Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|4381
Gene name
LocationContig_3:12952..15593
Strand-
Gene length (bp)2641
Transcript length (bp)2583
Coding sequence length (bp)2583
Protein length (aa) 861

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00815 Histidinol_dh Histidinol dehydrogenase 1.9E-159 445 853
PF01502 PRA-CH Phosphoribosyl-AMP cyclohydrolase 6.7E-24 218 288
PF01503 PRA-PH Phosphoribosyl-ATP pyrophosphohydrolase 1.2E-12 296 375

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P07685|HIS2_NEUCR Histidine biosynthesis trifunctional protein OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=his-3 PE=3 SV=3 1 859 0.0E+00
sp|P45353|HIS2_PICPA Histidine biosynthesis trifunctional protein OS=Komagataella pastoris GN=HIS4 PE=3 SV=1 167 857 0.0E+00
sp|O74712|HIS2_CANAX Histidine biosynthesis trifunctional protein OS=Candida albicans GN=HIS4 PE=3 SV=1 28 857 0.0E+00
sp|O13471|HIS2_KLULA Histidine biosynthesis trifunctional protein OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=HIS4 PE=3 SV=2 196 857 0.0E+00
sp|Q12670|HIS2_SACBA Histidine biosynthesis trifunctional protein OS=Saccharomyces bayanus GN=HIS4 PE=3 SV=1 24 857 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P07685|HIS2_NEUCR Histidine biosynthesis trifunctional protein OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=his-3 PE=3 SV=3 1 859 0.0E+00
sp|P45353|HIS2_PICPA Histidine biosynthesis trifunctional protein OS=Komagataella pastoris GN=HIS4 PE=3 SV=1 167 857 0.0E+00
sp|O74712|HIS2_CANAX Histidine biosynthesis trifunctional protein OS=Candida albicans GN=HIS4 PE=3 SV=1 28 857 0.0E+00
sp|O13471|HIS2_KLULA Histidine biosynthesis trifunctional protein OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=HIS4 PE=3 SV=2 196 857 0.0E+00
sp|Q12670|HIS2_SACBA Histidine biosynthesis trifunctional protein OS=Saccharomyces bayanus GN=HIS4 PE=3 SV=1 24 857 0.0E+00
sp|P00815|HIS2_YEAST Histidine biosynthesis trifunctional protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HIS4 PE=1 SV=3 27 857 0.0E+00
sp|Q9P777|HISX_SCHPO Histidinol dehydrogenase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=his2 PE=3 SV=1 440 853 7.0E-156
sp|Q9C5U8|HIS8_ARATH Histidinol dehydrogenase, chloroplastic OS=Arabidopsis thaliana GN=HISN8 PE=2 SV=1 399 860 9.0E-144
sp|Q5NAY4|HISX_ORYSJ Histidinol dehydrogenase, chloroplastic OS=Oryza sativa subsp. japonica GN=HDH PE=2 SV=1 451 858 3.0E-143
sp|P24226|HISX_BRAOC Histidinol dehydrogenase, chloroplastic OS=Brassica oleracea var. capitata GN=HDH PE=1 SV=1 411 860 3.0E-140
sp|P62459|HISX_PHOPR Histidinol dehydrogenase OS=Photobacterium profundum GN=hisD PE=3 SV=1 440 860 3.0E-131
sp|Q9F854|HISX_VIBCH Histidinol dehydrogenase OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=hisD PE=3 SV=2 432 859 4.0E-125
sp|Q87QL1|HISX_VIBPA Histidinol dehydrogenase OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=hisD PE=3 SV=1 440 859 5.0E-125
sp|Q8ABA9|HISX_BACTN Histidinol dehydrogenase OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482) GN=hisD PE=3 SV=1 432 858 8.0E-125
sp|Q6D411|HISX_PECAS Histidinol dehydrogenase OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=hisD PE=3 SV=1 426 860 2.0E-123
sp|Q7MLS6|HISX_VIBVY Histidinol dehydrogenase OS=Vibrio vulnificus (strain YJ016) GN=hisD PE=3 SV=1 440 857 2.0E-123
sp|Q8D8Q0|HISX_VIBVU Histidinol dehydrogenase OS=Vibrio vulnificus (strain CMCP6) GN=hisD PE=3 SV=1 440 857 2.0E-122
sp|Q5QWP8|HISX_IDILO Histidinol dehydrogenase OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=hisD PE=3 SV=1 432 855 1.0E-121
sp|P06988|HISX_ECOLI Histidinol dehydrogenase OS=Escherichia coli (strain K12) GN=hisD PE=1 SV=5 426 860 7.0E-121
sp|Q8FG52|HISX_ECOL6 Histidinol dehydrogenase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=hisD PE=3 SV=3 426 860 1.0E-120
sp|Q9CLM4|HISX_PASMU Histidinol dehydrogenase OS=Pasteurella multocida (strain Pm70) GN=hisD PE=3 SV=1 423 860 2.0E-120
sp|Q32EE9|HISX_SHIDS Histidinol dehydrogenase OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=hisD PE=3 SV=1 426 860 2.0E-120
sp|Q47XB8|HISX1_COLP3 Histidinol dehydrogenase 1 OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=hisD1 PE=3 SV=1 421 856 6.0E-120
sp|Q5E638|HISX_VIBF1 Histidinol dehydrogenase OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=hisD PE=3 SV=1 440 857 8.0E-120
sp|Q9PM77|HISX_CAMJE Histidinol dehydrogenase OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) GN=hisD PE=3 SV=1 423 858 5.0E-119
sp|Q5LAZ8|HISX_BACFN Histidinol dehydrogenase OS=Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / JCM 11019 / NCTC 9343) GN=hisD PE=3 SV=1 433 859 8.0E-119
sp|Q323J2|HISX_SHIBS Histidinol dehydrogenase OS=Shigella boydii serotype 4 (strain Sb227) GN=hisD PE=3 SV=1 426 860 8.0E-119
sp|Q8X8T3|HISX_ECO57 Histidinol dehydrogenase OS=Escherichia coli O157:H7 GN=hisD PE=3 SV=3 426 860 2.0E-118
sp|Q3Z0G5|HISX_SHISS Histidinol dehydrogenase OS=Shigella sonnei (strain Ss046) GN=hisD PE=3 SV=1 426 860 2.0E-118
sp|Q66C49|HISX_YERPS Histidinol dehydrogenase OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=hisD PE=3 SV=1 426 859 1.0E-117
sp|Q8ZFX5|HISX_YERPE Histidinol dehydrogenase OS=Yersinia pestis GN=hisD PE=3 SV=1 426 859 1.0E-117
sp|Q4QN74|HISX_HAEI8 Histidinol dehydrogenase OS=Haemophilus influenzae (strain 86-028NP) GN=hisD PE=3 SV=1 423 857 3.0E-117
sp|Q64RE7|HISX_BACFR Histidinol dehydrogenase OS=Bacteroides fragilis (strain YCH46) GN=hisD PE=3 SV=1 433 859 4.0E-117
sp|P44001|HISX_HAEIN Histidinol dehydrogenase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=hisD PE=3 SV=1 423 857 6.0E-117
sp|P59401|HISX_SHIFL Histidinol dehydrogenase OS=Shigella flexneri GN=hisD PE=3 SV=2 426 860 9.0E-117
sp|P10370|HISX_SALTY Histidinol dehydrogenase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=hisD PE=1 SV=3 426 860 1.0E-116
sp|Q57MS3|HISX_SALCH Histidinol dehydrogenase OS=Salmonella choleraesuis (strain SC-B67) GN=hisD PE=3 SV=1 440 860 3.0E-115
sp|Q5PDP3|HISX_SALPA Histidinol dehydrogenase OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=hisD PE=3 SV=1 426 860 6.0E-115
sp|Q7N6I1|HIS8_PHOLL Putative histidine biosynthesis bifunctional protein HisCD OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=hisCD PE=3 SV=1 440 854 1.0E-114
sp|Q8Z5K0|HISX_SALTI Histidinol dehydrogenase OS=Salmonella typhi GN=hisD PE=3 SV=3 426 860 2.0E-114
sp|Q8P9P2|HISX_XANCP Histidinol dehydrogenase OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=hisD PE=3 SV=1 423 854 4.0E-113
sp|Q4UU40|HISX_XANC8 Histidinol dehydrogenase OS=Xanthomonas campestris pv. campestris (strain 8004) GN=hisD PE=3 SV=1 423 854 4.0E-113
sp|Q65RB1|HISX_MANSM Histidinol dehydrogenase OS=Mannheimia succiniciproducens (strain MBEL55E) GN=hisD PE=3 SV=1 423 858 6.0E-113
sp|Q3BUF7|HISX_XANC5 Histidinol dehydrogenase OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=hisD PE=3 SV=1 423 854 4.0E-111
sp|Q5HSJ3|HISX_CAMJR Histidinol dehydrogenase OS=Campylobacter jejuni (strain RM1221) GN=hisD PE=3 SV=1 423 858 3.0E-110
sp|Q8PLG9|HISX_XANAC Histidinol dehydrogenase OS=Xanthomonas axonopodis pv. citri (strain 306) GN=hisD PE=3 SV=1 423 854 1.0E-109
sp|Q7VQX0|HISX_BLOFL Histidinol dehydrogenase OS=Blochmannia floridanus GN=hisD PE=3 SV=1 430 858 2.0E-108
sp|Q3ICF0|HISX_PSEHT Histidinol dehydrogenase OS=Pseudoalteromonas haloplanktis (strain TAC 125) GN=hisD PE=3 SV=1 430 860 9.0E-107
sp|Q492K3|HISX_BLOPB Histidinol dehydrogenase OS=Blochmannia pennsylvanicus (strain BPEN) GN=hisD PE=3 SV=1 427 860 2.0E-106
sp|Q5H0L1|HISX_XANOR Histidinol dehydrogenase OS=Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85) GN=hisD PE=3 SV=1 423 854 1.0E-105
sp|Q2P3K3|HISX_XANOM Histidinol dehydrogenase OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=hisD PE=3 SV=1 423 854 1.0E-105
sp|Q87C29|HISX_XYLFT Histidinol dehydrogenase OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=hisD PE=3 SV=1 423 854 2.0E-104
sp|Q8EFB1|HISX_SHEON Histidinol dehydrogenase OS=Shewanella oneidensis (strain MR-1) GN=hisD PE=3 SV=1 455 858 5.0E-104
sp|Q9PBC5|HISX_XYLFA Histidinol dehydrogenase OS=Xylella fastidiosa (strain 9a5c) GN=hisD PE=3 SV=1 423 854 2.0E-102
sp|P57201|HISX_BUCAI Histidinol dehydrogenase OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=hisD PE=3 SV=1 440 858 2.0E-102
sp|P59398|HISX_BUCBP Histidinol dehydrogenase OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=hisD PE=3 SV=1 438 854 3.0E-102
sp|Q8TL41|HISX_METAC Histidinol dehydrogenase OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=hisD PE=3 SV=1 429 856 4.0E-101
sp|Q465R4|HISX_METBF Histidinol dehydrogenase OS=Methanosarcina barkeri (strain Fusaro / DSM 804) GN=hisD PE=3 SV=1 432 856 4.0E-100
sp|Q9ZHE6|HISX_BUCAP Histidinol dehydrogenase OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=hisD PE=3 SV=1 466 860 4.0E-96
sp|Q8PZR8|HISX_METMA Histidinol dehydrogenase OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=hisD PE=3 SV=1 455 856 5.0E-96
sp|Q5ZW87|HISX_LEGPH Histidinol dehydrogenase OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) GN=hisD PE=3 SV=1 440 857 3.0E-93
sp|O30027|HISX_ARCFU Histidinol dehydrogenase OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=hisD PE=3 SV=1 438 857 3.0E-92
sp|O26327|HISX_METTH Histidinol dehydrogenase OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=hisD PE=3 SV=1 449 855 1.0E-91
sp|Q5WX91|HISX_LEGPL Histidinol dehydrogenase OS=Legionella pneumophila (strain Lens) GN=hisD PE=3 SV=1 440 857 1.0E-91
sp|Q5X5W9|HISX_LEGPA Histidinol dehydrogenase OS=Legionella pneumophila (strain Paris) GN=hisD PE=3 SV=1 440 857 1.0E-91
sp|Q97KI2|HISX_CLOAB Histidinol dehydrogenase OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=hisD PE=3 SV=1 435 855 1.0E-90
sp|Q8R882|HISX_CALS4 Histidinol dehydrogenase OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=hisD PE=3 SV=1 422 854 1.0E-90
sp|Q81G06|HISX_BACCR Histidinol dehydrogenase OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=hisD PE=3 SV=1 449 855 8.0E-90
sp|Q02136|HISX_LACLA Histidinol dehydrogenase OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=hisD PE=3 SV=3 435 857 3.0E-89
sp|Q58851|HISX_METJA Histidinol dehydrogenase OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=hisD PE=3 SV=1 449 855 6.0E-89
sp|P62456|HISX_BACC1 Histidinol dehydrogenase OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=hisD PE=3 SV=1 439 858 1.0E-88
sp|Q6HLE7|HISX_BACHK Histidinol dehydrogenase OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=hisD PE=3 SV=1 439 858 7.0E-88
sp|Q81T62|HISX_BACAN Histidinol dehydrogenase OS=Bacillus anthracis GN=hisD PE=3 SV=1 439 858 1.0E-87
sp|Q63DX2|HISX_BACCZ Histidinol dehydrogenase OS=Bacillus cereus (strain ZK / E33L) GN=hisD PE=3 SV=1 439 858 1.0E-87
sp|Q8Y9G1|HISX_LISMO Histidinol dehydrogenase OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=hisD PE=3 SV=1 455 855 2.0E-87
sp|Q8GDP4|HISX_HELMO Histidinol dehydrogenase (Fragment) OS=Heliobacillus mobilis GN=hisD PE=3 SV=1 455 855 2.0E-86
sp|Q5WDH8|HISX2_BACSK Histidinol dehydrogenase 2 OS=Bacillus clausii (strain KSM-K16) GN=hisD2 PE=3 SV=1 440 857 2.0E-86
sp|P60859|HISX_GEOSL Histidinol dehydrogenase OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=hisD PE=3 SV=1 445 855 3.0E-85
sp|Q92E84|HISX_LISIN Histidinol dehydrogenase OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=hisD PE=3 SV=1 429 855 4.0E-85
sp|Q5MZ26|HISX_SYNP6 Histidinol dehydrogenase OS=Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1) GN=hisD PE=3 SV=1 458 859 5.0E-85
sp|Q722Y3|HISX_LISMF Histidinol dehydrogenase OS=Listeria monocytogenes serotype 4b (strain F2365) GN=hisD PE=3 SV=1 455 855 5.0E-85
sp|Q5KVC6|HISX_GEOKA Histidinol dehydrogenase OS=Geobacillus kaustophilus (strain HTA426) GN=hisD PE=3 SV=1 440 858 6.0E-85
sp|Q2RGV8|HISX_MOOTA Histidinol dehydrogenase OS=Moorella thermoacetica (strain ATCC 39073) GN=hisD PE=3 SV=1 458 853 1.0E-84
sp|Q3A133|HISX_PELCD Histidinol dehydrogenase OS=Pelobacter carbinolicus (strain DSM 2380 / Gra Bd 1) GN=hisD PE=3 SV=1 448 855 1.0E-84
sp|Q39YP7|HISX_GEOMG Histidinol dehydrogenase OS=Geobacter metallireducens (strain GS-15 / ATCC 53774 / DSM 7210) GN=hisD PE=3 SV=1 445 855 1.0E-83
sp|Q9K6Z2|HISX_BACHD Histidinol dehydrogenase OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=hisD PE=3 SV=1 455 855 1.0E-83
sp|P60861|HISX_RHOPA Histidinol dehydrogenase OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=hisD PE=3 SV=1 458 856 1.0E-82
sp|Q8DTQ7|HISX_STRMU Histidinol dehydrogenase OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=hisD PE=3 SV=1 423 853 2.0E-82
sp|Q57F99|HISX_BRUAB Histidinol dehydrogenase OS=Brucella abortus biovar 1 (strain 9-941) GN=hisD PE=3 SV=1 449 855 4.0E-82
sp|Q2YPB8|HISX_BRUA2 Histidinol dehydrogenase OS=Brucella abortus (strain 2308) GN=hisD PE=3 SV=1 449 855 4.0E-82
sp|P59399|HISX_LACPL Histidinol dehydrogenase OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=hisD PE=3 SV=1 437 854 5.0E-82
sp|Q8G2R2|HISX_BRUSU Histidinol dehydrogenase OS=Brucella suis biovar 1 (strain 1330) GN=hisD PE=1 SV=1 449 855 6.0E-82
sp|P60862|HISX_METMP Histidinol dehydrogenase OS=Methanococcus maripaludis (strain S2 / LL) GN=hisD PE=3 SV=1 451 854 7.0E-82
sp|Q6FEC8|HISX_ACIAD Histidinol dehydrogenase OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=hisD PE=3 SV=1 422 855 2.0E-81
sp|Q8YF59|HISX_BRUME Histidinol dehydrogenase OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=hisD PE=3 SV=1 449 855 2.0E-81
sp|P62458|HISX_LEPIC Histidinol dehydrogenase OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130) GN=hisD PE=3 SV=1 452 853 1.0E-80
sp|O59667|HIS2_SCHPO Histidine biosynthesis bifunctional protein his7 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=his7 PE=3 SV=1 63 394 3.0E-80
sp|O34651|HISX_BACSU Histidinol dehydrogenase OS=Bacillus subtilis (strain 168) GN=hisD PE=3 SV=1 440 859 3.0E-80
sp|Q8F393|HISX_LEPIN Histidinol dehydrogenase OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601) GN=hisD PE=3 SV=1 452 853 4.0E-80
sp|Q8DGR2|HISX_THEEB Histidinol dehydrogenase OS=Thermosynechococcus elongatus (strain BP-1) GN=hisD PE=3 SV=1 420 855 4.0E-80
sp|Q65EF9|HISX_BACLD Histidinol dehydrogenase OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=hisD PE=3 SV=1 440 853 7.0E-80
sp|Q3ZXL7|HISX_DEHMC Histidinol dehydrogenase OS=Dehalococcoides mccartyi (strain CBDB1) GN=hisD PE=3 SV=1 453 855 8.0E-80
sp|Q82W26|HISX_NITEU Histidinol dehydrogenase OS=Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298) GN=hisD PE=3 SV=1 450 855 1.0E-79
sp|Q3Z878|HISX_DEHM1 Histidinol dehydrogenase OS=Dehalococcoides mccartyi (strain ATCC BAA-2266 / KCTC 15142 / 195) GN=hisD PE=3 SV=1 453 858 2.0E-79
sp|Q606Q2|HISX_METCA Histidinol dehydrogenase OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=hisD PE=1 SV=1 421 856 3.0E-79
sp|Q92S26|HISX1_RHIME Histidinol dehydrogenase 1 OS=Rhizobium meliloti (strain 1021) GN=hisD1 PE=3 SV=1 449 859 4.0E-79
sp|Q5FS83|HISX_GLUOX Histidinol dehydrogenase OS=Gluconobacter oxydans (strain 621H) GN=hisD PE=3 SV=1 423 855 2.0E-78
sp|P59397|HISX_BRADU Histidinol dehydrogenase OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=hisD PE=3 SV=1 425 855 2.0E-78
sp|Q3J079|HISX1_RHOS4 Histidinol dehydrogenase 1 OS=Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) GN=hisD1 PE=3 SV=1 433 859 2.0E-78
sp|Q8YWL4|HISX2_NOSS1 Histidinol dehydrogenase 2 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=hisD2 PE=3 SV=1 433 858 2.0E-78
sp|Q8ESR8|HISX_OCEIH Histidinol dehydrogenase OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=hisD PE=3 SV=1 458 853 4.0E-78
sp|Q4FNE2|HISX1_PELUB Histidinol dehydrogenase 1 OS=Pelagibacter ubique (strain HTCC1062) GN=hisD1 PE=3 SV=1 436 856 5.0E-78
sp|Q3SW26|HISX_NITWN Histidinol dehydrogenase OS=Nitrobacter winogradskyi (strain Nb-255 / ATCC 25391) GN=hisD PE=3 SV=2 425 855 7.0E-78
sp|Q313T7|HISX_DESAG Histidinol dehydrogenase OS=Desulfovibrio alaskensis (strain G20) GN=hisD PE=3 SV=1 445 855 9.0E-78
sp|Q3M5D3|HISX2_ANAVT Histidinol dehydrogenase 2 OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=hisD2 PE=3 SV=1 433 858 1.0E-77
sp|Q483H8|HISX2_COLP3 Histidinol dehydrogenase 2 OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=hisD2 PE=3 SV=1 418 850 5.0E-77
sp|Q7NL02|HISX_GLOVI Histidinol dehydrogenase OS=Gloeobacter violaceus (strain PCC 7421) GN=hisD PE=3 SV=1 429 859 1.0E-76
sp|Q3J7H1|HISX_NITOC Histidinol dehydrogenase OS=Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848) GN=hisD PE=3 SV=1 423 855 1.0E-76
sp|P62457|HISX_DESVH Histidinol dehydrogenase OS=Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / NCIMB 8303) GN=hisD PE=3 SV=1 454 853 5.0E-76
sp|Q8KEY6|HISX_CHLTE Histidinol dehydrogenase OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) GN=hisD PE=3 SV=1 433 857 6.0E-76
sp|Q7U8K7|HISX_SYNPX Histidinol dehydrogenase OS=Synechococcus sp. (strain WH8102) GN=hisD PE=3 SV=1 437 854 7.0E-76
sp|Q989E7|HISX1_RHILO Histidinol dehydrogenase 1 OS=Rhizobium loti (strain MAFF303099) GN=hisD1 PE=3 SV=1 409 855 7.0E-76
sp|Q46J19|HISX_PROMT Histidinol dehydrogenase OS=Prochlorococcus marinus (strain NATL2A) GN=hisD PE=3 SV=1 412 853 7.0E-76
sp|Q9X0D1|HISX_THEMA Histidinol dehydrogenase OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=hisD PE=3 SV=1 439 853 1.0E-75
sp|Q3IQR5|HISX_NATPD Histidinol dehydrogenase OS=Natronomonas pharaonis (strain ATCC 35678 / DSM 2160) GN=hisD PE=3 SV=1 449 854 1.0E-75
sp|Q7V5N9|HISX_PROMM Histidinol dehydrogenase OS=Prochlorococcus marinus (strain MIT 9313) GN=hisD PE=3 SV=1 437 855 2.0E-75
sp|Q5LL27|HISX3_RUEPO Histidinol dehydrogenase 3 OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) GN=hisD3 PE=3 SV=1 445 857 3.0E-75
sp|P73058|HISX1_SYNY3 Histidinol dehydrogenase 1 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=hisD1 PE=3 SV=1 423 853 4.0E-75
sp|Q6ANR3|HISX_DESPS Histidinol dehydrogenase OS=Desulfotalea psychrophila (strain LSv54 / DSM 12343) GN=hisD PE=3 SV=1 436 855 4.0E-75
sp|Q3AR25|HISX_CHLCH Histidinol dehydrogenase OS=Chlorobium chlorochromatii (strain CaD3) GN=hisD PE=3 SV=1 453 855 7.0E-75
sp|Q3AD53|HISX_CARHZ Histidinol dehydrogenase OS=Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901) GN=hisD PE=3 SV=1 432 856 2.0E-74
sp|Q8UHX1|HISX_AGRFC Histidinol dehydrogenase OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=hisD PE=3 SV=1 449 855 2.0E-74
sp|Q5P790|HISX_AROAE Histidinol dehydrogenase OS=Aromatoleum aromaticum (strain EbN1) GN=hisD PE=3 SV=1 423 854 3.0E-74
sp|Q9HVW9|HISX_PSEAE Histidinol dehydrogenase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=hisD PE=3 SV=1 423 854 1.0E-73
sp|Q9RSI4|HISX_DEIRA Histidinol dehydrogenase OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=hisD PE=3 SV=1 447 855 2.0E-73
sp|Q7VA26|HISX_PROMA Histidinol dehydrogenase OS=Prochlorococcus marinus (strain SARG / CCMP1375 / SS120) GN=hisD PE=3 SV=1 435 853 2.0E-73
sp|P59400|HISX_PSEPK Histidinol dehydrogenase OS=Pseudomonas putida (strain KT2440) GN=hisD PE=3 SV=1 423 859 4.0E-73
sp|Q5V574|HISX_HALMA Histidinol dehydrogenase OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=hisD PE=3 SV=1 458 855 5.0E-73
sp|Q47AL5|HISX_DECAR Histidinol dehydrogenase OS=Dechloromonas aromatica (strain RCB) GN=hisD PE=3 SV=1 421 856 7.0E-73
sp|Q7UX39|HISX_RHOBA Histidinol dehydrogenase OS=Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1) GN=hisD PE=3 SV=1 452 855 7.0E-73
sp|Q48EC9|HISX_PSE14 Histidinol dehydrogenase OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=hisD PE=3 SV=1 423 854 8.0E-73
sp|Q318Q4|HISX_PROM9 Histidinol dehydrogenase OS=Prochlorococcus marinus (strain MIT 9312) GN=hisD PE=3 SV=1 425 855 8.0E-73
sp|Q30TA4|HISX_SULDN Histidinol dehydrogenase OS=Sulfurimonas denitrificans (strain ATCC 33889 / DSM 1251) GN=hisD PE=3 SV=1 428 854 1.0E-72
sp|Q31GY9|HISX_THICR Histidinol dehydrogenase OS=Thiomicrospira crunogena (strain XCL-2) GN=hisD PE=3 SV=1 437 855 2.0E-72
sp|Q4ZNV9|HISX_PSEU2 Histidinol dehydrogenase OS=Pseudomonas syringae pv. syringae (strain B728a) GN=hisD PE=3 SV=1 423 854 2.0E-72
sp|O66976|HISX_AQUAE Histidinol dehydrogenase OS=Aquifex aeolicus (strain VF5) GN=hisD PE=3 SV=1 425 853 2.0E-72
sp|Q5SKC1|HISX_THET8 Histidinol dehydrogenase OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=hisD PE=3 SV=1 453 853 2.0E-72
sp|Q9HPW5|HISX_HALSA Histidinol dehydrogenase OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=hisD PE=3 SV=1 455 855 2.0E-72
sp|P62460|HISX_THET2 Histidinol dehydrogenase OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=hisD PE=3 SV=1 453 853 2.0E-72
sp|Q87WV5|HISX_PSESM Histidinol dehydrogenase OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=hisD PE=3 SV=1 423 858 2.0E-72
sp|Q7M8K9|HISX_WOLSU Histidinol dehydrogenase OS=Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / LMG 7466 / NCTC 11488 / FDC 602W) GN=hisD PE=3 SV=1 423 854 3.0E-72
sp|Q9JTH9|HISX_NEIMA Histidinol dehydrogenase OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=hisD PE=3 SV=1 433 855 7.0E-72
sp|Q3KHZ2|HISX_PSEPF Histidinol dehydrogenase OS=Pseudomonas fluorescens (strain Pf0-1) GN=hisD PE=3 SV=1 423 855 8.0E-72
sp|Q39K91|HISX_BURL3 Histidinol dehydrogenase OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=hisD PE=3 SV=1 421 856 1.0E-71
sp|Q5F7D8|HISX_NEIG1 Histidinol dehydrogenase OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) GN=hisD PE=3 SV=1 433 855 2.0E-71
sp|Q4KI73|HISX_PSEF5 Histidinol dehydrogenase OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=hisD PE=3 SV=2 423 854 2.0E-71
sp|P28736|HISX_MYCSM Histidinol dehydrogenase OS=Mycobacterium smegmatis GN=hisD PE=3 SV=1 423 855 3.0E-71
sp|Q9JYH8|HISX_NEIMB Histidinol dehydrogenase OS=Neisseria meningitidis serogroup B (strain MC58) GN=hisD PE=3 SV=1 433 855 3.0E-71
sp|Q7V004|HISX_PROMP Histidinol dehydrogenase OS=Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / MED4) GN=hisD PE=3 SV=1 432 855 3.0E-71
sp|Q63Q86|HISX_BURPS Histidinol dehydrogenase OS=Burkholderia pseudomallei (strain K96243) GN=hisD PE=3 SV=1 421 855 3.0E-71
sp|Q3JMZ6|HISX_BURP1 Histidinol dehydrogenase OS=Burkholderia pseudomallei (strain 1710b) GN=hisD PE=3 SV=1 421 855 3.0E-71
sp|Q2YAU5|HISX_NITMU Histidinol dehydrogenase OS=Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849) GN=hisD PE=3 SV=1 455 853 5.0E-71
sp|Q9RH05|HISX_ZYMMO Histidinol dehydrogenase OS=Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4) GN=hisD PE=3 SV=3 422 855 6.0E-71
sp|Q2RQM7|HISX_RHORT Histidinol dehydrogenase OS=Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1) GN=hisD PE=3 SV=1 425 856 1.0E-70
sp|Q67KH6|HISX_SYMTH Histidinol dehydrogenase OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=hisD PE=3 SV=1 436 854 1.0E-70
sp|Q62GD9|HISX_BURMA Histidinol dehydrogenase OS=Burkholderia mallei (strain ATCC 23344) GN=hisD PE=3 SV=1 421 855 2.0E-70
sp|Q845V3|HISX_BURM1 Histidinol dehydrogenase OS=Burkholderia multivorans (strain ATCC 17616 / 249) GN=hisD PE=3 SV=2 421 855 4.0E-70
sp|Q46WL2|HISX_CUPPJ Histidinol dehydrogenase OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=hisD PE=3 SV=1 419 856 5.0E-70
sp|O33775|HISX_SULSO Histidinol dehydrogenase OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=hisD PE=3 SV=1 441 853 5.0E-70
sp|Q3MEV7|HISX1_ANAVT Histidinol dehydrogenase 1 OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=hisD1 PE=3 SV=1 421 858 1.0E-69
sp|B0SS41|HISX_LEPBP Histidinol dehydrogenase OS=Leptospira biflexa serovar Patoc (strain Patoc 1 / ATCC 23582 / Paris) GN=hisD PE=3 SV=1 457 858 3.0E-69
sp|B0S9F2|HISX_LEPBA Histidinol dehydrogenase OS=Leptospira biflexa serovar Patoc (strain Patoc 1 / Ames) GN=hisD PE=3 SV=1 457 858 3.0E-69
sp|P9WNW9|HISX_MYCTU Histidinol dehydrogenase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=hisD PE=1 SV=2 422 855 3.0E-69
sp|P9WNW8|HISX_MYCTO Histidinol dehydrogenase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=hisD PE=3 SV=2 422 855 3.0E-69
sp|Q4FQF8|HISX_PSYA2 Histidinol dehydrogenase OS=Psychrobacter arcticus (strain DSM 17307 / 273-4) GN=hisD PE=3 SV=1 451 855 4.0E-69
sp|Q7VSZ1|HISX_BORPE Histidinol dehydrogenase OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=hisD PE=3 SV=1 422 856 5.0E-69
sp|Q7VFF5|HISX_HELHP Histidinol dehydrogenase OS=Helicobacter hepaticus (strain ATCC 51449 / 3B1) GN=hisD PE=3 SV=1 449 860 5.0E-69
sp|Q7W2Y4|HISX_BORPA Histidinol dehydrogenase OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=hisD PE=3 SV=1 422 856 6.0E-69
sp|Q7WDY4|HISX_BORBR Histidinol dehydrogenase OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=hisD PE=3 SV=1 422 856 6.0E-69
sp|Q9A5V1|HISX_CAUCR Histidinol dehydrogenase OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=hisD PE=3 SV=1 419 854 6.0E-69
sp|Q4JW59|HISX_CORJK Histidinol dehydrogenase OS=Corynebacterium jeikeium (strain K411) GN=hisD PE=3 SV=1 417 853 7.0E-69
sp|P63951|HISX_MYCBO Histidinol dehydrogenase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=hisD PE=3 SV=1 422 855 9.0E-69
sp|Q5LVV1|HISX1_RUEPO Histidinol dehydrogenase 1 OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) GN=hisD1 PE=3 SV=1 435 854 1.0E-68
sp|Q5YYQ0|HISX_NOCFA Histidinol dehydrogenase OS=Nocardia farcinica (strain IFM 10152) GN=hisD PE=3 SV=1 418 857 2.0E-68
sp|P16245|HISX_STRCO Histidinol dehydrogenase OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=hisD PE=3 SV=3 452 855 2.0E-68
sp|P60858|HISX_CORDI Histidinol dehydrogenase OS=Corynebacterium diphtheriae (strain ATCC 700971 / NCTC 13129 / Biotype gravis) GN=hisD PE=3 SV=1 451 857 2.0E-68
sp|Q8TXG3|HISX_METKA Histidinol dehydrogenase OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) GN=hisD PE=3 SV=1 444 853 2.0E-68
sp|Q8CQ95|HISX_STAES Histidinol dehydrogenase OS=Staphylococcus epidermidis (strain ATCC 12228) GN=hisD PE=3 SV=1 449 853 2.0E-68
sp|Q5HKN8|HISX_STAEQ Histidinol dehydrogenase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=hisD PE=3 SV=1 449 853 5.0E-68
sp|Q8FNZ0|HISX_COREF Histidinol dehydrogenase OS=Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395) GN=hisD PE=3 SV=1 451 857 1.0E-67
sp|Q82AA6|HISX_STRAW Histidinol dehydrogenase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=hisD PE=3 SV=1 452 854 2.0E-67
sp|Q8YSM8|HISX1_NOSS1 Histidinol dehydrogenase 1 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=hisD1 PE=3 SV=1 458 858 3.0E-67
sp|Q8NNT5|HISX_CORGL Histidinol dehydrogenase OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=hisD PE=3 SV=1 451 857 3.0E-67
sp|Q3B5E3|HISX_CHLL7 Histidinol dehydrogenase OS=Chlorobium luteolum (strain DSM 273 / 2530) GN=hisD PE=3 SV=1 436 855 4.0E-67
sp|Q7P0F6|HISX_CHRVO Histidinol dehydrogenase OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=hisD PE=3 SV=1 423 855 9.0E-67
sp|Q8XV79|HISX_RALSO Histidinol dehydrogenase OS=Ralstonia solanacearum (strain GMI1000) GN=hisD PE=3 SV=1 421 856 1.0E-66
sp|P63954|HISX_STAAW Histidinol dehydrogenase OS=Staphylococcus aureus (strain MW2) GN=hisD PE=3 SV=1 440 853 2.0E-66
sp|P63953|HISX_STAAN Histidinol dehydrogenase OS=Staphylococcus aureus (strain N315) GN=hisD PE=3 SV=1 440 853 2.0E-66
sp|P63952|HISX_STAAM Histidinol dehydrogenase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=hisD PE=3 SV=1 440 853 2.0E-66
sp|Q5HCL9|HISX_STAAC Histidinol dehydrogenase OS=Staphylococcus aureus (strain COL) GN=hisD PE=3 SV=1 440 853 2.0E-66
sp|Q6G5Z7|HISX_STAAS Histidinol dehydrogenase OS=Staphylococcus aureus (strain MSSA476) GN=hisD PE=3 SV=1 440 853 2.0E-66
sp|Q3SI67|HISX_THIDA Histidinol dehydrogenase OS=Thiobacillus denitrificans (strain ATCC 25259) GN=hisD PE=3 SV=1 421 856 1.0E-65
sp|Q6GDC6|HISX_STAAR Histidinol dehydrogenase OS=Staphylococcus aureus (strain MRSA252) GN=hisD PE=3 SV=1 440 853 1.0E-65
sp|Q970Y9|HISX_SULTO Histidinol dehydrogenase OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=hisD PE=3 SV=1 436 853 2.0E-65
sp|Q4A044|HISX_STAS1 Histidinol dehydrogenase OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=hisD PE=3 SV=1 449 853 3.0E-65
sp|Q2YZB4|HISX_STAAB Histidinol dehydrogenase OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=hisD PE=3 SV=1 440 853 1.0E-64
sp|Q5JFR5|HISX_THEKO Histidinol dehydrogenase OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=hisD PE=3 SV=1 458 853 1.0E-64
sp|Q9CC57|HISX_MYCLE Histidinol dehydrogenase OS=Mycobacterium leprae (strain TN) GN=hisD PE=3 SV=1 432 854 6.0E-64
sp|O59626|HISX_PYRFU Histidinol dehydrogenase OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=hisD PE=3 SV=2 450 853 3.0E-63
sp|Q47QS9|HISX_THEFY Histidinol dehydrogenase OS=Thermobifida fusca (strain YX) GN=hisD PE=3 SV=1 420 860 7.0E-63
sp|Q6KZD1|HISX_PICTO Histidinol dehydrogenase OS=Picrophilus torridus (strain ATCC 700027 / DSM 9790 / JCM 10055 / NBRC 100828) GN=hisD PE=3 SV=1 450 854 1.0E-62
sp|Q4J8I8|HISX_SULAC Histidinol dehydrogenase OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=hisD PE=3 SV=1 442 821 3.0E-61
sp|Q4FMH0|HISX2_PELUB Histidinol dehydrogenase 2 OS=Pelagibacter ubique (strain HTCC1062) GN=hisD2 PE=3 SV=1 454 855 4.0E-60
sp|P60860|HISX_MYCPA Histidinol dehydrogenase OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=hisD PE=3 SV=1 432 855 3.0E-59
sp|Q6A8L5|HISX_PROAC Histidinol dehydrogenase OS=Propionibacterium acnes (strain KPA171202 / DSM 16379) GN=hisD PE=3 SV=1 452 853 7.0E-59
sp|Q988P7|HISX2_RHILO Histidinol dehydrogenase 2 OS=Rhizobium loti (strain MAFF303099) GN=hisD2 PE=3 SV=1 376 856 5.0E-58
sp|Q8G4S9|HISX_BIFLO Histidinol dehydrogenase OS=Bifidobacterium longum (strain NCC 2705) GN=hisD PE=3 SV=1 422 854 1.0E-57
sp|Q46N53|HPSN_CUPPJ Sulfopropanediol 3-dehydrogenase OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=hpsN PE=1 SV=1 437 854 2.0E-56
sp|Q930I4|HISX2_RHIME Histidinol dehydrogenase 2 OS=Rhizobium meliloti (strain 1021) GN=hisD2 PE=3 SV=1 440 859 2.0E-55
sp|Q6AE76|HISX_LEIXX Histidinol dehydrogenase OS=Leifsonia xyli subsp. xyli (strain CTCB07) GN=hisD PE=3 SV=1 423 856 6.0E-55
sp|Q5WIU9|HISX1_BACSK Histidinol dehydrogenase 1 OS=Bacillus clausii (strain KSM-K16) GN=hisD1 PE=3 SV=1 434 859 4.0E-54
sp|Q987C6|HISX3_RHILO Histidinol dehydrogenase 3 OS=Rhizobium loti (strain MAFF303099) GN=hisD3 PE=3 SV=1 421 857 6.0E-54
sp|Q3J4H6|HISX2_RHOS4 Putative histidinol dehydrogenase 2 OS=Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) GN=hisD2 PE=3 SV=1 440 850 7.0E-53
sp|Q5LUS2|HISX2_RUEPO Histidinol dehydrogenase 2 OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) GN=hisD2 PE=3 SV=1 507 857 6.0E-51
sp|Q8GKZ1|HISX_SALEN Histidinol dehydrogenase (Fragment) OS=Salmonella enteritidis GN=hisD PE=3 SV=1 571 732 8.0E-44
sp|Q9RQ82|HISX_BUCMH Histidinol dehydrogenase (Fragment) OS=Buchnera aphidicola subsp. Melaphis rhois GN=hisD PE=3 SV=1 440 624 3.0E-37
sp|Q9L6I1|HISX_THIRO Histidinol dehydrogenase (Fragment) OS=Thiocapsa roseopersicina GN=hisD PE=3 SV=1 628 853 8.0E-32
sp|Q9RQ85|HISX_BUCSC Histidinol dehydrogenase (Fragment) OS=Buchnera aphidicola subsp. Schlechtendalia chinensis GN=hisD PE=3 SV=1 440 624 2.0E-28
sp|Q9RQ88|HISX_BUCDN Histidinol dehydrogenase (Fragment) OS=Buchnera aphidicola subsp. Diuraphis noxia GN=hisD PE=3 SV=1 440 624 3.0E-28
sp|P58853|HIS2_PYRFU Histidine biosynthesis bifunctional protein HisIE OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=hisI PE=3 SV=1 198 350 6.0E-23
sp|P62349|HIS2_PHOPR Histidine biosynthesis bifunctional protein HisIE OS=Photobacterium profundum GN=hisI PE=3 SV=1 187 379 7.0E-23
sp|Q8ZY17|HISX_PYRAE Histidinol dehydrogenase OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=hisD PE=3 SV=1 448 850 9.0E-23
sp|Q8EFB6|HIS2_SHEON Histidine biosynthesis bifunctional protein HisIE OS=Shewanella oneidensis (strain MR-1) GN=hisI PE=3 SV=1 173 383 3.0E-22
sp|Q8CXM8|HIS2_OCEIH Histidine biosynthesis bifunctional protein HisIE OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=hisI PE=3 SV=1 186 373 4.0E-22
sp|P72946|HISX2_SYNY3 Putative histidinol dehydrogenase 2 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=hisD2 PE=3 SV=1 534 793 2.0E-21
sp|Q9RWD6|HIS2_DEIRA Histidine biosynthesis bifunctional protein HisIE OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=hisI PE=3 SV=1 202 379 5.0E-21
sp|Q8D8Q6|HIS2_VIBVU Histidine biosynthesis bifunctional protein HisIE OS=Vibrio vulnificus (strain CMCP6) GN=hisI PE=3 SV=1 198 369 2.0E-20
sp|Q8R886|HIS2_CALS4 Histidine biosynthesis bifunctional protein HisIE OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=hisI PE=3 SV=1 200 379 3.0E-20
sp|P74755|HIS2_SYNY3 Histidine biosynthesis bifunctional protein HisIE OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=hisI PE=3 SV=2 202 389 5.0E-20
sp|P62350|HIS2_THET2 Histidine biosynthesis bifunctional protein HisIE OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=hisI PE=3 SV=1 200 350 2.0E-19
sp|O24714|HIS2_KLEPN Histidine biosynthesis bifunctional protein HisIE OS=Klebsiella pneumoniae GN=hisI PE=3 SV=1 198 376 2.0E-19
sp|Q7MLS0|HIS2_VIBVY Histidine biosynthesis bifunctional protein HisIE OS=Vibrio vulnificus (strain YJ016) GN=hisI PE=3 SV=1 198 369 3.0E-19
sp|Q7MAQ8|HIS2_WOLSU Histidine biosynthesis bifunctional protein HisIE OS=Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / LMG 7466 / NCTC 11488 / FDC 602W) GN=hisI PE=3 SV=1 203 364 3.0E-19
sp|Q87QK5|HIS2_VIBPA Histidine biosynthesis bifunctional protein HisIE OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=hisI PE=3 SV=1 198 369 5.0E-19
sp|O34912|HIS2_BACSU Histidine biosynthesis bifunctional protein HisIE OS=Bacillus subtilis (strain 168) GN=hisI PE=3 SV=1 200 350 2.0E-18
sp|O67780|HIS2_AQUAE Histidine biosynthesis bifunctional protein HisIE OS=Aquifex aeolicus (strain VF5) GN=hisI PE=3 SV=1 200 373 2.0E-18
sp|Q9CLL8|HIS2_PASMU Histidine biosynthesis bifunctional protein HisIE OS=Pasteurella multocida (strain Pm70) GN=hisI PE=3 SV=1 195 379 3.0E-18
sp|P06989|HIS2_ECOLI Histidine biosynthesis bifunctional protein HisIE OS=Escherichia coli (strain K12) GN=hisI PE=3 SV=3 198 373 3.0E-18
sp|Q7U635|HIS2_SYNPX Histidine biosynthesis bifunctional protein HisIE OS=Synechococcus sp. (strain WH8102) GN=hisI PE=3 SV=1 202 376 3.0E-18
sp|Q9KSW7|HIS2_VIBCH Histidine biosynthesis bifunctional protein HisIE OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=hisI PE=3 SV=1 195 369 4.0E-18
sp|P37793|HIS2_SHIFL Histidine biosynthesis bifunctional protein HisIE OS=Shigella flexneri GN=hisI PE=3 SV=1 198 353 5.0E-18
sp|Q8YS28|HIS2_NOSS1 Histidine biosynthesis bifunctional protein HisIE OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=hisI PE=3 SV=1 202 383 5.0E-18
sp|B3QU88|HIS3_CHLT3 Phosphoribosyl-AMP cyclohydrolase OS=Chloroherpeton thalassium (strain ATCC 35110 / GB-78) GN=hisI PE=3 SV=1 200 288 2.0E-17
sp|Q7NLB5|HIS2_GLOVI Histidine biosynthesis bifunctional protein HisIE OS=Gloeobacter violaceus (strain PCC 7421) GN=hisI PE=3 SV=1 200 369 3.0E-17
sp|Q9X0C5|HIS2_THEMA Histidine biosynthesis bifunctional protein HisIE OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=hisI PE=3 SV=1 203 376 5.0E-17
sp|Q9PM71|HIS2_CAMJE Histidine biosynthesis bifunctional protein HisIE OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) GN=hisI PE=3 SV=1 195 376 6.0E-17
sp|Q9K6Z7|HIS2_BACHD Histidine biosynthesis bifunctional protein HisIE OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=hisI PE=3 SV=1 202 350 6.0E-17
sp|Q2RTY3|HIS3_RHORT Phosphoribosyl-AMP cyclohydrolase OS=Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1) GN=hisI PE=3 SV=1 201 315 8.0E-17
sp|Q3Z0F9|HIS2_SHISS Histidine biosynthesis bifunctional protein HisIE OS=Shigella sonnei (strain Ss046) GN=hisI PE=3 SV=1 198 353 9.0E-17
sp|Q9S5G3|HIS2_ECO57 Histidine biosynthesis bifunctional protein HisIE OS=Escherichia coli O157:H7 GN=hisI PE=3 SV=1 198 353 9.0E-17
sp|Q8FG47|HIS2_ECOL6 Histidine biosynthesis bifunctional protein HisIE OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=hisI PE=3 SV=1 198 353 1.0E-16
sp|P44434|HIS2_HAEIN Histidine biosynthesis bifunctional protein HisIE OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=hisI PE=3 SV=1 195 353 2.0E-16
sp|Q7VJ02|HIS2_HELHP Histidine biosynthesis bifunctional protein HisIE OS=Helicobacter hepaticus (strain ATCC 51449 / 3B1) GN=hisI PE=3 SV=1 203 402 2.0E-16
sp|Q8ZFY1|HIS2_YERPE Histidine biosynthesis bifunctional protein HisIE OS=Yersinia pestis GN=hisI PE=3 SV=1 198 353 2.0E-16
sp|Q47QS0|HIS3_THEFY Phosphoribosyl-AMP cyclohydrolase OS=Thermobifida fusca (strain YX) GN=hisI PE=3 SV=1 201 288 3.0E-16
sp|Q8DM88|HIS2_THEEB Histidine biosynthesis bifunctional protein HisIE OS=Thermosynechococcus elongatus (strain BP-1) GN=hisI PE=3 SV=1 202 376 5.0E-16
sp|Q7TUC7|HIS2_PROMP Histidine biosynthesis bifunctional protein HisIE OS=Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / MED4) GN=hisI PE=3 SV=1 202 379 8.0E-16
sp|P10367|HIS2_SALTY Histidine biosynthesis bifunctional protein HisIE OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=hisI PE=3 SV=2 198 373 1.0E-15
sp|Q8Z5J6|HIS2_SALTI Histidine biosynthesis bifunctional protein HisIE OS=Salmonella typhi GN=hisI PE=3 SV=1 198 353 2.0E-15
sp|Q8NUI4|HIS2_STAAW Histidine biosynthesis bifunctional protein HisIE OS=Staphylococcus aureus (strain MW2) GN=hisI PE=3 SV=1 195 391 3.0E-15
sp|Q6G603|HIS2_STAAS Histidine biosynthesis bifunctional protein HisIE OS=Staphylococcus aureus (strain MSSA476) GN=hisI PE=3 SV=1 195 391 3.0E-15
sp|Q6GDD2|HIS2_STAAR Histidine biosynthesis bifunctional protein HisIE OS=Staphylococcus aureus (strain MRSA252) GN=hisI PE=3 SV=1 195 391 3.0E-15
sp|Q5HCM5|HIS2_STAAC Histidine biosynthesis bifunctional protein HisIE OS=Staphylococcus aureus (strain COL) GN=hisI PE=3 SV=1 195 391 3.0E-15
sp|Q8A7Z7|HIS2_BACTN Histidine biosynthesis bifunctional protein HisIE OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482) GN=hisI PE=3 SV=1 198 376 3.0E-15
sp|P64356|HIS2_STAAN Histidine biosynthesis bifunctional protein HisIE OS=Staphylococcus aureus (strain N315) GN=hisI PE=3 SV=1 195 391 9.0E-15
sp|P64355|HIS2_STAAM Histidine biosynthesis bifunctional protein HisIE OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=hisI PE=3 SV=1 195 391 9.0E-15
sp|Q8CQ91|HIS2_STAES Histidine biosynthesis bifunctional protein HisIE OS=Staphylococcus epidermidis (strain ATCC 12228) GN=hisI PE=3 SV=1 198 389 1.0E-14
sp|Q5HKP3|HIS2_STAEQ Histidine biosynthesis bifunctional protein HisIE OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=hisI PE=3 SV=1 198 391 1.0E-14
sp|Q9RPQ3|HIS2_THEP3 Histidine biosynthesis bifunctional protein HisIE OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) GN=hisI PE=3 SV=1 202 369 1.0E-14
sp|Q9ZHE0|HIS2_BUCAP Histidine biosynthesis bifunctional protein HisIE OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=hisI PE=3 SV=2 199 353 2.0E-14
sp|Q8Y9G6|HIS3_LISMO Phosphoribosyl-AMP cyclohydrolase OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=hisI PE=3 SV=1 198 291 2.0E-14
sp|Q722Y8|HIS3_LISMF Phosphoribosyl-AMP cyclohydrolase OS=Listeria monocytogenes serotype 4b (strain F2365) GN=hisI PE=3 SV=1 198 291 2.0E-14
sp|C1L0J1|HIS3_LISMC Phosphoribosyl-AMP cyclohydrolase OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=hisI PE=3 SV=1 198 291 2.0E-14
sp|B8DA63|HIS3_LISMH Phosphoribosyl-AMP cyclohydrolase OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=hisI PE=3 SV=1 198 291 2.0E-14
sp|Q03K83|HIS3_STRTD Phosphoribosyl-AMP cyclohydrolase OS=Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9) GN=hisI PE=3 SV=1 198 288 4.0E-14
sp|Q8PLG5|HIS2_XANAC Histidine biosynthesis bifunctional protein HisIE OS=Xanthomonas axonopodis pv. citri (strain 306) GN=hisI PE=3 SV=1 198 376 4.0E-14
sp|O82768|HIS2_ARATH Histidine biosynthesis bifunctional protein hisIE, chloroplastic OS=Arabidopsis thaliana GN=HISN2 PE=1 SV=1 202 369 5.0E-14
sp|O28329|HIS3_ARCFU Phosphoribosyl-AMP cyclohydrolase OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=hisI PE=3 SV=1 200 288 5.0E-14
sp|P57207|HIS2_BUCAI Histidine biosynthesis bifunctional protein HisIE OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=hisI PE=3 SV=1 199 353 5.0E-14
sp|A0AG14|HIS3_LISW6 Phosphoribosyl-AMP cyclohydrolase OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=hisI PE=3 SV=1 198 291 6.0E-14
sp|P60541|HIS3_CORDI Phosphoribosyl-AMP cyclohydrolase OS=Corynebacterium diphtheriae (strain ATCC 700971 / NCTC 13129 / Biotype gravis) GN=hisI PE=3 SV=1 202 288 7.0E-14
sp|Q3AT43|HIS3_CHLCH Phosphoribosyl-AMP cyclohydrolase OS=Chlorobium chlorochromatii (strain CaD3) GN=hisI PE=3 SV=1 201 288 7.0E-14
sp|Q9PBD1|HIS2_XYLFA Histidine biosynthesis bifunctional protein HisIE OS=Xylella fastidiosa (strain 9a5c) GN=hisI PE=3 SV=1 201 376 7.0E-14
sp|Q87C35|HIS2_XYLFT Histidine biosynthesis bifunctional protein HisIE OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=hisI PE=3 SV=1 201 376 8.0E-14
sp|B7HKD5|HIS3_BACC7 Phosphoribosyl-AMP cyclohydrolase OS=Bacillus cereus (strain AH187) GN=hisI PE=3 SV=1 202 288 1.0E-13
sp|Q92E89|HIS3_LISIN Phosphoribosyl-AMP cyclohydrolase OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=hisI PE=3 SV=1 198 291 1.0E-13
sp|Q6HLE2|HIS3_BACHK Phosphoribosyl-AMP cyclohydrolase OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=hisI PE=3 SV=1 202 288 1.0E-13
sp|Q63DW7|HIS3_BACCZ Phosphoribosyl-AMP cyclohydrolase OS=Bacillus cereus (strain ZK / E33L) GN=hisI PE=3 SV=1 202 288 1.0E-13
sp|P9WMM7|HIS3_MYCTU Phosphoribosyl-AMP cyclohydrolase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=hisI PE=1 SV=1 201 288 2.0E-13
sp|P9WMM6|HIS3_MYCTO Phosphoribosyl-AMP cyclohydrolase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=hisI PE=3 SV=1 201 288 2.0E-13
sp|A5U2W2|HIS3_MYCTA Phosphoribosyl-AMP cyclohydrolase OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=hisI PE=3 SV=1 201 288 2.0E-13
sp|C1ANM8|HIS3_MYCBT Phosphoribosyl-AMP cyclohydrolase OS=Mycobacterium bovis (strain BCG / Tokyo 172 / ATCC 35737 / TMC 1019) GN=hisI PE=3 SV=1 201 288 2.0E-13
sp|A1KJ22|HIS3_MYCBP Phosphoribosyl-AMP cyclohydrolase OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) GN=hisI PE=3 SV=1 201 288 2.0E-13
sp|P0A5B4|HIS3_MYCBO Phosphoribosyl-AMP cyclohydrolase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=hisI PE=3 SV=1 201 288 2.0E-13
sp|B9IV01|HIS3_BACCQ Phosphoribosyl-AMP cyclohydrolase OS=Bacillus cereus (strain Q1) GN=hisI PE=3 SV=1 202 288 2.0E-13
sp|Q1GGT9|HIS3_RUEST Phosphoribosyl-AMP cyclohydrolase OS=Ruegeria sp. (strain TM1040) GN=hisI PE=3 SV=1 202 288 2.0E-13
sp|Q8P9N8|HIS2_XANCP Histidine biosynthesis bifunctional protein HisIE OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=hisI PE=3 SV=1 198 376 2.0E-13
sp|B6IMI3|HIS3_RHOCS Phosphoribosyl-AMP cyclohydrolase OS=Rhodospirillum centenum (strain ATCC 51521 / SW) GN=hisI PE=3 SV=1 201 288 2.0E-13
sp|Q0BWU4|HIS3_HYPNA Phosphoribosyl-AMP cyclohydrolase OS=Hyphomonas neptunium (strain ATCC 15444) GN=hisI PE=3 SV=1 200 288 3.0E-13
sp|Q8DTR4|HIS3_STRMU Phosphoribosyl-AMP cyclohydrolase OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=hisI PE=3 SV=1 199 290 3.0E-13
sp|Q02130|HIS2_LACLA Histidine biosynthesis bifunctional protein HisIE OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=hisI PE=3 SV=2 203 369 3.0E-13
sp|B2UX19|HIS3_CLOBA Phosphoribosyl-AMP cyclohydrolase OS=Clostridium botulinum (strain Alaska E43 / Type E3) GN=hisI PE=3 SV=1 198 288 4.0E-13
sp|Q0A9D7|HIS3_ALKEH Phosphoribosyl-AMP cyclohydrolase OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) GN=hisI PE=3 SV=1 202 290 4.0E-13
sp|C1EMQ8|HIS3_BACC3 Phosphoribosyl-AMP cyclohydrolase OS=Bacillus cereus (strain 03BB102) GN=hisI PE=3 SV=1 202 288 4.0E-13
sp|A0RBM3|HIS3_BACAH Phosphoribosyl-AMP cyclohydrolase OS=Bacillus thuringiensis (strain Al Hakam) GN=hisI PE=3 SV=1 202 288 4.0E-13
sp|A9A5W9|HIS3_NITMS Phosphoribosyl-AMP cyclohydrolase OS=Nitrosopumilus maritimus (strain SCM1) GN=hisI PE=3 SV=1 198 290 5.0E-13
sp|B8GU33|HIS3_THISH Phosphoribosyl-AMP cyclohydrolase OS=Thioalkalivibrio sulfidiphilus (strain HL-EbGR7) GN=hisI PE=3 SV=1 201 288 5.0E-13
sp|A7GMV1|HIS3_BACCN Phosphoribosyl-AMP cyclohydrolase OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=hisI PE=3 SV=1 202 288 5.0E-13
sp|B3EM52|HIS3_CHLPB Phosphoribosyl-AMP cyclohydrolase OS=Chlorobium phaeobacteroides (strain BS1) GN=hisI PE=3 SV=1 201 288 5.0E-13
sp|Q8NNT9|HIS3_CORGL Phosphoribosyl-AMP cyclohydrolase OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=hisI PE=3 SV=1 202 290 7.0E-13
sp|A1BDQ9|HIS3_CHLPD Phosphoribosyl-AMP cyclohydrolase OS=Chlorobium phaeobacteroides (strain DSM 266) GN=hisI PE=3 SV=1 200 288 7.0E-13
sp|B7JFZ6|HIS3_BACC0 Phosphoribosyl-AMP cyclohydrolase OS=Bacillus cereus (strain AH820) GN=hisI PE=3 SV=1 202 288 8.0E-13
sp|P60540|HIS3_BACAN Phosphoribosyl-AMP cyclohydrolase OS=Bacillus anthracis GN=hisI PE=3 SV=1 202 288 8.0E-13
sp|C3L9P6|HIS3_BACAC Phosphoribosyl-AMP cyclohydrolase OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=hisI PE=3 SV=1 202 288 8.0E-13
sp|A5G0S8|HIS3_ACICJ Phosphoribosyl-AMP cyclohydrolase OS=Acidiphilium cryptum (strain JF-5) GN=hisI PE=3 SV=1 202 288 9.0E-13
sp|B9KRK6|HIS3_RHOSK Phosphoribosyl-AMP cyclohydrolase OS=Rhodobacter sphaeroides (strain KD131 / KCTC 12085) GN=hisI PE=3 SV=1 201 288 1.0E-12
sp|P62393|HIS3_BACC1 Phosphoribosyl-AMP cyclohydrolase OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=hisI PE=3 SV=1 202 288 1.0E-12
sp|C3KVX7|HIS3_CLOB6 Phosphoribosyl-AMP cyclohydrolase OS=Clostridium botulinum (strain 657 / Type Ba4) GN=hisI PE=3 SV=1 199 288 1.0E-12
sp|Q2S3T1|HIS3_SALRD Phosphoribosyl-AMP cyclohydrolase OS=Salinibacter ruber (strain DSM 13855 / M31) GN=hisI PE=3 SV=1 201 288 1.0E-12
sp|A0RZ79|HIS3_CENSY Phosphoribosyl-AMP cyclohydrolase OS=Cenarchaeum symbiosum (strain A) GN=hisI PE=3 SV=1 198 288 1.0E-12
sp|Q4JW51|HIS3_CORJK Phosphoribosyl-AMP cyclohydrolase OS=Corynebacterium jeikeium (strain K411) GN=hisI PE=3 SV=1 172 288 1.0E-12
sp|A6LT23|HIS3_CLOB8 Phosphoribosyl-AMP cyclohydrolase OS=Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052) GN=hisI PE=3 SV=1 198 288 1.0E-12
sp|B1ILB1|HIS3_CLOBK Phosphoribosyl-AMP cyclohydrolase OS=Clostridium botulinum (strain Okra / Type B1) GN=hisI PE=3 SV=1 202 288 2.0E-12
sp|A4QFF8|HIS3_CORGB Phosphoribosyl-AMP cyclohydrolase OS=Corynebacterium glutamicum (strain R) GN=hisI PE=3 SV=1 202 290 2.0E-12
sp|Q53158|HIS3_RHOS4 Phosphoribosyl-AMP cyclohydrolase OS=Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) GN=hisI PE=3 SV=1 201 288 2.0E-12
sp|Q8KF68|HIS3_CHLTE Phosphoribosyl-AMP cyclohydrolase OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) GN=hisI PE=3 SV=1 201 288 2.0E-12
sp|A3PJ78|HIS3_RHOS1 Phosphoribosyl-AMP cyclohydrolase OS=Rhodobacter sphaeroides (strain ATCC 17029 / ATH 2.4.9) GN=hisI PE=3 SV=1 201 288 3.0E-12
sp|B3QLJ0|HIS3_CHLP8 Phosphoribosyl-AMP cyclohydrolase OS=Chlorobaculum parvum (strain NCIB 8327) GN=hisI PE=3 SV=1 177 288 3.0E-12
sp|Q166D6|HIS3_ROSDO Phosphoribosyl-AMP cyclohydrolase OS=Roseobacter denitrificans (strain ATCC 33942 / OCh 114) GN=hisI PE=3 SV=1 200 288 3.0E-12
sp|Q4K3E4|HIS32_PSEF5 Phosphoribosyl-AMP cyclohydrolase 2 OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=hisI2 PE=3 SV=1 183 290 3.0E-12
sp|A1B9F2|HIS3_PARDP Phosphoribosyl-AMP cyclohydrolase OS=Paracoccus denitrificans (strain Pd 1222) GN=hisI PE=3 SV=1 201 288 4.0E-12
sp|A1WXS8|HIS3_HALHL Phosphoribosyl-AMP cyclohydrolase OS=Halorhodospira halophila (strain DSM 244 / SL1) GN=hisI PE=3 SV=1 201 291 5.0E-12
sp|A4T9N1|HIS3_MYCGI Phosphoribosyl-AMP cyclohydrolase OS=Mycobacterium gilvum (strain PYR-GCK) GN=hisI PE=3 SV=1 201 288 6.0E-12
sp|A4WRQ0|HIS3_RHOS5 Phosphoribosyl-AMP cyclohydrolase OS=Rhodobacter sphaeroides (strain ATCC 17025 / ATH 2.4.3) GN=hisI PE=3 SV=1 202 288 8.0E-12
sp|B3EFT2|HIS3_CHLL2 Phosphoribosyl-AMP cyclohydrolase OS=Chlorobium limicola (strain DSM 245 / NBRC 103803) GN=hisI PE=3 SV=1 200 288 8.0E-12
sp|Q7N6I6|HIS2_PHOLL Histidine biosynthesis bifunctional protein HisIE OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=hisI PE=3 SV=1 203 353 9.0E-12
sp|Q0BTI5|HIS3_GRABC Phosphoribosyl-AMP cyclohydrolase OS=Granulibacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1) GN=hisI PE=3 SV=1 202 288 1.0E-11
sp|A4SG83|HIS3_CHLPM Phosphoribosyl-AMP cyclohydrolase OS=Chlorobium phaeovibrioides (strain DSM 265 / 1930) GN=hisI PE=3 SV=1 202 288 1.0E-11
sp|A5I247|HIS3_CLOBH Phosphoribosyl-AMP cyclohydrolase OS=Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A) GN=hisI PE=3 SV=1 202 288 1.0E-11
sp|A7FU83|HIS3_CLOB1 Phosphoribosyl-AMP cyclohydrolase OS=Clostridium botulinum (strain ATCC 19397 / Type A) GN=hisI PE=3 SV=1 202 288 1.0E-11
sp|Q81G01|HIS3_BACCR Phosphoribosyl-AMP cyclohydrolase OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=hisI PE=3 SV=1 202 288 1.0E-11
sp|Q58825|HIS3_METJA Phosphoribosyl-AMP cyclohydrolase OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=hisI PE=3 SV=1 203 288 1.0E-11
sp|C1A0L2|HIS3_RHOE4 Phosphoribosyl-AMP cyclohydrolase OS=Rhodococcus erythropolis (strain PR4 / NBRC 100887) GN=hisI PE=3 SV=1 199 288 1.0E-11
sp|B7HHG6|HIS3_BACC4 Phosphoribosyl-AMP cyclohydrolase OS=Bacillus cereus (strain B4264) GN=hisI PE=3 SV=1 202 288 1.0E-11
sp|B0KM39|HIS3_PSEPG Phosphoribosyl-AMP cyclohydrolase OS=Pseudomonas putida (strain GB-1) GN=hisI PE=3 SV=1 195 288 2.0E-11
sp|Q9HN23|HIS3_HALSA Phosphoribosyl-AMP cyclohydrolase OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=hisI PE=3 SV=1 196 288 2.0E-11
sp|B0R7I1|HIS3_HALS3 Phosphoribosyl-AMP cyclohydrolase OS=Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1) GN=hisI PE=3 SV=1 196 288 2.0E-11
sp|C5CBK2|HIS3_MICLC Phosphoribosyl-AMP cyclohydrolase OS=Micrococcus luteus (strain ATCC 4698 / DSM 20030 / JCM 1464 / NBRC 3333 / NCIMB 9278 / NCTC 2665 / VKM Ac-2230) GN=hisI PE=3 SV=1 202 288 2.0E-11
sp|Q28PE4|HIS3_JANSC Phosphoribosyl-AMP cyclohydrolase OS=Jannaschia sp. (strain CCS1) GN=hisI PE=3 SV=1 201 288 2.0E-11
sp|Q88D15|HIS3_PSEPK Phosphoribosyl-AMP cyclohydrolase OS=Pseudomonas putida (strain KT2440) GN=hisI PE=3 SV=1 195 288 2.0E-11
sp|A5WA48|HIS3_PSEP1 Phosphoribosyl-AMP cyclohydrolase OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=hisI PE=3 SV=1 195 288 2.0E-11
sp|A0PP21|HIS3_MYCUA Phosphoribosyl-AMP cyclohydrolase OS=Mycobacterium ulcerans (strain Agy99) GN=hisI PE=3 SV=1 201 288 2.0E-11
sp|Q3B281|HIS3_CHLL7 Phosphoribosyl-AMP cyclohydrolase OS=Chlorobium luteolum (strain DSM 273 / 2530) GN=hisI PE=3 SV=1 202 288 2.0E-11
sp|Q3IMJ0|HIS3_NATPD Phosphoribosyl-AMP cyclohydrolase OS=Natronomonas pharaonis (strain ATCC 35678 / DSM 2160) GN=hisI PE=3 SV=1 198 288 2.0E-11
sp|Q5FPD9|HIS3_GLUOX Phosphoribosyl-AMP cyclohydrolase OS=Gluconobacter oxydans (strain 621H) GN=hisI PE=3 SV=1 201 288 2.0E-11
sp|Q82A89|HIS3_STRAW Phosphoribosyl-AMP cyclohydrolase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=hisI PE=3 SV=1 201 299 3.0E-11
sp|Q2LVG1|HIS3_SYNAS Phosphoribosyl-AMP cyclohydrolase OS=Syntrophus aciditrophicus (strain SB) GN=hisI PE=3 SV=1 199 288 3.0E-11
sp|B1J2S5|HIS3_PSEPW Phosphoribosyl-AMP cyclohydrolase OS=Pseudomonas putida (strain W619) GN=hisI PE=3 SV=1 195 288 3.0E-11
sp|Q2W4W4|HIS3_MAGSA Phosphoribosyl-AMP cyclohydrolase OS=Magnetospirillum magneticum (strain AMB-1 / ATCC 700264) GN=hisI PE=3 SV=1 201 288 3.0E-11
sp|Q2KTT0|HIS3_BORA1 Phosphoribosyl-AMP cyclohydrolase OS=Bordetella avium (strain 197N) GN=hisI PE=3 SV=1 201 288 4.0E-11
sp|A4FZQ7|HIS3_METM5 Phosphoribosyl-AMP cyclohydrolase OS=Methanococcus maripaludis (strain C5 / ATCC BAA-1333) GN=hisI PE=3 SV=1 203 305 4.0E-11
sp|Q5UZH6|HIS3_HALMA Phosphoribosyl-AMP cyclohydrolase OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=hisI PE=3 SV=1 198 288 4.0E-11
sp|C1ATY6|HIS3_RHOOB Phosphoribosyl-AMP cyclohydrolase OS=Rhodococcus opacus (strain B4) GN=hisI PE=3 SV=1 202 288 4.0E-11
sp|C1FN43|HIS3_CLOBJ Phosphoribosyl-AMP cyclohydrolase OS=Clostridium botulinum (strain Kyoto / Type A2) GN=hisI PE=3 SV=1 203 288 4.0E-11
sp|Q0SHY8|HIS3_RHOJR Phosphoribosyl-AMP cyclohydrolase OS=Rhodococcus jostii (strain RHA1) GN=hisI PE=3 SV=1 202 288 4.0E-11
sp|A4FLL5|HIS3_SACEN Phosphoribosyl-AMP cyclohydrolase OS=Saccharopolyspora erythraea (strain ATCC 11635 / DSM 40517 / JCM 4748 / NBRC 13426 / NCIMB 8594 / NRRL 2338) GN=hisI PE=3 SV=1 201 288 4.0E-11
sp|B7INA4|HIS3_BACC2 Phosphoribosyl-AMP cyclohydrolase OS=Bacillus cereus (strain G9842) GN=hisI PE=3 SV=1 202 288 5.0E-11
sp|Q7TV28|HIS2_PROMM Histidine biosynthesis bifunctional protein HisIE OS=Prochlorococcus marinus (strain MIT 9313) GN=hisI PE=3 SV=1 202 369 5.0E-11
sp|A5CZ72|HIS3_PELTS Phosphoribosyl-AMP cyclohydrolase OS=Pelotomaculum thermopropionicum (strain DSM 13744 / JCM 10971 / SI) GN=hisI PE=3 SV=1 200 316 5.0E-11
sp|B4SCX8|HIS3_PELPB Phosphoribosyl-AMP cyclohydrolase OS=Pelodictyon phaeoclathratiforme (strain DSM 5477 / BU-1) GN=hisI PE=3 SV=1 202 313 5.0E-11
sp|Q3ST00|HIS3_NITWN Phosphoribosyl-AMP cyclohydrolase OS=Nitrobacter winogradskyi (strain Nb-255 / ATCC 25391) GN=hisI PE=3 SV=1 202 288 5.0E-11
sp|B2HQA9|HIS3_MYCMM Phosphoribosyl-AMP cyclohydrolase OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=hisI PE=3 SV=1 201 288 5.0E-11
sp|Q6A8P2|HIS3_PROAC Phosphoribosyl-AMP cyclohydrolase OS=Propionibacterium acnes (strain KPA171202 / DSM 16379) GN=hisI PE=3 SV=1 202 288 5.0E-11
sp|Q89AX6|HIS2_BUCBP Histidine biosynthesis bifunctional protein HisIE OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=hisI PE=3 SV=1 198 379 5.0E-11
sp|Q5YYP1|HIS3_NOCFA Phosphoribosyl-AMP cyclohydrolase OS=Nocardia farcinica (strain IFM 10152) GN=hisI PE=3 SV=1 202 288 6.0E-11
sp|Q7VD07|HIS2_PROMA Histidine biosynthesis bifunctional protein HisIE OS=Prochlorococcus marinus (strain SARG / CCMP1375 / SS120) GN=hisI PE=3 SV=1 200 353 6.0E-11
sp|A1T8W8|HIS3_MYCVP Phosphoribosyl-AMP cyclohydrolase OS=Mycobacterium vanbaalenii (strain DSM 7251 / PYR-1) GN=hisI PE=3 SV=1 201 288 7.0E-11
sp|A0QX88|HIS3_MYCS2 Phosphoribosyl-AMP cyclohydrolase OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=hisI PE=3 SV=1 201 288 7.0E-11
sp|B4S4Y9|HIS3_PROA2 Phosphoribosyl-AMP cyclohydrolase OS=Prosthecochloris aestuarii (strain DSM 271 / SK 413) GN=hisI PE=3 SV=1 202 288 7.0E-11
sp|A8LK58|HIS3_DINSH Phosphoribosyl-AMP cyclohydrolase OS=Dinoroseobacter shibae (strain DSM 16493 / NCIMB 14021 / DFL 12) GN=hisI PE=3 SV=1 202 288 9.0E-11
sp|A2STB6|HIS3_METLZ Phosphoribosyl-AMP cyclohydrolase OS=Methanocorpusculum labreanum (strain ATCC 43576 / DSM 4855 / Z) GN=hisI PE=3 SV=1 200 288 9.0E-11
sp|Q1QMS2|HIS3_NITHX Phosphoribosyl-AMP cyclohydrolase OS=Nitrobacter hamburgensis (strain X14 / DSM 10229) GN=hisI PE=3 SV=1 202 288 9.0E-11
sp|A3CX32|HIS3_METMJ Phosphoribosyl-AMP cyclohydrolase OS=Methanoculleus marisnigri (strain ATCC 35101 / DSM 1498 / JR1) GN=hisI PE=3 SV=1 200 288 9.0E-11
sp|Q97KH7|HIS3_CLOAB Phosphoribosyl-AMP cyclohydrolase OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=hisI PE=3 SV=1 198 288 1.0E-10
sp|Q21FQ0|HIS3_SACD2 Phosphoribosyl-AMP cyclohydrolase OS=Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024) GN=hisI PE=3 SV=1 201 288 1.0E-10
sp|Q1B7H1|HIS3_MYCSS Phosphoribosyl-AMP cyclohydrolase OS=Mycobacterium sp. (strain MCS) GN=hisI PE=3 SV=1 201 288 1.0E-10
sp|A1UHK1|HIS3_MYCSK Phosphoribosyl-AMP cyclohydrolase OS=Mycobacterium sp. (strain KMS) GN=hisI PE=3 SV=1 201 288 1.0E-10
sp|A0LCF4|HIS3_MAGMM Phosphoribosyl-AMP cyclohydrolase OS=Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1) GN=hisI PE=3 SV=1 200 288 1.0E-10
sp|A1SL49|HIS3_NOCSJ Phosphoribosyl-AMP cyclohydrolase OS=Nocardioides sp. (strain BAA-499 / JS614) GN=hisI PE=3 SV=1 201 288 1.0E-10
sp|A3Q124|HIS3_MYCSJ Phosphoribosyl-AMP cyclohydrolase OS=Mycobacterium sp. (strain JLS) GN=hisI PE=3 SV=1 201 288 1.0E-10
sp|Q89IW3|HIS3_BRADU Phosphoribosyl-AMP cyclohydrolase OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=hisI PE=3 SV=1 202 288 1.0E-10
sp|A0QHH5|HIS3_MYCA1 Phosphoribosyl-AMP cyclohydrolase OS=Mycobacterium avium (strain 104) GN=hisI PE=3 SV=1 201 288 1.0E-10
sp|Q18DH0|HIS3_HALWD Phosphoribosyl-AMP cyclohydrolase OS=Haloquadratum walsbyi (strain DSM 16790 / HBSQ001) GN=hisI PE=3 SV=1 201 288 1.0E-10
sp|P60543|HIS3_MYCPA Phosphoribosyl-AMP cyclohydrolase OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=hisI PE=3 SV=1 201 288 1.0E-10
sp|A4VGE2|HIS3_PSEU5 Phosphoribosyl-AMP cyclohydrolase OS=Pseudomonas stutzeri (strain A1501) GN=hisI PE=3 SV=1 201 288 1.0E-10
sp|Q8FP00|HIS3_COREF Phosphoribosyl-AMP cyclohydrolase OS=Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395) GN=hisI PE=3 SV=1 202 288 1.0E-10
sp|A1U670|HIS3_MARHV Phosphoribosyl-AMP cyclohydrolase OS=Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8) GN=hisI PE=3 SV=1 188 288 1.0E-10
sp|O26347|HIS3_METTH Phosphoribosyl-AMP cyclohydrolase OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=hisI PE=1 SV=1 200 288 1.0E-10
sp|Q9X7C3|HIS3_MYCLE Phosphoribosyl-AMP cyclohydrolase OS=Mycobacterium leprae (strain TN) GN=hisI PE=3 SV=1 201 288 2.0E-10
sp|B8ZRB5|HIS3_MYCLB Phosphoribosyl-AMP cyclohydrolase OS=Mycobacterium leprae (strain Br4923) GN=hisI PE=3 SV=1 201 288 2.0E-10
sp|Q0RFX5|HIS3_FRAAA Phosphoribosyl-AMP cyclohydrolase OS=Frankia alni (strain ACN14a) GN=hisI PE=3 SV=1 202 288 2.0E-10
sp|Q1QWC3|HIS3_CHRSD Phosphoribosyl-AMP cyclohydrolase OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=hisI PE=3 SV=1 202 288 2.0E-10
sp|Q1I3S7|HIS3_PSEE4 Phosphoribosyl-AMP cyclohydrolase OS=Pseudomonas entomophila (strain L48) GN=hisI PE=3 SV=1 195 288 2.0E-10
sp|Q3SEU9|HIS3_THIDA Phosphoribosyl-AMP cyclohydrolase OS=Thiobacillus denitrificans (strain ATCC 25259) GN=hisI PE=3 SV=1 202 288 2.0E-10
sp|A9A817|HIS3_METM6 Phosphoribosyl-AMP cyclohydrolase OS=Methanococcus maripaludis (strain C6 / ATCC BAA-1332) GN=hisI PE=3 SV=1 203 290 2.0E-10
sp|A4YSB5|HIS3_BRASO Phosphoribosyl-AMP cyclohydrolase OS=Bradyrhizobium sp. (strain ORS278) GN=hisI PE=3 SV=1 202 288 2.0E-10
sp|Q9HUB7|HIS3_PSEAE Phosphoribosyl-AMP cyclohydrolase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=hisI PE=3 SV=1 194 288 2.0E-10
sp|Q02EV1|HIS3_PSEAB Phosphoribosyl-AMP cyclohydrolase OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=hisI PE=3 SV=1 194 288 2.0E-10
sp|B7V3F9|HIS3_PSEA8 Phosphoribosyl-AMP cyclohydrolase OS=Pseudomonas aeruginosa (strain LESB58) GN=hisI PE=3 SV=1 194 288 2.0E-10
sp|A6VDI9|HIS3_PSEA7 Phosphoribosyl-AMP cyclohydrolase OS=Pseudomonas aeruginosa (strain PA7) GN=hisI PE=3 SV=1 194 288 2.0E-10
sp|C1DHS5|HIS3_AZOVD Phosphoribosyl-AMP cyclohydrolase OS=Azotobacter vinelandii (strain DJ / ATCC BAA-1303) GN=hisI PE=3 SV=1 194 288 2.0E-10
sp|Q0AEU0|HIS3_NITEC Phosphoribosyl-AMP cyclohydrolase OS=Nitrosomonas eutropha (strain C91) GN=hisI PE=3 SV=1 201 288 2.0E-10
sp|Q5LST2|HIS3_RUEPO Phosphoribosyl-AMP cyclohydrolase OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) GN=hisI PE=3 SV=1 202 288 2.0E-10
sp|A8ZXG8|HIS3_DESOH Phosphoribosyl-AMP cyclohydrolase OS=Desulfococcus oleovorans (strain DSM 6200 / Hxd3) GN=hisI PE=3 SV=1 198 288 3.0E-10
sp|A1KAV3|HIS3_AZOSB Phosphoribosyl-AMP cyclohydrolase OS=Azoarcus sp. (strain BH72) GN=hisI PE=3 SV=1 200 288 3.0E-10
sp|C0QLA8|HIS3_DESAH Phosphoribosyl-AMP cyclohydrolase OS=Desulfobacterium autotrophicum (strain ATCC 43914 / DSM 3382 / HRM2) GN=hisI PE=3 SV=1 198 288 3.0E-10
sp|Q88UE4|HIS3_LACPL Phosphoribosyl-AMP cyclohydrolase OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=hisI PE=3 SV=1 198 290 3.0E-10
sp|Q0VML6|HIS3_ALCBS Phosphoribosyl-AMP cyclohydrolase OS=Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2) GN=hisI PE=3 SV=1 202 288 3.0E-10
sp|Q87UY9|HIS3_PSESM Phosphoribosyl-AMP cyclohydrolase OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=hisI PE=3 SV=1 194 288 3.0E-10
sp|Q48PJ7|HIS3_PSE14 Phosphoribosyl-AMP cyclohydrolase OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=hisI PE=3 SV=1 194 288 3.0E-10
sp|A5ELY1|HIS3_BRASB Phosphoribosyl-AMP cyclohydrolase OS=Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182) GN=hisI PE=3 SV=1 202 288 4.0E-10
sp|B8FLE7|HIS3_DESAA Phosphoribosyl-AMP cyclohydrolase OS=Desulfatibacillum alkenivorans (strain AK-01) GN=hisI PE=3 SV=1 198 291 4.0E-10
sp|Q4ZZG6|HIS3_PSEU2 Phosphoribosyl-AMP cyclohydrolase OS=Pseudomonas syringae pv. syringae (strain B728a) GN=hisI PE=3 SV=1 194 288 4.0E-10
sp|Q7VSY5|HIS3_BORPE Phosphoribosyl-AMP cyclohydrolase OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=hisI PE=3 SV=1 200 288 4.0E-10
sp|B1W0N3|HIS3_STRGG Phosphoribosyl-AMP cyclohydrolase OS=Streptomyces griseus subsp. griseus (strain JCM 4626 / NBRC 13350) GN=hisI PE=3 SV=1 201 288 4.0E-10
sp|B3PK83|HIS3_CELJU Phosphoribosyl-AMP cyclohydrolase OS=Cellvibrio japonicus (strain Ueda107) GN=hisI PE=3 SV=1 201 288 5.0E-10
sp|Q82WM6|HIS3_NITEU Phosphoribosyl-AMP cyclohydrolase OS=Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298) GN=hisI PE=3 SV=1 201 288 5.0E-10
sp|Q47AM4|HIS3_DECAR Phosphoribosyl-AMP cyclohydrolase OS=Dechloromonas aromatica (strain RCB) GN=hisI PE=3 SV=1 201 296 5.0E-10
sp|Q43925|HIS3_AZOCH Phosphoribosyl-AMP cyclohydrolase OS=Azotobacter chroococcum mcd 1 GN=hisI PE=3 SV=1 194 288 5.0E-10
sp|A1VHE5|HIS3_DESVV Phosphoribosyl-AMP cyclohydrolase OS=Desulfovibrio vulgaris subsp. vulgaris (strain DP4) GN=hisI PE=3 SV=1 202 288 5.0E-10
sp|P62386|HIS3_DESVH Phosphoribosyl-AMP cyclohydrolase OS=Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / NCIMB 8303) GN=hisI PE=3 SV=1 202 288 5.0E-10
sp|Q1H4R1|HIS3_METFK Phosphoribosyl-AMP cyclohydrolase OS=Methylobacillus flagellatus (strain KT / ATCC 51484 / DSM 6875) GN=hisI PE=3 SV=1 201 288 7.0E-10
sp|Q30VD6|HIS3_DESAG Phosphoribosyl-AMP cyclohydrolase OS=Desulfovibrio alaskensis (strain G20) GN=hisI PE=3 SV=1 198 288 7.0E-10
sp|Q039B6|HIS3_LACC3 Phosphoribosyl-AMP cyclohydrolase OS=Lactobacillus casei (strain ATCC 334) GN=hisI PE=3 SV=1 198 288 8.0E-10
sp|Q134L8|HIS3_RHOPS Phosphoribosyl-AMP cyclohydrolase OS=Rhodopseudomonas palustris (strain BisB5) GN=hisI PE=3 SV=1 202 288 8.0E-10
sp|B3WED0|HIS3_LACCB Phosphoribosyl-AMP cyclohydrolase OS=Lactobacillus casei (strain BL23) GN=hisI PE=3 SV=1 198 288 8.0E-10
sp|A9HWB8|HIS3_BORPD Phosphoribosyl-AMP cyclohydrolase OS=Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448) GN=hisI PE=3 SV=1 201 288 8.0E-10
sp|A2SE10|HIS3_METPP Phosphoribosyl-AMP cyclohydrolase OS=Methylibium petroleiphilum (strain PM1) GN=hisI PE=3 SV=1 200 288 8.0E-10
sp|Q845U6|HIS3_BURM1 Phosphoribosyl-AMP cyclohydrolase OS=Burkholderia multivorans (strain ATCC 17616 / 249) GN=hisI PE=3 SV=2 201 288 9.0E-10
sp|Q4KJL5|HIS31_PSEF5 Phosphoribosyl-AMP cyclohydrolase 1 OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=hisI1 PE=3 SV=1 201 288 9.0E-10
sp|B9JFG9|HIS3_AGRRK Phosphoribosyl-AMP cyclohydrolase OS=Agrobacterium radiobacter (strain K84 / ATCC BAA-868) GN=hisI PE=3 SV=1 202 288 9.0E-10
sp|A4JAX0|HIS3_BURVG Phosphoribosyl-AMP cyclohydrolase OS=Burkholderia vietnamiensis (strain G4 / LMG 22486) GN=hisI PE=3 SV=1 201 288 9.0E-10
sp|A6X0X1|HIS3_OCHA4 Phosphoribosyl-AMP cyclohydrolase OS=Ochrobactrum anthropi (strain ATCC 49188 / DSM 6882 / NCTC 12168) GN=hisI PE=3 SV=1 202 288 1.0E-09
sp|Q7W2X8|HIS3_BORPA Phosphoribosyl-AMP cyclohydrolase OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=hisI PE=3 SV=1 200 288 1.0E-09
sp|Q7WDX8|HIS3_BORBR Phosphoribosyl-AMP cyclohydrolase OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=hisI PE=3 SV=1 200 288 1.0E-09
sp|Q39K84|HIS3_BURL3 Phosphoribosyl-AMP cyclohydrolase OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=hisI PE=3 SV=1 201 288 1.0E-09
sp|Q7VQW4|HIS2_BLOFL Histidine biosynthesis bifunctional protein HisIE OS=Blochmannia floridanus GN=hisI PE=3 SV=1 199 377 1.0E-09
sp|A6UT21|HIS3_META3 Phosphoribosyl-AMP cyclohydrolase OS=Methanococcus aeolicus (strain Nankai-3 / ATCC BAA-1280) GN=hisI PE=3 SV=1 203 288 1.0E-09
sp|Q9S2U1|HIS3_STRCO Phosphoribosyl-AMP cyclohydrolase OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=hisI PE=3 SV=1 201 288 1.0E-09
sp|A0K3V9|HIS3_BURCH Phosphoribosyl-AMP cyclohydrolase OS=Burkholderia cenocepacia (strain HI2424) GN=hisI PE=3 SV=1 201 288 1.0E-09
sp|B1JUA6|HIS3_BURCC Phosphoribosyl-AMP cyclohydrolase OS=Burkholderia cenocepacia (strain MC0-3) GN=hisI PE=3 SV=1 201 288 1.0E-09
sp|Q1BS32|HIS3_BURCA Phosphoribosyl-AMP cyclohydrolase OS=Burkholderia cenocepacia (strain AU 1054) GN=hisI PE=3 SV=1 201 288 1.0E-09
sp|Q11JM5|HIS3_CHESB Phosphoribosyl-AMP cyclohydrolase OS=Chelativorans sp. (strain BNC1) GN=hisI PE=3 SV=1 201 288 1.0E-09
sp|Q0BIW3|HIS3_BURCM Phosphoribosyl-AMP cyclohydrolase OS=Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) GN=hisI PE=3 SV=1 201 288 1.0E-09
sp|B1YRW2|HIS3_BURA4 Phosphoribosyl-AMP cyclohydrolase OS=Burkholderia ambifaria (strain MC40-6) GN=hisI PE=3 SV=1 201 288 1.0E-09
sp|Q212N1|HIS3_RHOPB Phosphoribosyl-AMP cyclohydrolase OS=Rhodopseudomonas palustris (strain BisB18) GN=hisI PE=3 SV=1 202 288 1.0E-09
sp|Q98LQ5|HIS3_RHILO Phosphoribosyl-AMP cyclohydrolase OS=Rhizobium loti (strain MAFF303099) GN=hisI PE=3 SV=1 202 302 2.0E-09
sp|Q603K4|HIS3_METCA Phosphoribosyl-AMP cyclohydrolase OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=hisI PE=3 SV=1 201 288 2.0E-09
sp|Q3J6Q0|HIS3_NITOC Phosphoribosyl-AMP cyclohydrolase OS=Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848) GN=hisI PE=3 SV=1 200 288 2.0E-09
sp|A0B8B3|HIS3_METTP Phosphoribosyl-AMP cyclohydrolase OS=Methanosaeta thermophila (strain DSM 6194 / JCM 14653 / NBRC 101360 / PT) GN=hisI PE=3 SV=1 203 288 2.0E-09
sp|Q8TS96|HIS3_METAC Phosphoribosyl-AMP cyclohydrolase OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=hisI PE=3 SV=1 200 293 2.0E-09
sp|B4E642|HIS3_BURCJ Phosphoribosyl-AMP cyclohydrolase OS=Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610) GN=hisI PE=3 SV=1 201 288 2.0E-09
sp|Q5P796|HIS3_AROAE Phosphoribosyl-AMP cyclohydrolase OS=Aromatoleum aromaticum (strain EbN1) GN=hisI PE=3 SV=1 196 288 2.0E-09
sp|A1W445|HIS3_ACISJ Phosphoribosyl-AMP cyclohydrolase OS=Acidovorax sp. (strain JS42) GN=hisI PE=3 SV=1 202 290 2.0E-09
sp|B9MDW4|HIS3_ACIET Phosphoribosyl-AMP cyclohydrolase OS=Acidovorax ebreus (strain TPSY) GN=hisI PE=3 SV=1 202 290 3.0E-09
sp|Q2NGK6|HIS3_METST Phosphoribosyl-AMP cyclohydrolase OS=Methanosphaera stadtmanae (strain ATCC 43021 / DSM 3091 / JCM 11832 / MCB-3) GN=hisI PE=3 SV=1 211 288 3.0E-09
sp|Q3KJC8|HIS3_PSEPF Phosphoribosyl-AMP cyclohydrolase OS=Pseudomonas fluorescens (strain Pf0-1) GN=hisI PE=3 SV=1 201 288 4.0E-09
sp|Q6AJV8|HIS3_DESPS Phosphoribosyl-AMP cyclohydrolase OS=Desulfotalea psychrophila (strain LSv54 / DSM 12343) GN=hisI PE=3 SV=1 201 288 4.0E-09
sp|A6T375|HIS3_JANMA Phosphoribosyl-AMP cyclohydrolase OS=Janthinobacterium sp. (strain Marseille) GN=hisI PE=3 SV=1 200 288 4.0E-09
sp|A5CXC7|HIS3_VESOH Phosphoribosyl-AMP cyclohydrolase OS=Vesicomyosocius okutanii subsp. Calyptogena okutanii (strain HA) GN=hisI PE=3 SV=1 200 288 4.0E-09
sp|A1AVW3|HIS3_RUTMC Phosphoribosyl-AMP cyclohydrolase OS=Ruthia magnifica subsp. Calyptogena magnifica GN=hisI PE=3 SV=1 203 288 5.0E-09
sp|A7I9M0|HIS3_METB6 Phosphoribosyl-AMP cyclohydrolase OS=Methanoregula boonei (strain 6A8) GN=hisI PE=3 SV=1 200 288 5.0E-09
sp|B3QE24|HIS3_RHOPT Phosphoribosyl-AMP cyclohydrolase OS=Rhodopseudomonas palustris (strain TIE-1) GN=hisI PE=3 SV=1 202 305 5.0E-09
sp|A1WFT0|HIS3_VEREI Phosphoribosyl-AMP cyclohydrolase OS=Verminephrobacter eiseniae (strain EF01-2) GN=hisI PE=3 SV=2 202 288 5.0E-09
sp|Q0W7V3|HIS3_METAR Phosphoribosyl-AMP cyclohydrolase OS=Methanocella arvoryzae (strain DSM 22066 / NBRC 105507 / MRE50) GN=hisI PE=3 SV=1 200 288 6.0E-09
sp|P58836|HIS3_METKA Phosphoribosyl-AMP cyclohydrolase OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) GN=hisI PE=3 SV=1 181 288 6.0E-09
sp|A6VIS0|HIS3_METM7 Phosphoribosyl-AMP cyclohydrolase OS=Methanococcus maripaludis (strain C7 / ATCC BAA-1331) GN=hisI PE=3 SV=1 203 290 9.0E-09
sp|Q8YH95|HIS3_BRUME Phosphoribosyl-AMP cyclohydrolase OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=hisI PE=3 SV=1 202 288 1.0E-08
sp|C0RJ48|HIS3_BRUMB Phosphoribosyl-AMP cyclohydrolase OS=Brucella melitensis biotype 2 (strain ATCC 23457) GN=hisI PE=3 SV=1 202 288 1.0E-08
sp|Q57D60|HIS3_BRUAB Phosphoribosyl-AMP cyclohydrolase OS=Brucella abortus biovar 1 (strain 9-941) GN=hisI PE=3 SV=1 202 288 1.0E-08
sp|B2S5T1|HIS3_BRUA1 Phosphoribosyl-AMP cyclohydrolase OS=Brucella abortus (strain S19) GN=hisI PE=3 SV=1 202 288 1.0E-08
sp|Q8G0L3|HIS3_BRUSU Phosphoribosyl-AMP cyclohydrolase OS=Brucella suis biovar 1 (strain 1330) GN=hisI PE=3 SV=2 202 288 1.0E-08
sp|B0CGM5|HIS3_BRUSI Phosphoribosyl-AMP cyclohydrolase OS=Brucella suis (strain ATCC 23445 / NCTC 10510) GN=hisI PE=3 SV=1 202 288 1.0E-08
sp|A9M587|HIS3_BRUC2 Phosphoribosyl-AMP cyclohydrolase OS=Brucella canis (strain ATCC 23365 / NCTC 10854) GN=hisI PE=3 SV=1 202 288 1.0E-08
sp|A5V3S9|HIS3_SPHWW Phosphoribosyl-AMP cyclohydrolase OS=Sphingomonas wittichii (strain RW1 / DSM 6014 / JCM 10273) GN=hisI PE=3 SV=1 202 288 1.0E-08
sp|Q7UJC4|HIS3_RHOBA Phosphoribosyl-AMP cyclohydrolase OS=Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1) GN=hisI PE=3 SV=1 203 288 1.0E-08
sp|Q3M244|HIS3_ANAVT Phosphoribosyl-AMP cyclohydrolase OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=hisI PE=3 SV=1 198 300 1.0E-08
sp|A1TL07|HIS3_ACIAC Phosphoribosyl-AMP cyclohydrolase OS=Acidovorax citrulli (strain AAC00-1) GN=hisI PE=3 SV=1 202 288 1.0E-08
sp|C6E0X3|HIS3_GEOSM Phosphoribosyl-AMP cyclohydrolase OS=Geobacter sp. (strain M21) GN=hisI PE=3 SV=1 198 288 1.0E-08
sp|B5EE14|HIS3_GEOBB Phosphoribosyl-AMP cyclohydrolase OS=Geobacter bemidjiensis (strain Bem / ATCC BAA-1014 / DSM 16622) GN=hisI PE=3 SV=1 198 288 1.0E-08
[Show less]

GO

GO Term Description Terminal node
GO:0016616 oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor Yes
GO:0046872 metal ion binding Yes
GO:0000105 histidine biosynthetic process Yes
GO:0051287 NAD binding Yes
GO:0004635 phosphoribosyl-AMP cyclohydrolase activity Yes
GO:0043167 ion binding No
GO:0043169 cation binding No
GO:0006547 histidine metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0043436 oxoacid metabolic process No
GO:0008652 cellular amino acid biosynthetic process No
GO:1901576 organic substance biosynthetic process No
GO:0006520 cellular amino acid metabolic process No
GO:0003824 catalytic activity No
GO:0046394 carboxylic acid biosynthetic process No
GO:0000166 nucleotide binding No
GO:0003674 molecular_function No
GO:0016814 hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds, in cyclic amidines No
GO:0016787 hydrolase activity No
GO:0005488 binding No
GO:0008150 biological_process No
GO:0006082 organic acid metabolic process No
GO:0019752 carboxylic acid metabolic process No
GO:0016614 oxidoreductase activity, acting on CH-OH group of donors No
GO:1901566 organonitrogen compound biosynthetic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0016491 oxidoreductase activity No
GO:0009058 biosynthetic process No
GO:0044238 primary metabolic process No
GO:0009987 cellular process No
GO:0019238 cyclohydrolase activity No
GO:0036094 small molecule binding No
GO:0016053 organic acid biosynthetic process No
GO:0008152 metabolic process No
GO:0016810 hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds No
GO:0044237 cellular metabolic process No
GO:0044281 small molecule metabolic process No
GO:0071704 organic substance metabolic process No
GO:1901363 heterocyclic compound binding No
GO:0044283 small molecule biosynthetic process No
GO:0044249 cellular biosynthetic process No
GO:1901265 nucleoside phosphate binding No
GO:0097159 organic cyclic compound binding No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup3651
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|760
Ophiocordyceps australis map64 (Brazil) OphauB2|4381 (this protein)
Ophiocordyceps camponoti-floridani Ophcf2|02274
Ophiocordyceps camponoti-rufipedis Ophun1|3177
Ophiocordyceps kimflemingae Ophio5|5105
Ophiocordyceps subramaniannii Hirsu2|7049

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|4381
METDLPLPFLVSVAIPPGLANLEGLTREQVSLLGNPFLEATPQTEDKLVRFFNRHNYEFHAHVDATSLQSPDHVI
GLLDRGARRVFVAPQDLSQYPDYGDRLLPVVSKPDLSAASKHGLLITNVDPQAATGLAEQRQSAKMKNLFFKPAP
GVDAGSFLDFARKCNAIPILPSTSMTADKSDTSRLLLSSVIARYWQSDRQDGLVPTVVTNEAGIALGLAYSSEES
LLEALRTQTGVYQSRKRGLWIKGATSGDTQQLLRLSLDCDNDALKFVVKQKGRFCHLEQFGCFGNLKGIPALEQT
LMSRKQSAPEGSYTARLFSDEKLLRAKLMEEAEELCDAKTPQDVAFEAADVIYFALTKAVSAGVTLADIEANLDA
KSLKVTRRTGDAKRKWADKEGMEPAASASTKPPSLRQADKACSQRIVMQRIDSTKATQAQLLEKLKRPSQKSPEE
ILKIVGPIIEEVRKGGDKALLSYTHKFEKATSLKCPVIKAPFPKELMALDAETIKAIDVSYDNIKTFHSAQKEDK
ALSVETMPGVVCGRFSRPIERVGLYIPGGTAVLPSSALMLGVPAMVAGCKKIVLASPPRPDGSITPEIVYVAQKV
GAESIVLAGGAQAVAAMAYGTESVSKVDKILGPGNQFVTAAKMHVSNDTNAGVSIDMPAGPSEVLVVADARANPA
FVASDLLSQAEHGVDSQVVLIAVGLDETQLRAIEHEVHAQAMALPRVDMVRGAIEHSVTVQVDTVDEAMRISNEY
APEHLILQLDDAPRLVDKVVNAGSVFIGEWTPESVGDYSAGVNHSLPTYGYAKQYSGVNLGSFMKHITCSHLTAD
GLRNVGPAVMQLAKVEQLEAHRRAVEIRIKHMEKQ*
Coding >OphauB2|4381
ATGGAGACGGATCTCCCTCTGCCTTTTCTCGTCAGCGTGGCCATTCCCCCGGGGCTGGCCAACCTCGAAGGATTG
ACTCGCGAACAAGTTTCCCTGCTGGGCAATCCTTTTCTCGAGGCGACGCCGCAGACTGAGGACAAGCTGGTCCGC
TTCTTCAATCGCCACAACTACGAGTTTCACGCCCATGTAGACGCCACAAGCCTGCAGTCACCTGATCATGTAATT
GGCCTCTTGGATCGCGGTGCGCGAAGAGTCTTTGTTGCTCCACAAGACTTGTCGCAGTACCCCGACTATGGCGAC
CGTCTTTTGCCCGTTGTGTCAAAGCCCGACCTTTCTGCCGCCTCCAAGCATGGCCTATTAATCACAAATGTGGAT
CCGCAAGCGGCTACTGGCTTGGCTGAGCAGCGCCAGTCTGCCAAGATGAAGAATCTCTTTTTCAAGCCAGCGCCT
GGTGTTGATGCTGGCAGCTTCCTCGACTTTGCACGCAAATGCAATGCCATTCCAATCCTCCCTTCTACGTCGATG
ACGGCAGACAAGTCGGACACATCAAGGCTGCTGCTGTCGAGCGTCATTGCCAGATACTGGCAGTCGGATCGCCAA
GATGGTCTGGTTCCAACCGTGGTCACTAATGAAGCTGGCATTGCACTAGGTCTCGCCTACTCTAGCGAAGAAAGC
CTTTTGGAGGCTCTGAGGACGCAGACGGGCGTGTATCAAAGTCGGAAGCGAGGCCTCTGGATCAAGGGCGCAACT
TCTGGCGACACACAGCAGCTTCTGCGTCTGTCTCTGGACTGCGACAACGACGCGCTCAAATTTGTTGTCAAGCAA
AAGGGCCGCTTCTGTCACTTGGAACAGTTTGGCTGCTTTGGGAACTTGAAGGGCATCCCAGCCCTGGAGCAGACG
CTCATGTCGAGGAAACAGTCTGCCCCCGAGGGCTCCTATACGGCCAGATTATTTTCAGACGAGAAGCTGCTCAGA
GCCAAGCTTATGGAGGAGGCTGAAGAGCTTTGCGACGCCAAGACGCCCCAGGACGTTGCCTTTGAGGCTGCAGAC
GTGATTTACTTTGCCCTGACCAAGGCAGTCAGCGCTGGAGTAACTCTGGCGGACATTGAAGCCAACCTGGATGCA
AAGAGCCTCAAAGTGACGAGGAGAACAGGCGATGCCAAGAGAAAGTGGGCCGACAAGGAGGGCATGGAGCCTGCC
GCGTCTGCTTCCACCAAGCCGCCGTCCTTGAGGCAGGCCGACAAGGCTTGCAGCCAACGAATTGTGATGCAGCGA
ATCGACTCGACAAAGGCCACACAGGCTCAACTGTTGGAAAAGCTCAAGCGCCCATCACAAAAGTCGCCCGAGGAA
ATCCTCAAGATTGTCGGTCCAATCATTGAAGAGGTGCGCAAGGGCGGCGACAAGGCGCTGCTCTCATATACCCAC
AAGTTTGAAAAGGCGACGAGCTTGAAGTGCCCCGTCATCAAGGCACCCTTTCCCAAGGAGCTCATGGCTCTGGAT
GCCGAAACCATCAAGGCCATTGACGTGTCTTATGACAACATCAAGACGTTTCACTCGGCGCAAAAGGAAGACAAG
GCCTTGTCTGTGGAAACGATGCCGGGCGTTGTGTGCGGGCGCTTCTCGCGACCCATTGAGCGCGTGGGCCTGTAC
ATACCCGGAGGCACCGCCGTGCTGCCCAGCTCGGCCCTGATGCTGGGCGTGCCGGCCATGGTGGCGGGCTGCAAA
AAGATTGTGCTGGCGTCGCCGCCACGCCCCGACGGCAGCATCACGCCCGAGATTGTCTACGTGGCGCAAAAGGTG
GGCGCCGAGAGCATCGTGCTGGCAGGCGGCGCGCAGGCCGTGGCAGCCATGGCCTATGGCACCGAGAGCGTCTCC
AAGGTGGACAAGATTCTCGGCCCGGGCAACCAGTTTGTCACGGCGGCCAAGATGCACGTCAGCAACGACACCAAT
GCCGGCGTCAGCATCGACATGCCCGCCGGCCCGTCCGAGGTGCTGGTTGTGGCTGATGCGCGCGCCAACCCGGCC
TTTGTGGCGTCCGACTTGCTTTCCCAGGCTGAGCACGGCGTCGACAGCCAGGTTGTCCTGATTGCCGTGGGCCTC
GACGAGACGCAGCTGCGCGCCATTGAGCACGAGGTGCACGCCCAGGCCATGGCTCTGCCCCGCGTCGACATGGTT
CGCGGCGCCATTGAGCATTCCGTCACGGTGCAGGTTGACACGGTGGACGAGGCGATGCGCATCAGCAACGAGTAT
GCGCCCGAGCATCTCATTCTTCAGCTCGACGATGCGCCGCGCCTTGTCGACAAGGTTGTCAATGCCGGCAGTGTC
TTTATTGGCGAATGGACGCCCGAGAGCGTTGGCGATTACTCGGCCGGCGTCAATCATTCTCTGCCAACCTATGGC
TACGCCAAGCAATACTCTGGCGTCAACCTCGGCTCCTTTATGAAGCACATTACCTGCTCCCACCTCACCGCCGAC
GGACTGCGAAACGTTGGCCCGGCCGTTATGCAGCTCGCCAAGGTGGAGCAACTAGAGGCGCACCGCAGGGCCGTT
GAGATTCGCATCAAACACATGGAGAAGCAGTGA
Transcript >OphauB2|4381
ATGGAGACGGATCTCCCTCTGCCTTTTCTCGTCAGCGTGGCCATTCCCCCGGGGCTGGCCAACCTCGAAGGATTG
ACTCGCGAACAAGTTTCCCTGCTGGGCAATCCTTTTCTCGAGGCGACGCCGCAGACTGAGGACAAGCTGGTCCGC
TTCTTCAATCGCCACAACTACGAGTTTCACGCCCATGTAGACGCCACAAGCCTGCAGTCACCTGATCATGTAATT
GGCCTCTTGGATCGCGGTGCGCGAAGAGTCTTTGTTGCTCCACAAGACTTGTCGCAGTACCCCGACTATGGCGAC
CGTCTTTTGCCCGTTGTGTCAAAGCCCGACCTTTCTGCCGCCTCCAAGCATGGCCTATTAATCACAAATGTGGAT
CCGCAAGCGGCTACTGGCTTGGCTGAGCAGCGCCAGTCTGCCAAGATGAAGAATCTCTTTTTCAAGCCAGCGCCT
GGTGTTGATGCTGGCAGCTTCCTCGACTTTGCACGCAAATGCAATGCCATTCCAATCCTCCCTTCTACGTCGATG
ACGGCAGACAAGTCGGACACATCAAGGCTGCTGCTGTCGAGCGTCATTGCCAGATACTGGCAGTCGGATCGCCAA
GATGGTCTGGTTCCAACCGTGGTCACTAATGAAGCTGGCATTGCACTAGGTCTCGCCTACTCTAGCGAAGAAAGC
CTTTTGGAGGCTCTGAGGACGCAGACGGGCGTGTATCAAAGTCGGAAGCGAGGCCTCTGGATCAAGGGCGCAACT
TCTGGCGACACACAGCAGCTTCTGCGTCTGTCTCTGGACTGCGACAACGACGCGCTCAAATTTGTTGTCAAGCAA
AAGGGCCGCTTCTGTCACTTGGAACAGTTTGGCTGCTTTGGGAACTTGAAGGGCATCCCAGCCCTGGAGCAGACG
CTCATGTCGAGGAAACAGTCTGCCCCCGAGGGCTCCTATACGGCCAGATTATTTTCAGACGAGAAGCTGCTCAGA
GCCAAGCTTATGGAGGAGGCTGAAGAGCTTTGCGACGCCAAGACGCCCCAGGACGTTGCCTTTGAGGCTGCAGAC
GTGATTTACTTTGCCCTGACCAAGGCAGTCAGCGCTGGAGTAACTCTGGCGGACATTGAAGCCAACCTGGATGCA
AAGAGCCTCAAAGTGACGAGGAGAACAGGCGATGCCAAGAGAAAGTGGGCCGACAAGGAGGGCATGGAGCCTGCC
GCGTCTGCTTCCACCAAGCCGCCGTCCTTGAGGCAGGCCGACAAGGCTTGCAGCCAACGAATTGTGATGCAGCGA
ATCGACTCGACAAAGGCCACACAGGCTCAACTGTTGGAAAAGCTCAAGCGCCCATCACAAAAGTCGCCCGAGGAA
ATCCTCAAGATTGTCGGTCCAATCATTGAAGAGGTGCGCAAGGGCGGCGACAAGGCGCTGCTCTCATATACCCAC
AAGTTTGAAAAGGCGACGAGCTTGAAGTGCCCCGTCATCAAGGCACCCTTTCCCAAGGAGCTCATGGCTCTGGAT
GCCGAAACCATCAAGGCCATTGACGTGTCTTATGACAACATCAAGACGTTTCACTCGGCGCAAAAGGAAGACAAG
GCCTTGTCTGTGGAAACGATGCCGGGCGTTGTGTGCGGGCGCTTCTCGCGACCCATTGAGCGCGTGGGCCTGTAC
ATACCCGGAGGCACCGCCGTGCTGCCCAGCTCGGCCCTGATGCTGGGCGTGCCGGCCATGGTGGCGGGCTGCAAA
AAGATTGTGCTGGCGTCGCCGCCACGCCCCGACGGCAGCATCACGCCCGAGATTGTCTACGTGGCGCAAAAGGTG
GGCGCCGAGAGCATCGTGCTGGCAGGCGGCGCGCAGGCCGTGGCAGCCATGGCCTATGGCACCGAGAGCGTCTCC
AAGGTGGACAAGATTCTCGGCCCGGGCAACCAGTTTGTCACGGCGGCCAAGATGCACGTCAGCAACGACACCAAT
GCCGGCGTCAGCATCGACATGCCCGCCGGCCCGTCCGAGGTGCTGGTTGTGGCTGATGCGCGCGCCAACCCGGCC
TTTGTGGCGTCCGACTTGCTTTCCCAGGCTGAGCACGGCGTCGACAGCCAGGTTGTCCTGATTGCCGTGGGCCTC
GACGAGACGCAGCTGCGCGCCATTGAGCACGAGGTGCACGCCCAGGCCATGGCTCTGCCCCGCGTCGACATGGTT
CGCGGCGCCATTGAGCATTCCGTCACGGTGCAGGTTGACACGGTGGACGAGGCGATGCGCATCAGCAACGAGTAT
GCGCCCGAGCATCTCATTCTTCAGCTCGACGATGCGCCGCGCCTTGTCGACAAGGTTGTCAATGCCGGCAGTGTC
TTTATTGGCGAATGGACGCCCGAGAGCGTTGGCGATTACTCGGCCGGCGTCAATCATTCTCTGCCAACCTATGGC
TACGCCAAGCAATACTCTGGCGTCAACCTCGGCTCCTTTATGAAGCACATTACCTGCTCCCACCTCACCGCCGAC
GGACTGCGAAACGTTGGCCCGGCCGTTATGCAGCTCGCCAAGGTGGAGCAACTAGAGGCGCACCGCAGGGCCGTT
GAGATTCGCATCAAACACATGGAGAAGCAGTGA
Gene >OphauB2|4381
ATGGAGACGGATCTCCCTCTGCCTTTTCTCGTCAGCGTGGCCATTCCCCCGGGGCTGGCCAACCTCGAAGGATTG
ACTCGCGAACAAGTTTCCCTGCTGGGCAATCCTTTTCTCGAGGCGACGCCGCAGACTGAGGACAAGCTGGTCCGC
TTCTTCAATCGCCACAACTACGAGTTTCACGCCCATGTAGACGCCACAAGCCTGCAGTCACCTGATCATGTAATT
GGCCTCTTGGATCGCGGTGCGCGAAGAGTCTTTGTTGCTCCACAAGACTTGTCGCAGTACCCCGACTATGGCGAC
CGTCTTTTGCCCGTTGTGTCAAAGCCCGACCTTTCTGCCGCCTCCAAGCATGGCCTATTAATCACAAATGTGGAT
CCGCAAGCGGCTACTGGCTTGGCTGAGCAGCGCCAGTCTGCCAAGATGAAGAATCTCTTTTTCAAGCCAGCGCCT
GGTGTTGATGCTGGCAGCTTCCTCGACTTTGCACGCAAATGCAATGCCATTCCAATCCTCCCTTCTACGTCGATG
ACGGCAGACAAGTCGGACACATCAAGGCTGCTGCTGTCGAGCGTCATTGCCAGATACTGGCAGTCGGATCGCCAA
GATGGTCTGGTTCCAACCGTGGTCACTAATGAAGCTGGCATTGCACTAGGTCTCGCCTACTCTAGCGAAGAAAGC
CTTTTGGAGGCTCTGAGGACGCAGACGGGCGTGTATCAAAGTCGGAAGCGAGGCCTCTGGATCAAGGGCGCAACT
TCTGGCGACACACAGCAGCTTCTGCGTCTGTCTCTGGACTGCGACAACGACGCGCTCAAATTTGTTGTCAAGCAA
AAGGGCCGCTTCTGTCACTTGGAACAGTTTGGCTGCTTTGGGAACTTGAAGGGCATCCCAGCCCTGGAGCAGACG
CTCATGTCGAGGAAACAGTCTGCCCCCGAGGGCTCCTATACGGCCAGATTATTTTCAGACGAGAAGCTGCTCAGA
GCCAAGCTTATGGAGGAGGCTGAAGAGCTTTGCGACGCCAAGACGCCCCAGGACGTTGCCTTTGAGGCTGCAGAC
GTGATTTACTTTGCCCTGACCAAGGCAGTCAGCGCTGGAGTAACTCTGGCGGACATTGAAGCCAACCTGGATGCA
AAGAGCCTCAAAGTGACGAGGAGAACAGGCGATGCCAAGAGAAAGTGGGCCGACAAGGAGGGCATGGAGCCTGCC
GCGTCTGCTTCCACCAAGCCGCCGTCCTTGAGGCAGGCCGACAAGGCTTGCAGCCAACGAATTGTGATGCAGCGA
ATCGACTCGACAAAGGCCACACAGGCTCAACTGTTGGAAAAGCTCAAGCGCCCATCACAAAAGTCGCCCGAGGAA
ATCCTCAAGATTGTCGGTCCAATCATTGAAGAGGTGCGCAAGGGCGGCGACAAGGCGCTGCTCTCATATACCCAC
AAGTTTGAAAAGGCGACGAGCTTGAAGTGCCCCGTCATCAAGGCACCCTTTCCCAAGGAGCTCATGGCTCTGGAT
GCCGAAACCATCAAGGCCATTGACGTGTCTTATGACAACATCAAGACGTTTCACTCGGCGCAAAAGGAAGACAAG
GCCTTGTCTGTGGAAACGATGCCGGGCGTTGTGTGCGGGCGCTTCTCGCGACCCATTGAGCGCGTGGGCCTGTAC
ATACCCGGAGGCACCGCCGTGCTGCCCAGCTCGGCCCTGATGCTGGGCGTGCCGGCCATGGTGGCGGGCTGCAAA
AAGATTGTGCTGGCGTCGCCGCCACGCCCCGACGGCAGCATCACGCCCGAGATTGTCTACGTGGCGCAAAAGGTG
GGCGCCGAGAGCATCGTGCTGGCAGGCGGCGCGCAGGCCGTGGCAGCCATGGCCTATGGCACCGAGAGCGTCTCC
AAGGTGGACAAGATTCTCGGCCCGGGCAACCAGTTTGTCACGGCGGCCAAGATGCACGTCAGCAACGACACCAAT
GCCGGCGTCAGCATCGACATGCCCGCCGGCCCGTCCGAGGTGCTGGTTGTGGCTGATGCGCGCGCCAACCCGGCC
TTTGTGGCGTCCGACTTGCTTTCCCAGGCTGAGCACGGCGTCGACAGCCAGGTTGTCCTGATTGCCGTGGGCCTC
GACGAGACGCAGCTGCGCGCCATTGAGCACGAGGTGCACGCCCAGGCCATGGCTCTGCCCCGCGTCGACATGGTT
CGCGGCGCCATTGAGCATTCCGTCACGGTGCAGGTTGACACGGTGGACGAGGCGATGCGCATCAGCAACGAGTAT
GCGCCCGAGCATCTCATTCTTCAGCTCGACGATGCGCCGCGCCTTGTCGACAAGGTTGTCAATGCCGGCAGTGTC
TTTATTGGCGAATGGACGCCCGAGAGCGTTGGCGATTACTCGGCCGGCGTCAATCATTCTCTGCGTGAGTATTTT
TTGCTCTTTTTTTTTCTTGTCTGATTGGTGTCCTAACATGTCGTTAGCAACCTATGGCTACGCCAAGCAATACTC
TGGCGTCAACCTCGGCTCCTTTATGAAGCACATTACCTGCTCCCACCTCACCGCCGACGGACTGCGAAACGTTGG
CCCGGCCGTTATGCAGCTCGCCAAGGTGGAGCAACTAGAGGCGCACCGCAGGGCCGTTGAGATTCGCATCAAACA
CATGGAGAAGCAGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail