Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|4380
Gene name
LocationContig_3:9540..12349
Strand+
Gene length (bp)2809
Transcript length (bp)2649
Coding sequence length (bp)2649
Protein length (aa) 883

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08235 LNS2 LNS2 (Lipin/Ned1/Smp2) 5.6E-93 485 707
PF04571 Lipin_N lipin, N-terminal conserved region 9.2E-41 112 211

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9UUJ6|NED1_SCHPO Nuclear elongation and deformation protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ned1 PE=1 SV=1 112 764 3.0E-169
sp|P32567|PAH1_YEAST Phosphatidic acid phosphohydrolase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PAH1 PE=1 SV=1 483 737 2.0E-88
sp|Q9BQK8|LPIN3_HUMAN Phosphatidate phosphatase LPIN3 OS=Homo sapiens GN=LPIN3 PE=1 SV=3 483 731 2.0E-65
sp|Q99PI4|LPIN3_MOUSE Phosphatidate phosphatase LPIN3 OS=Mus musculus GN=Lpin3 PE=1 SV=1 482 738 9.0E-64
sp|Q7TNN8|LPIN3_MUSSP Phosphatidate phosphatase LPIN3 OS=Mus spretus GN=Lpin3 PE=2 SV=1 482 738 1.0E-63
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9UUJ6|NED1_SCHPO Nuclear elongation and deformation protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ned1 PE=1 SV=1 112 764 3.0E-169
sp|P32567|PAH1_YEAST Phosphatidic acid phosphohydrolase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PAH1 PE=1 SV=1 483 737 2.0E-88
sp|Q9BQK8|LPIN3_HUMAN Phosphatidate phosphatase LPIN3 OS=Homo sapiens GN=LPIN3 PE=1 SV=3 483 731 2.0E-65
sp|Q99PI4|LPIN3_MOUSE Phosphatidate phosphatase LPIN3 OS=Mus musculus GN=Lpin3 PE=1 SV=1 482 738 9.0E-64
sp|Q7TNN8|LPIN3_MUSSP Phosphatidate phosphatase LPIN3 OS=Mus spretus GN=Lpin3 PE=2 SV=1 482 738 1.0E-63
sp|Q92539|LPIN2_HUMAN Phosphatidate phosphatase LPIN2 OS=Homo sapiens GN=LPIN2 PE=1 SV=1 421 728 4.0E-61
sp|Q99PI5|LPIN2_MOUSE Phosphatidate phosphatase LPIN2 OS=Mus musculus GN=Lpin2 PE=1 SV=2 479 728 2.0E-60
sp|Q14693|LPIN1_HUMAN Phosphatidate phosphatase LPIN1 OS=Homo sapiens GN=LPIN1 PE=1 SV=2 481 735 2.0E-59
sp|Q91ZP3|LPIN1_MOUSE Phosphatidate phosphatase LPIN1 OS=Mus musculus GN=Lpin1 PE=1 SV=1 483 735 3.0E-59
sp|Q9FMN2|PAH2_ARATH Phosphatidate phosphatase PAH2 OS=Arabidopsis thaliana GN=PAH2 PE=1 SV=1 453 727 3.0E-56
sp|Q9SF47|PAH1_ARATH Phosphatidate phosphatase PAH1 OS=Arabidopsis thaliana GN=PAH1 PE=1 SV=1 490 727 5.0E-55
sp|Q14693|LPIN1_HUMAN Phosphatidate phosphatase LPIN1 OS=Homo sapiens GN=LPIN1 PE=1 SV=2 112 218 2.0E-21
sp|Q91ZP3|LPIN1_MOUSE Phosphatidate phosphatase LPIN1 OS=Mus musculus GN=Lpin1 PE=1 SV=1 112 214 2.0E-21
sp|Q7TNN8|LPIN3_MUSSP Phosphatidate phosphatase LPIN3 OS=Mus spretus GN=Lpin3 PE=2 SV=1 112 212 2.0E-20
sp|Q99PI4|LPIN3_MOUSE Phosphatidate phosphatase LPIN3 OS=Mus musculus GN=Lpin3 PE=1 SV=1 112 212 2.0E-20
sp|Q9BQK8|LPIN3_HUMAN Phosphatidate phosphatase LPIN3 OS=Homo sapiens GN=LPIN3 PE=1 SV=3 112 212 3.0E-20
sp|Q92539|LPIN2_HUMAN Phosphatidate phosphatase LPIN2 OS=Homo sapiens GN=LPIN2 PE=1 SV=1 112 212 4.0E-20
sp|Q99PI5|LPIN2_MOUSE Phosphatidate phosphatase LPIN2 OS=Mus musculus GN=Lpin2 PE=1 SV=2 112 212 1.0E-19
sp|Q9SF47|PAH1_ARATH Phosphatidate phosphatase PAH1 OS=Arabidopsis thaliana GN=PAH1 PE=1 SV=1 134 214 2.0E-10
sp|Q9FMN2|PAH2_ARATH Phosphatidate phosphatase PAH2 OS=Arabidopsis thaliana GN=PAH2 PE=1 SV=1 134 257 4.0E-09
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 24 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|4380
MAGATRPRWLSSPYSRPVPATSAAQVRNEPSTSALAAAAPFPQVPPQYMPRPAAVAATPTSDFSRALIPLPLGFF
TLDTRPACHDPALPNPPVLPSVPRCPPLPRLDDATTMQYVRNLSDSVSTAWNSINPATLSGAIDVIVVERQDGTL
CCSPFHVRFGKFSLLRPYEKKVEFRVNAIKQDYSMKLGEGGEAFFVFETTDSIPESLQTSPLVSPANSPPLQPDP
SAPQLQEPDPLELNSSAPSPRRPPPHVLHAPARSHDSDTLASFSPLSRSASGDWPPATSLRPHSDATLSMQYTRQ
SETSSGPTAVSDRSHSPPPLPHGEAIERAHALSKGLEAANIPSHVTRTGDLMLEMAGFKGSEQDMLRAEVLARKI
LSEALDGDYDIGALFGFDEEGNLWIYSSEEAKQAAMARTIESSLRAHCRPVEADASSDPGYQSDGSDMATGHQVS
THRRSESEDGPTGTMSNPTMSYRANLADATTSYAKTLRLTSDQLKALDLKPGENSMSFTVNRATCCANMYLWKEE
TPVVVSDIDGTITKSDALGHVLNMIGRDWTHSGVAKLYSDIALNGYNIMYLTSRSVGQADTTRAYLKGIVQDRFR
MPPGPTILSPDRTMAALRREIYLRKPHIFKMATLRDISNLYGAGRRPFYAGFGNRLTDQISYRTVHVPRNRIFTI
NSNAEVSLDLLSLNKLKMSYCNINEVVDHYFPPVGTLVPPGGEEFTDFMYWRDEPLDPDEFTASESEGDDAAADE
GSAYSGDEEDDAVDDDGLGDSYISRESLDAVAVDEGMVGSLELAEEEDVSEGSEDEDYDEDDEGRHGSVATNATE
SHFVAEDVSAELITGLKHNLGTGPDTRASAVPEKELGRAGAALKQFHAPRRTSWNSI*
Coding >OphauB2|4380
ATGGCCGGGGCTACCAGGCCAAGGTGGCTGTCCAGCCCGTACTCGCGGCCCGTACCCGCGACCTCTGCCGCCCAG
GTGCGCAACGAGCCCTCTACCTCGGCCTTGGCGGCCGCTGCGCCGTTTCCCCAGGTACCGCCTCAGTACATGCCC
CGCCCTGCCGCCGTTGCTGCTACCCCGACTTCTGACTTCTCTCGTGCCTTGATCCCTCTTCCTCTTGGCTTCTTC
ACCCTCGACACTCGGCCCGCTTGCCATGACCCAGCGCTGCCCAATCCCCCCGTGCTGCCCTCTGTCCCCCGCTGT
CCCCCGCTGCCTCGACTCGACGACGCCACGACGATGCAATACGTTCGCAACCTAAGTGACTCCGTCTCCACCGCC
TGGAACTCCATCAACCCGGCCACCCTCAGCGGCGCTATTGATGTCATTGTTGTTGAGCGTCAGGATGGCACCCTG
TGCTGCTCTCCCTTCCACGTCCGTTTTGGCAAGTTCTCGCTGCTGCGGCCCTACGAGAAAAAGGTGGAGTTTAGA
GTCAATGCCATCAAGCAAGACTACTCCATGAAGCTCGGCGAGGGCGGCGAGGCCTTTTTTGTCTTTGAGACGACG
GATAGTATCCCCGAGTCGTTGCAGACTTCGCCTCTTGTCTCTCCTGCAAACAGCCCGCCCTTGCAGCCCGACCCT
TCTGCTCCCCAGCTTCAGGAGCCGGATCCCTTGGAGCTGAATAGCAGCGCTCCAAGTCCTCGCCGCCCGCCTCCT
CATGTCCTTCATGCCCCGGCCCGCTCTCATGATTCAGACACTCTTGCCTCCTTTTCCCCGCTATCTCGTTCGGCC
TCTGGCGACTGGCCGCCAGCCACCTCGCTCCGACCTCATAGCGATGCCACCCTCTCAATGCAGTACACAAGACAG
TCAGAAACTAGCTCTGGCCCAACAGCCGTCTCGGACAGATCCCACAGTCCCCCTCCTCTACCCCATGGTGAGGCC
ATAGAGCGTGCTCACGCCCTGTCCAAGGGACTCGAGGCTGCCAATATTCCCTCTCATGTTACTCGCACCGGTGAC
CTGATGCTGGAAATGGCCGGCTTCAAAGGCAGCGAACAAGACATGCTGCGAGCCGAGGTGTTGGCCAGAAAAATC
CTGTCCGAGGCTCTCGACGGAGACTACGACATTGGCGCGCTCTTTGGCTTCGATGAAGAGGGCAACTTGTGGATC
TACAGCAGCGAAGAAGCCAAGCAGGCGGCCATGGCTAGGACGATAGAGTCGTCTCTGCGAGCCCACTGTCGCCCC
GTTGAAGCCGATGCAAGTTCGGACCCCGGCTATCAGAGCGATGGAAGTGACATGGCCACTGGGCACCAAGTCTCG
ACGCATCGCCGGTCCGAGTCGGAAGACGGGCCTACGGGCACAATGTCGAATCCCACCATGTCTTACAGAGCAAAT
CTGGCTGACGCAACGACCAGTTATGCTAAAACTCTGCGGCTGACTAGCGATCAGCTCAAGGCCCTGGATCTAAAG
CCGGGAGAAAACTCAATGAGCTTCACCGTGAACCGAGCCACCTGCTGCGCCAACATGTATCTTTGGAAGGAAGAG
ACGCCTGTTGTTGTATCCGACATTGATGGTACAATTACAAAGTCGGATGCTCTTGGCCATGTCCTCAACATGATT
GGCCGAGACTGGACTCACTCGGGTGTCGCCAAGCTGTATAGCGATATTGCCCTCAACGGCTACAACATCATGTAC
CTGACGTCGCGTTCGGTTGGCCAGGCTGACACGACTCGGGCCTACCTCAAGGGCATTGTCCAAGATCGCTTCCGC
ATGCCTCCCGGACCGACTATTCTGTCTCCTGACCGAACCATGGCAGCCCTGCGCCGCGAGATTTACTTGCGCAAG
CCCCACATCTTCAAGATGGCGACTCTTCGCGACATTAGTAACCTCTATGGAGCCGGGAGAAGACCCTTTTATGCA
GGCTTTGGGAATCGTCTGACGGATCAGATTTCCTATAGGACTGTTCACGTGCCACGAAACCGAATCTTCACCATA
AACTCCAATGCTGAGGTTTCCCTTGATCTCCTGAGTCTCAACAAGCTCAAGATGAGCTACTGCAACATTAATGAG
GTTGTTGATCACTACTTTCCGCCTGTTGGAACCTTGGTGCCTCCTGGAGGTGAGGAGTTTACAGACTTTATGTAC
TGGAGGGACGAGCCCTTGGACCCCGACGAATTTACTGCGAGTGAGAGCGAAGGCGACGATGCTGCAGCAGACGAG
GGCAGCGCCTACTCTGGAGACGAGGAAGACGATGCAGTCGATGACGATGGCCTCGGAGACAGCTACATTTCGCGC
GAGTCACTAGACGCAGTTGCTGTGGACGAAGGCATGGTTGGCTCGCTGGAACTGGCGGAAGAGGAGGACGTGTCT
GAGGGGTCAGAGGATGAAGACTATGACGAGGATGACGAGGGCAGGCACGGCTCCGTGGCAACCAATGCCACGGAA
TCGCACTTTGTGGCCGAAGATGTCTCGGCCGAGCTCATCACCGGGTTGAAGCATAATCTGGGCACCGGCCCGGAC
ACTCGGGCATCAGCTGTGCCGGAAAAGGAGTTGGGACGCGCGGGGGCTGCATTGAAGCAATTCCACGCCCCAAGA
CGCACCAGCTGGAATTCTATTTGA
Transcript >OphauB2|4380
ATGGCCGGGGCTACCAGGCCAAGGTGGCTGTCCAGCCCGTACTCGCGGCCCGTACCCGCGACCTCTGCCGCCCAG
GTGCGCAACGAGCCCTCTACCTCGGCCTTGGCGGCCGCTGCGCCGTTTCCCCAGGTACCGCCTCAGTACATGCCC
CGCCCTGCCGCCGTTGCTGCTACCCCGACTTCTGACTTCTCTCGTGCCTTGATCCCTCTTCCTCTTGGCTTCTTC
ACCCTCGACACTCGGCCCGCTTGCCATGACCCAGCGCTGCCCAATCCCCCCGTGCTGCCCTCTGTCCCCCGCTGT
CCCCCGCTGCCTCGACTCGACGACGCCACGACGATGCAATACGTTCGCAACCTAAGTGACTCCGTCTCCACCGCC
TGGAACTCCATCAACCCGGCCACCCTCAGCGGCGCTATTGATGTCATTGTTGTTGAGCGTCAGGATGGCACCCTG
TGCTGCTCTCCCTTCCACGTCCGTTTTGGCAAGTTCTCGCTGCTGCGGCCCTACGAGAAAAAGGTGGAGTTTAGA
GTCAATGCCATCAAGCAAGACTACTCCATGAAGCTCGGCGAGGGCGGCGAGGCCTTTTTTGTCTTTGAGACGACG
GATAGTATCCCCGAGTCGTTGCAGACTTCGCCTCTTGTCTCTCCTGCAAACAGCCCGCCCTTGCAGCCCGACCCT
TCTGCTCCCCAGCTTCAGGAGCCGGATCCCTTGGAGCTGAATAGCAGCGCTCCAAGTCCTCGCCGCCCGCCTCCT
CATGTCCTTCATGCCCCGGCCCGCTCTCATGATTCAGACACTCTTGCCTCCTTTTCCCCGCTATCTCGTTCGGCC
TCTGGCGACTGGCCGCCAGCCACCTCGCTCCGACCTCATAGCGATGCCACCCTCTCAATGCAGTACACAAGACAG
TCAGAAACTAGCTCTGGCCCAACAGCCGTCTCGGACAGATCCCACAGTCCCCCTCCTCTACCCCATGGTGAGGCC
ATAGAGCGTGCTCACGCCCTGTCCAAGGGACTCGAGGCTGCCAATATTCCCTCTCATGTTACTCGCACCGGTGAC
CTGATGCTGGAAATGGCCGGCTTCAAAGGCAGCGAACAAGACATGCTGCGAGCCGAGGTGTTGGCCAGAAAAATC
CTGTCCGAGGCTCTCGACGGAGACTACGACATTGGCGCGCTCTTTGGCTTCGATGAAGAGGGCAACTTGTGGATC
TACAGCAGCGAAGAAGCCAAGCAGGCGGCCATGGCTAGGACGATAGAGTCGTCTCTGCGAGCCCACTGTCGCCCC
GTTGAAGCCGATGCAAGTTCGGACCCCGGCTATCAGAGCGATGGAAGTGACATGGCCACTGGGCACCAAGTCTCG
ACGCATCGCCGGTCCGAGTCGGAAGACGGGCCTACGGGCACAATGTCGAATCCCACCATGTCTTACAGAGCAAAT
CTGGCTGACGCAACGACCAGTTATGCTAAAACTCTGCGGCTGACTAGCGATCAGCTCAAGGCCCTGGATCTAAAG
CCGGGAGAAAACTCAATGAGCTTCACCGTGAACCGAGCCACCTGCTGCGCCAACATGTATCTTTGGAAGGAAGAG
ACGCCTGTTGTTGTATCCGACATTGATGGTACAATTACAAAGTCGGATGCTCTTGGCCATGTCCTCAACATGATT
GGCCGAGACTGGACTCACTCGGGTGTCGCCAAGCTGTATAGCGATATTGCCCTCAACGGCTACAACATCATGTAC
CTGACGTCGCGTTCGGTTGGCCAGGCTGACACGACTCGGGCCTACCTCAAGGGCATTGTCCAAGATCGCTTCCGC
ATGCCTCCCGGACCGACTATTCTGTCTCCTGACCGAACCATGGCAGCCCTGCGCCGCGAGATTTACTTGCGCAAG
CCCCACATCTTCAAGATGGCGACTCTTCGCGACATTAGTAACCTCTATGGAGCCGGGAGAAGACCCTTTTATGCA
GGCTTTGGGAATCGTCTGACGGATCAGATTTCCTATAGGACTGTTCACGTGCCACGAAACCGAATCTTCACCATA
AACTCCAATGCTGAGGTTTCCCTTGATCTCCTGAGTCTCAACAAGCTCAAGATGAGCTACTGCAACATTAATGAG
GTTGTTGATCACTACTTTCCGCCTGTTGGAACCTTGGTGCCTCCTGGAGGTGAGGAGTTTACAGACTTTATGTAC
TGGAGGGACGAGCCCTTGGACCCCGACGAATTTACTGCGAGTGAGAGCGAAGGCGACGATGCTGCAGCAGACGAG
GGCAGCGCCTACTCTGGAGACGAGGAAGACGATGCAGTCGATGACGATGGCCTCGGAGACAGCTACATTTCGCGC
GAGTCACTAGACGCAGTTGCTGTGGACGAAGGCATGGTTGGCTCGCTGGAACTGGCGGAAGAGGAGGACGTGTCT
GAGGGGTCAGAGGATGAAGACTATGACGAGGATGACGAGGGCAGGCACGGCTCCGTGGCAACCAATGCCACGGAA
TCGCACTTTGTGGCCGAAGATGTCTCGGCCGAGCTCATCACCGGGTTGAAGCATAATCTGGGCACCGGCCCGGAC
ACTCGGGCATCAGCTGTGCCGGAAAAGGAGTTGGGACGCGCGGGGGCTGCATTGAAGCAATTCCACGCCCCAAGA
CGCACCAGCTGGAATTCTATTTGA
Gene >OphauB2|4380
ATGGCCGGGGCTACCAGGCCAAGGTGGCTGTCCAGCCCGTACTCGCGGCCCGTACCCGCGACCTCTGCCGCCCAG
GTGCGCAACGAGCCCTCTACCTCGGCCTTGGCGGCCGCTGCGCCGTTTCCCCAGGTACCGCCTCAGTACATGCCC
CGCCCTGCCGCCGTTGCTGCTACGTTCCATGCCGCGCTTACAAGGACCTGCAGACATCATGTGCCTTGTCTTTTT
GAAGCCCGACTTCTGACTTCTCTCGTGCCTTGATCCCTCTTCCTCTTGGCTTCTTCACCCTCGACACTCGGCCCG
CTTGCCATGACCCAGCGCTGCCCAATCCCCCCGTGCTGCCCTCTGTCCCCCGCTGTCCCCCGCTGCCTCGACTCG
ACGACGCCACGACGATGCAATACGTTCGCAACCTAAGTGACTCCGTCTCCACCGCCTGGAACTCCATCAACCCGG
CCACCCTCAGCGGCGCTATTGATGTCATTGTTGTTGAGCGTCAGGATGGCACCCTGTGCTGCTCTCCCTTCCACG
TCCGTTTTGGCAAGTTCTCGCTGCTGCGGCCCTACGAGAAAAAGGTGGAGTTTAGAGTCAATGCCATCAAGCAAG
ACTACTCCATGAAGCTCGGCGAGGGCGGCGAGGCCTTTTTTGTCTTTGAGACGACGGATAGTATCCCCGAGTCGT
TGCAGACTTCGCCTCTTGTCTCTCCTGCAAACAGCCCGCCCTTGCAGCCCGACCCTTCTGCTCCCCAGCTTCAGG
AGCCGGATCCCTTGGAGCTGAATAGCAGCGCTCCAAGTCCTCGCCGCCCGCCTCCTCATGTCCTTCATGCCCCGG
CCCGCTCTCATGATTCAGGTACGCAATTCCCTTCAAACTTGTCCCACTTGTCTGCTAAGCCGCCCCAAAGACACT
CTTGCCTCCTTTTCCCCGCTATCTCGTTCGGCCTCTGGCGACTGGCCGCCAGCCACCTCGCTCCGACCTCATAGC
GATGCCACCCTCTCAATGCAGTACACAAGACAGTCAGAAACTAGCTCTGGCCCAACAGCCGTCTCGGACAGATCC
CACAGTCCCCCTCCTCTACCCCATGGTGAGGCCATAGAGCGTGCTCACGCCCTGTCCAAGGGACTCGAGGCTGCC
AATATTCCCTCTCATGTTACTCGCACCGGTGACCTGATGCTGGAAATGGCCGGCTTCAAAGGCAGCGAACAAGAC
ATGCTGCGAGCCGAGGTGTTGGCCAGAAAAATCCTGTCCGAGGCTCTCGACGGAGACTACGACATTGGCGCGCTC
TTTGGCTTCGATGAAGAGGGCAACTTGTGGATCTACAGCAGCGAAGAAGCCAAGCAGGCGGCCATGGCTAGGACG
ATAGAGTCGTCTCTGCGAGCCCACTGTCGCCCCGTTGAAGCCGATGCAAGTTCGGACCCCGGCTATCAGAGCGAT
GGAAGTGACATGGCCACTGGGCACCAAGTCTCGACGCATCGCCGGTCCGAGTCGGAAGACGGGCCTACGGGCACA
ATGTCGAATCCCACCATGTCTTACAGAGCAAATCTGGCTGACGCAACGACCAGTTATGCTAAAACTCTGCGGCTG
ACTAGCGATCAGCTCAAGGCCCTGGATCTAAAGCCGGGAGAAAACTCAATGAGCTTCACCGTGAACCGAGCCACC
TGCTGCGCCAACATGTATCTTTGGAAGGAAGAGACGCCTGTTGTTGTATCCGACATTGATGGTACAATTACAAAG
TCGGATGCTCTTGGCCATGTCCTCAACATGATTGGCCGAGACTGGACTCACTCGGGTGTCGCCAAGCTGTATAGC
GATATTGCCCTCAACGGCTACAACATCATGTACCTGACGTCGCGTTCGGTTGGCCAGGCTGACACGACTCGGGCC
TACCTCAAGGGCATTGTCCAAGATCGCTTCCGCATGCCTCCCGGACCGACTATTCTGTCTCCTGACCGAACCATG
GCAGCCCTGCGCCGCGAGATTTACTTGCGCAAGCCCCACATCTTCAAGATGGCGACTCTTCGCGACATTAGTAAC
CTCTATGGAGCCGGGAGAAGACCCTTTTATGCAGGCTTTGGGAATCGTCTGACGGATCAGATTTCCTATAGGACT
GTTCACGTGCCACGAAACCGAATCTTCACCATAAACTCCAATGCTGAGGTTTCCCTTGATCTCCTGAGTCTCAAC
AAGCTCAAGATGAGCTACTGCAACATTAATGAGGTTGTTGATCACTACTTTCCGCCTGTTGGAACCTTGGTGCCT
CCTGGAGGTGAGGAGTTTACAGACTTTATGTACTGGAGGGACGAGCCCTTGGACCCCGACGAATTTACTGCGAGT
GAGAGCGAAGGCGACGATGCTGCAGCAGACGAGGGCAGCGCCTACTCTGGAGACGAGGAAGACGATGCAGTCGAT
GACGATGGCCTCGGAGACAGCTACATTTCGCGCGAGTCACTAGACGCAGTTGCTGTGGACGAAGGCATGGTTGGC
TCGCTGGAACTGGCGGAAGAGGAGGACGTGTCTGAGGGGTCAGAGGATGAAGACTATGACGAGGATGACGAGGGC
AGGCACGGCTCCGTGGCAACCAATGCCACGGAATCGCACTTTGTGGCCGAAGATGTCTCGGCCGAGCTCATCACC
GGGGTTGGTCACTTGTCTCTGGGGAGAAATGGTTAAAGAGGGCTAAGAAGAGCAGTTGAAGCATAATCTGGGCAC
CGGCCCGGACACTCGGGCATCAGCTGTGCCGGAAAAGGAGTTGGGACGCGCGGGGGCTGCATTGAAGCAATTCCA
CGCCCCAAGACGCACCAGCTGGAATTCTATTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail