTGACACACAGCGACAGCAAATACTTTGAA
CAGCACTACGAAACGCGCTTCAAGCAAGAGCTCTGTGCCGAGCCTTCATCAGACCAGCAAAAGAAGCAGGTGGCC
TTTGCCAAGGGCCAGGGCCAAGACGCCGACGGCTTCAAGCCCATGTATTACACGTTTTCCTACCAGCGCGATCCG
CGCCTCATTGAAATGTCCTTCAACTGCAGCAACTACCAGCACCAGCTTAAACAGGCCAATGCCGAGTCTCAACGG
ACCCTGGAACCCGTATACCAAACCATTTTCCTAAACAAGAAGCTCAAGGACATGTGGACGCTGGACAGCATTAAC
GAGGACAAGGTGATTAAAAAGAATTGGTGGCACCAGTTGGGCCATCGGTGGCAGCACTATCTCCGCGTTGTCCCC
GGCATGATGTTTCTCCACGGCAAGCAGCATACCTATTTCGCCGGCTCTTGGACGCTCGTGAACATGCATGAGCTG
GCGTGTGTCAGTGGTATTGCAGCTGCCTACCATCTTGGGGCAGACTATGTCAAGATTGACGACTTTGCTCAAGAC
TTTTTTTCAAAGTACTTGCTACTCTCGCACGGCATGGTGTTTTCTCGCGAGGAAAAGAGGAGACGTCGTACAAGG
TCTTGA
Gene >OphauB2|4383
ATGGCAACGCCTTCAGATGACATCAAGAAGCGACATATTGCCATTATTGGCGGAGGAGCCGCGGGCATGGCAAGT
CGTGCTCTGCACCCAGTCACTCAGAAAGCACCTTGAGCTAATTTTAATTCTTGCTGGCTGCTCGCCACAGTCTTG
CGCAGCCACCTTGGCCCAGCATCCTGAAAAGTTCAAAGTAACGCTGTTGGAGCGAGCAGACGTTGTTGGCGGCCA
GGCAACGTCGATATCTCTGGACAAGCAGCGCCATGGCGCTTCGTGGATGAACAATGGCGTTCAGGGCGGATCTCA
AATCTTCAAGCACACGTTCAACTTTTTCCGCGAACAAGGCTTTCCGCCCCACCAGGTACAGCTTCAGGTAGCCTT
TGGCAAAGGGCAAGATGGGTTCTGGACCAATGTCTTTCCTACCAAGCTTGTGGAGCGCTATGCTGCCGACATTCG
CAAATTTGGCTATTTCTTGCGCCTCATCAAATGGACCATGCCGATCCTGGGCCTGGTGCCCATTTCCATCATGCT
GCGCGTCTTTTTCTTTAGTAAAGACTTTGGCGACAAGATGGTGTATCCTCTTATTGCTCTCTTTCTCGGCACCGG
CAACCAGACGCCCAATGTGCCCTCTGCCATTGTCGAGCGCCTCTTTGACGACCCCAACATGAAGCTGTGGGACTA
TGATGCCGTTACCTTGCTGCCTAACCTGCCCACCATGTACACCTTTGACCATCTCGATGCCTTTTACAAGTCTTG
GAGGAGCCATCTCGAGGGCCAGGGCGTAACCATGAGGACGGGGACCGAGGTCTCGCAAGTGCTCTCGAGGAGTAA
AGAGGGAGTTTTGCTCAGCATCAAAGACTTGGCCTCGGGCAACTCGACAGAGGAAGCCTTTGACGACATGGTGCT
CTGCACTCTGGCCGACGACAGTCTTCGCATTCTAGGCAAACAGGCAAGCTGGCGCGAGAAAATGGTGCTCGGCGG
CGCTGCCTTTTTCGACGACTTGACCGTGACACACAGCGACAGCAAATACTTTGAACAGCACTACGAAACGCGCTT
CAAGCAAGAGCTCTGTGCCGAGCCTTCATCAGACCAGCAAAAGAAGCAGGTGGCCTTTGCCAAGGGCCAGGGCCA
AGACGCCGACGGCTTCAAGCCCATGTATTACACGTTTTCCTACCAGCGCGATCCGCGCCTCATTGAAATGTCCTT
CAACTGCAGCAACTACCAGCACCAGCTTAAACAGGCCAATGCCGAGTCTCAACGGACCCTGGAACCCGTATACCA
AACCATTTTCCTAAACAAGAAGCTCAAGGACATGTGGACGCTGGACAGCATTAACGAGGACAAGGTGATTAAAAA
GAATTGGTGGCACCAGTTGGGCCATCGGTGGCAGCACTATCTCCGCGTTGTCCCCGGCATGATGTTTCTCCACGG
CAAGCAGCATACCTATTTCGCCGGCTCTTGGACGCTCGTGGTAAGGCTTGGAAAATGTCCTTGTCGCCCAAACTT
GGCCATGTCAAGGCGCTGACGCTTTCTGCTGCAGAACATGCATGAGCTGGCGTGTGTCAGTGGTATTGCAGCTGC
CTACCATCTTGGGGCAGACTATGTCAAGATTGACGACTTTGCTCAAGACTTTTTTTCAAAGTACTTGCTACTCTC
GCACGGCATGGTGTTTTCTCGCGAGGAAAAGAGGAGACGTCGTACAAGGTCTTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail