Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|4366
Gene name
LocationContig_294:542..4927
Strand-
Gene length (bp)4385
Transcript length (bp)4158
Coding sequence length (bp)4158
Protein length (aa) 1386

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00443 UCH Ubiquitin carboxyl-terminal hydrolase 3.4E-77 432 1216
PF06337 DUSP DUSP domain 7.1E-08 108 200

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P39538|UBP12_YEAST Ubiquitin carboxyl-terminal hydrolase 12 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=UBP12 PE=1 SV=1 424 701 5.0E-70
sp|O60079|UBP12_SCHPO Probable ubiquitin carboxyl-terminal hydrolase 12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ubp12 PE=1 SV=1 430 894 8.0E-67
sp|Q9USM5|UBP1_SCHPO Probable ubiquitin carboxyl-terminal hydrolase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ubp1 PE=3 SV=1 375 704 7.0E-64
sp|B2GUZ1|UBP4_RAT Ubiquitin carboxyl-terminal hydrolase 4 OS=Rattus norvegicus GN=Usp4 PE=1 SV=1 430 707 3.0E-62
sp|P35123|UBP4_MOUSE Ubiquitin carboxyl-terminal hydrolase 4 OS=Mus musculus GN=Usp4 PE=1 SV=3 430 701 9.0E-62
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P39538|UBP12_YEAST Ubiquitin carboxyl-terminal hydrolase 12 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=UBP12 PE=1 SV=1 424 701 5.0E-70
sp|O60079|UBP12_SCHPO Probable ubiquitin carboxyl-terminal hydrolase 12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ubp12 PE=1 SV=1 430 894 8.0E-67
sp|Q9USM5|UBP1_SCHPO Probable ubiquitin carboxyl-terminal hydrolase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ubp1 PE=3 SV=1 375 704 7.0E-64
sp|B2GUZ1|UBP4_RAT Ubiquitin carboxyl-terminal hydrolase 4 OS=Rattus norvegicus GN=Usp4 PE=1 SV=1 430 707 3.0E-62
sp|P35123|UBP4_MOUSE Ubiquitin carboxyl-terminal hydrolase 4 OS=Mus musculus GN=Usp4 PE=1 SV=3 430 701 9.0E-62
sp|Q13107|UBP4_HUMAN Ubiquitin carboxyl-terminal hydrolase 4 OS=Homo sapiens GN=USP4 PE=1 SV=3 430 701 5.0E-61
sp|Q5RCD3|UBP4_PONAB Ubiquitin carboxyl-terminal hydrolase 4 OS=Pongo abelii GN=USP4 PE=2 SV=1 430 701 1.0E-60
sp|A6QR55|UBP4_BOVIN Ubiquitin carboxyl-terminal hydrolase 4 OS=Bos taurus GN=USP4 PE=2 SV=1 430 701 2.0E-60
sp|F6Z5C0|UBP15_XENTR Ubiquitin carboxyl-terminal hydrolase 15 OS=Xenopus tropicalis GN=usp15 PE=2 SV=2 330 700 4.0E-60
sp|Q9R085|UBP15_RAT Ubiquitin carboxyl-terminal hydrolase 15 OS=Rattus norvegicus GN=Usp15 PE=1 SV=1 424 702 1.0E-59
sp|Q8R5H1|UBP15_MOUSE Ubiquitin carboxyl-terminal hydrolase 15 OS=Mus musculus GN=Usp15 PE=1 SV=1 424 702 2.0E-59
sp|Q9Y4E8|UBP15_HUMAN Ubiquitin carboxyl-terminal hydrolase 15 OS=Homo sapiens GN=USP15 PE=1 SV=3 424 702 2.0E-59
sp|Q2HJE4|UBP15_BOVIN Ubiquitin carboxyl-terminal hydrolase 15 OS=Bos taurus GN=USP15 PE=2 SV=1 424 702 2.0E-59
sp|P51784|UBP11_HUMAN Ubiquitin carboxyl-terminal hydrolase 11 OS=Homo sapiens GN=USP11 PE=1 SV=3 430 701 1.0E-58
sp|Q93Y01|UBP9_ARATH Ubiquitin carboxyl-terminal hydrolase 9 OS=Arabidopsis thaliana GN=UBP9 PE=2 SV=1 426 712 2.0E-56
sp|Q9MAQ3|UBP11_ARATH Putative ubiquitin carboxyl-terminal hydrolase 11 OS=Arabidopsis thaliana GN=UBP11 PE=3 SV=2 418 683 9.0E-56
sp|Q9ZSB5|UBP10_ARATH Ubiquitin carboxyl-terminal hydrolase 10 OS=Arabidopsis thaliana GN=UBP10 PE=2 SV=2 426 705 3.0E-55
sp|Q99K46|UBP11_MOUSE Ubiquitin carboxyl-terminal hydrolase 11 OS=Mus musculus GN=Usp11 PE=1 SV=4 430 701 4.0E-55
sp|P35125|UBP6_HUMAN Ubiquitin carboxyl-terminal hydrolase 6 OS=Homo sapiens GN=USP6 PE=1 SV=2 418 671 5.0E-52
sp|Q9C585|UBP8_ARATH Ubiquitin carboxyl-terminal hydrolase 8 OS=Arabidopsis thaliana GN=UBP8 PE=2 SV=2 430 709 8.0E-52
sp|Q8NFA0|UBP32_HUMAN Ubiquitin carboxyl-terminal hydrolase 32 OS=Homo sapiens GN=USP32 PE=1 SV=1 418 671 1.0E-51
sp|O22207|UBP5_ARATH Ubiquitin carboxyl-terminal hydrolase 5 OS=Arabidopsis thaliana GN=UBP5 PE=1 SV=2 426 707 2.0E-51
sp|Q6J1Y9|UBP19_RAT Ubiquitin carboxyl-terminal hydrolase 19 OS=Rattus norvegicus GN=Usp19 PE=1 SV=1 430 701 1.0E-47
sp|Q3UJD6|UBP19_MOUSE Ubiquitin carboxyl-terminal hydrolase 19 OS=Mus musculus GN=Usp19 PE=1 SV=1 430 701 2.0E-47
sp|O94966|UBP19_HUMAN Ubiquitin carboxyl-terminal hydrolase 19 OS=Homo sapiens GN=USP19 PE=1 SV=2 430 701 1.0E-46
sp|P35123|UBP4_MOUSE Ubiquitin carboxyl-terminal hydrolase 4 OS=Mus musculus GN=Usp4 PE=1 SV=3 1044 1219 4.0E-45
sp|B2GUZ1|UBP4_RAT Ubiquitin carboxyl-terminal hydrolase 4 OS=Rattus norvegicus GN=Usp4 PE=1 SV=1 1051 1219 8.0E-45
sp|P39538|UBP12_YEAST Ubiquitin carboxyl-terminal hydrolase 12 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=UBP12 PE=1 SV=1 1008 1235 1.0E-44
sp|O60079|UBP12_SCHPO Probable ubiquitin carboxyl-terminal hydrolase 12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ubp12 PE=1 SV=1 990 1221 3.0E-44
sp|A6QR55|UBP4_BOVIN Ubiquitin carboxyl-terminal hydrolase 4 OS=Bos taurus GN=USP4 PE=2 SV=1 1001 1219 8.0E-44
sp|Q13107|UBP4_HUMAN Ubiquitin carboxyl-terminal hydrolase 4 OS=Homo sapiens GN=USP4 PE=1 SV=3 1052 1219 1.0E-43
sp|Q5RCD3|UBP4_PONAB Ubiquitin carboxyl-terminal hydrolase 4 OS=Pongo abelii GN=USP4 PE=2 SV=1 1052 1219 2.0E-42
sp|O22207|UBP5_ARATH Ubiquitin carboxyl-terminal hydrolase 5 OS=Arabidopsis thaliana GN=UBP5 PE=1 SV=2 1066 1220 4.0E-42
sp|Q9C585|UBP8_ARATH Ubiquitin carboxyl-terminal hydrolase 8 OS=Arabidopsis thaliana GN=UBP8 PE=2 SV=2 1065 1218 1.0E-41
sp|Q9ZSB5|UBP10_ARATH Ubiquitin carboxyl-terminal hydrolase 10 OS=Arabidopsis thaliana GN=UBP10 PE=2 SV=2 1064 1221 4.0E-41
sp|Q9MAQ3|UBP11_ARATH Putative ubiquitin carboxyl-terminal hydrolase 11 OS=Arabidopsis thaliana GN=UBP11 PE=3 SV=2 1069 1221 2.0E-40
sp|Q93Y01|UBP9_ARATH Ubiquitin carboxyl-terminal hydrolase 9 OS=Arabidopsis thaliana GN=UBP9 PE=2 SV=1 1064 1221 4.0E-40
sp|F6Z5C0|UBP15_XENTR Ubiquitin carboxyl-terminal hydrolase 15 OS=Xenopus tropicalis GN=usp15 PE=2 SV=2 1065 1221 5.0E-39
sp|Q9R085|UBP15_RAT Ubiquitin carboxyl-terminal hydrolase 15 OS=Rattus norvegicus GN=Usp15 PE=1 SV=1 1070 1221 4.0E-38
sp|Q9Y4E8|UBP15_HUMAN Ubiquitin carboxyl-terminal hydrolase 15 OS=Homo sapiens GN=USP15 PE=1 SV=3 1070 1221 4.0E-38
sp|P51784|UBP11_HUMAN Ubiquitin carboxyl-terminal hydrolase 11 OS=Homo sapiens GN=USP11 PE=1 SV=3 1066 1219 4.0E-38
sp|Q8R5H1|UBP15_MOUSE Ubiquitin carboxyl-terminal hydrolase 15 OS=Mus musculus GN=Usp15 PE=1 SV=1 1070 1221 5.0E-38
sp|Q2HJE4|UBP15_BOVIN Ubiquitin carboxyl-terminal hydrolase 15 OS=Bos taurus GN=USP15 PE=2 SV=1 1070 1221 6.0E-38
sp|P40818|UBP8_HUMAN Ubiquitin carboxyl-terminal hydrolase 8 OS=Homo sapiens GN=USP8 PE=1 SV=1 426 617 8.0E-37
sp|Q6J1Y9|UBP19_RAT Ubiquitin carboxyl-terminal hydrolase 19 OS=Rattus norvegicus GN=Usp19 PE=1 SV=1 1063 1221 1.0E-36
sp|Q3UJD6|UBP19_MOUSE Ubiquitin carboxyl-terminal hydrolase 19 OS=Mus musculus GN=Usp19 PE=1 SV=1 1063 1221 2.0E-36
sp|O94966|UBP19_HUMAN Ubiquitin carboxyl-terminal hydrolase 19 OS=Homo sapiens GN=USP19 PE=1 SV=2 1063 1221 2.0E-36
sp|Q70CQ4|UBP31_HUMAN Ubiquitin carboxyl-terminal hydrolase 31 OS=Homo sapiens GN=USP31 PE=2 SV=2 1006 1223 5.0E-36
sp|Q99K46|UBP11_MOUSE Ubiquitin carboxyl-terminal hydrolase 11 OS=Mus musculus GN=Usp11 PE=1 SV=4 1066 1222 1.0E-35
sp|O57429|UBP2_CHICK Ubiquitin carboxyl-terminal hydrolase 2 OS=Gallus gallus GN=USP2 PE=2 SV=1 430 618 2.0E-35
sp|Q80U87|UBP8_MOUSE Ubiquitin carboxyl-terminal hydrolase 8 OS=Mus musculus GN=Usp8 PE=1 SV=2 426 617 2.0E-35
sp|Q8BUM9|UBP43_MOUSE Ubiquitin carboxyl-terminal hydrolase 43 OS=Mus musculus GN=Usp43 PE=1 SV=2 1005 1223 4.0E-35
sp|Q01988|UBP11_CANLF Ubiquitin carboxyl-terminal hydrolase 11 (Fragment) OS=Canis lupus familiaris GN=USP11 PE=2 SV=1 1066 1219 6.0E-35
sp|Q70EL4|UBP43_HUMAN Ubiquitin carboxyl-terminal hydrolase 43 OS=Homo sapiens GN=USP43 PE=1 SV=2 1071 1223 1.0E-33
sp|P32571|UBP4_YEAST Ubiquitin carboxyl-terminal hydrolase 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DOA4 PE=1 SV=2 431 622 2.0E-33
sp|A6ZY34|UBP4_YEAS7 Ubiquitin carboxyl-terminal hydrolase 4 OS=Saccharomyces cerevisiae (strain YJM789) GN=DOA4 PE=3 SV=1 431 622 2.0E-33
sp|B3LGK1|UBP4_YEAS1 Ubiquitin carboxyl-terminal hydrolase 4 OS=Saccharomyces cerevisiae (strain RM11-1a) GN=DOA4 PE=3 SV=1 431 622 9.0E-33
sp|Q5U349|UBP2_RAT Ubiquitin carboxyl-terminal hydrolase 2 OS=Rattus norvegicus GN=Usp2 PE=1 SV=1 430 617 9.0E-33
sp|O88623|UBP2_MOUSE Ubiquitin carboxyl-terminal hydrolase 2 OS=Mus musculus GN=Usp2 PE=1 SV=2 430 617 1.0E-32
sp|Q2KHV7|UBP2_BOVIN Ubiquitin carboxyl-terminal hydrolase 2 OS=Bos taurus GN=USP2 PE=2 SV=1 430 617 3.0E-32
sp|P40818|UBP8_HUMAN Ubiquitin carboxyl-terminal hydrolase 8 OS=Homo sapiens GN=USP8 PE=1 SV=1 1010 1232 4.0E-32
sp|Q80U87|UBP8_MOUSE Ubiquitin carboxyl-terminal hydrolase 8 OS=Mus musculus GN=Usp8 PE=1 SV=2 1010 1232 5.0E-32
sp|O75604|UBP2_HUMAN Ubiquitin carboxyl-terminal hydrolase 2 OS=Homo sapiens GN=USP2 PE=1 SV=2 424 617 1.0E-31
sp|Q9HFS7|UBP4_KLULA Ubiquitin carboxyl-terminal hydrolase 4 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=DOA4 PE=3 SV=1 431 618 1.0E-31
sp|Q754R5|UBP4_ASHGO Ubiquitin carboxyl-terminal hydrolase 4 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=DOA4 PE=3 SV=2 397 622 1.0E-30
sp|A7TGY3|UBP4_VANPO Ubiquitin carboxyl-terminal hydrolase 4 OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=DOA4 PE=3 SV=1 431 618 1.0E-30
sp|O57429|UBP2_CHICK Ubiquitin carboxyl-terminal hydrolase 2 OS=Gallus gallus GN=USP2 PE=2 SV=1 1070 1216 8.0E-30
sp|Q6FQF0|UBP4_CANGA Ubiquitin carboxyl-terminal hydrolase 4 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=DOA4 PE=3 SV=1 429 619 2.0E-28
sp|Q70CQ4|UBP31_HUMAN Ubiquitin carboxyl-terminal hydrolase 31 OS=Homo sapiens GN=USP31 PE=2 SV=2 430 695 6.0E-28
sp|O60139|UBP4_SCHPO Probable ubiquitin carboxyl-terminal hydrolase 4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ubp4 PE=1 SV=2 427 617 1.0E-27
sp|P39944|UBP5_YEAST Ubiquitin carboxyl-terminal hydrolase 5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=UBP5 PE=1 SV=1 432 618 1.0E-27
sp|Q9UK80|UBP21_HUMAN Ubiquitin carboxyl-terminal hydrolase 21 OS=Homo sapiens GN=USP21 PE=1 SV=1 429 629 1.0E-27
sp|Q2KJ72|UBP21_BOVIN Ubiquitin carboxyl-terminal hydrolase 21 OS=Bos taurus GN=USP21 PE=2 SV=1 429 629 3.0E-27
sp|B2GUX4|UBP21_RAT Ubiquitin carboxyl-terminal hydrolase 21 OS=Rattus norvegicus GN=Usp21 PE=2 SV=1 428 629 5.0E-27
sp|Q9USM5|UBP1_SCHPO Probable ubiquitin carboxyl-terminal hydrolase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ubp1 PE=3 SV=1 1070 1220 6.0E-27
sp|Q9QZL6|UBP21_MOUSE Ubiquitin carboxyl-terminal hydrolase 21 OS=Mus musculus GN=Usp21 PE=1 SV=1 428 629 7.0E-27
sp|A5PN09|UBP20_DANRE Ubiquitin carboxyl-terminal hydrolase 20 OS=Danio rerio GN=usp20 PE=3 SV=1 1070 1220 1.0E-26
sp|A7Z056|UBP20_BOVIN Ubiquitin carboxyl-terminal hydrolase 20 OS=Bos taurus GN=USP20 PE=2 SV=1 1070 1220 4.0E-26
sp|Q5R5Z6|UBP20_PONAB Ubiquitin carboxyl-terminal hydrolase 20 OS=Pongo abelii GN=USP20 PE=2 SV=1 1070 1220 9.0E-26
sp|Q9Y2K6|UBP20_HUMAN Ubiquitin carboxyl-terminal hydrolase 20 OS=Homo sapiens GN=USP20 PE=1 SV=2 1070 1220 1.0E-25
sp|Q9Y6I4|UBP3_HUMAN Ubiquitin carboxyl-terminal hydrolase 3 OS=Homo sapiens GN=USP3 PE=1 SV=2 1058 1216 2.0E-25
sp|Q8C6M1|UBP20_MOUSE Ubiquitin carboxyl-terminal hydrolase 20 OS=Mus musculus GN=Usp20 PE=1 SV=1 1070 1220 3.0E-25
sp|O88623|UBP2_MOUSE Ubiquitin carboxyl-terminal hydrolase 2 OS=Mus musculus GN=Usp2 PE=1 SV=2 1070 1216 4.0E-25
sp|Q5U349|UBP2_RAT Ubiquitin carboxyl-terminal hydrolase 2 OS=Rattus norvegicus GN=Usp2 PE=1 SV=1 1070 1216 7.0E-25
sp|Q6P8X6|UBP50_MOUSE Putative ubiquitin carboxyl-terminal hydrolase 50 OS=Mus musculus GN=Usp50 PE=2 SV=1 1071 1216 8.0E-25
sp|A0JM59|UBP20_XENTR Ubiquitin carboxyl-terminal hydrolase 20 OS=Xenopus tropicalis GN=usp20 PE=2 SV=1 1070 1220 1.0E-24
sp|O75604|UBP2_HUMAN Ubiquitin carboxyl-terminal hydrolase 2 OS=Homo sapiens GN=USP2 PE=1 SV=2 1070 1216 2.0E-24
sp|B1WBD7|UBP20_XENLA Ubiquitin carboxyl-terminal hydrolase 20 OS=Xenopus laevis GN=usp20 PE=2 SV=1 1070 1220 2.0E-24
sp|Q8R5K2|UBP33_MOUSE Ubiquitin carboxyl-terminal hydrolase 33 OS=Mus musculus GN=Usp33 PE=1 SV=2 1070 1220 2.0E-24
sp|Q5REG5|UBP33_PONAB Ubiquitin carboxyl-terminal hydrolase 33 OS=Pongo abelii GN=USP33 PE=2 SV=1 1070 1220 2.0E-24
sp|Q28CN3|UBP33_XENTR Ubiquitin carboxyl-terminal hydrolase 33 OS=Xenopus tropicalis GN=usp33 PE=2 SV=2 1070 1220 2.0E-24
sp|Q5UQR3|UBPL1_MIMIV Probable ubiquitin carboxyl-terminal hydrolase R319 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R319 PE=3 SV=1 1070 1218 3.0E-24
sp|Q70EL4|UBP43_HUMAN Ubiquitin carboxyl-terminal hydrolase 43 OS=Homo sapiens GN=USP43 PE=1 SV=2 430 707 5.0E-24
sp|A6QNM7|UBP33_BOVIN Ubiquitin carboxyl-terminal hydrolase 33 OS=Bos taurus GN=USP33 PE=2 SV=1 1070 1220 5.0E-24
sp|Q8TEY7|UBP33_HUMAN Ubiquitin carboxyl-terminal hydrolase 33 OS=Homo sapiens GN=USP33 PE=1 SV=2 1070 1220 7.0E-24
sp|Q91W36|UBP3_MOUSE Ubiquitin carboxyl-terminal hydrolase 3 OS=Mus musculus GN=Usp3 PE=2 SV=1 1058 1221 7.0E-24
sp|Q4R6D3|UBP50_MACFA Putative ubiquitin carboxyl-terminal hydrolase 50 OS=Macaca fascicularis GN=USP50 PE=2 SV=1 428 620 5.0E-23
sp|Q4R6D3|UBP50_MACFA Putative ubiquitin carboxyl-terminal hydrolase 50 OS=Macaca fascicularis GN=USP50 PE=2 SV=1 1071 1216 6.0E-23
sp|Q8BUM9|UBP43_MOUSE Ubiquitin carboxyl-terminal hydrolase 43 OS=Mus musculus GN=Usp43 PE=1 SV=2 430 733 8.0E-23
sp|A5PMR2|UBP33_DANRE Ubiquitin carboxyl-terminal hydrolase 33 OS=Danio rerio GN=usp33 PE=2 SV=1 1070 1218 2.0E-22
sp|Q6P8X6|UBP50_MOUSE Putative ubiquitin carboxyl-terminal hydrolase 50 OS=Mus musculus GN=Usp50 PE=2 SV=1 430 620 4.0E-22
sp|Q2KHV7|UBP2_BOVIN Ubiquitin carboxyl-terminal hydrolase 2 OS=Bos taurus GN=USP2 PE=2 SV=1 1070 1216 7.0E-22
sp|Q9HFS7|UBP4_KLULA Ubiquitin carboxyl-terminal hydrolase 4 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=DOA4 PE=3 SV=1 1066 1218 8.0E-21
sp|A7TGY3|UBP4_VANPO Ubiquitin carboxyl-terminal hydrolase 4 OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=DOA4 PE=3 SV=1 1074 1218 1.0E-20
sp|A6ZY34|UBP4_YEAS7 Ubiquitin carboxyl-terminal hydrolase 4 OS=Saccharomyces cerevisiae (strain YJM789) GN=DOA4 PE=3 SV=1 1061 1218 4.0E-20
sp|P32571|UBP4_YEAST Ubiquitin carboxyl-terminal hydrolase 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DOA4 PE=1 SV=2 1061 1218 1.0E-19
sp|B3LGK1|UBP4_YEAS1 Ubiquitin carboxyl-terminal hydrolase 4 OS=Saccharomyces cerevisiae (strain RM11-1a) GN=DOA4 PE=3 SV=1 1061 1218 1.0E-19
sp|P50102|UBP8_YEAST Ubiquitin carboxyl-terminal hydrolase 8 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=UBP8 PE=1 SV=1 1020 1219 4.0E-19
sp|Q67XW5|UBP18_ARATH Ubiquitin carboxyl-terminal hydrolase 18 OS=Arabidopsis thaliana GN=UBP18 PE=2 SV=2 1071 1218 1.0E-18
sp|Q9UK80|UBP21_HUMAN Ubiquitin carboxyl-terminal hydrolase 21 OS=Homo sapiens GN=USP21 PE=1 SV=1 1048 1217 2.0E-18
sp|Q2KJ72|UBP21_BOVIN Ubiquitin carboxyl-terminal hydrolase 21 OS=Bos taurus GN=USP21 PE=2 SV=1 1048 1217 2.0E-18
sp|Q754R5|UBP4_ASHGO Ubiquitin carboxyl-terminal hydrolase 4 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=DOA4 PE=3 SV=2 1067 1218 3.0E-18
sp|Q6FQF0|UBP4_CANGA Ubiquitin carboxyl-terminal hydrolase 4 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=DOA4 PE=3 SV=1 1066 1221 3.0E-18
sp|B2GUX4|UBP21_RAT Ubiquitin carboxyl-terminal hydrolase 21 OS=Rattus norvegicus GN=Usp21 PE=2 SV=1 1048 1217 3.0E-18
sp|Q9QZL6|UBP21_MOUSE Ubiquitin carboxyl-terminal hydrolase 21 OS=Mus musculus GN=Usp21 PE=1 SV=1 1048 1217 3.0E-18
sp|P40453|UBP7_YEAST Ubiquitin carboxyl-terminal hydrolase 7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=UBP7 PE=1 SV=1 433 618 4.0E-18
sp|Q9FPT5|UBP1_ARATH Ubiquitin carboxyl-terminal hydrolase 1 OS=Arabidopsis thaliana GN=UBP1 PE=1 SV=2 433 619 3.0E-17
sp|Q9VVR1|NOT_DROME Ubiquitin carboxyl-terminal hydrolase nonstop OS=Drosophila melanogaster GN=not PE=1 SV=3 1071 1218 4.0E-17
sp|Q9SJA1|UBP19_ARATH Ubiquitin carboxyl-terminal hydrolase 19 OS=Arabidopsis thaliana GN=UBP19 PE=2 SV=2 1069 1218 7.0E-17
sp|P39944|UBP5_YEAST Ubiquitin carboxyl-terminal hydrolase 5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=UBP5 PE=1 SV=1 1066 1218 1.0E-16
sp|Q70EL3|UBP50_HUMAN Inactive ubiquitin carboxyl-terminal hydrolase 50 OS=Homo sapiens GN=USP50 PE=2 SV=1 430 619 1.0E-16
sp|Q9FKP5|UBP17_ARATH Ubiquitin carboxyl-terminal hydrolase 17 OS=Arabidopsis thaliana GN=UBP17 PE=2 SV=1 1071 1224 1.0E-16
sp|A6NNY8|UBP27_HUMAN Ubiquitin carboxyl-terminal hydrolase 27 OS=Homo sapiens GN=USP27X PE=2 SV=3 1071 1219 1.0E-16
sp|Q9SB51|UBP16_ARATH Ubiquitin carboxyl-terminal hydrolase 16 OS=Arabidopsis thaliana GN=UBP16 PE=1 SV=1 1071 1223 2.0E-16
sp|Q70EK9|UBP51_HUMAN Ubiquitin carboxyl-terminal hydrolase 51 OS=Homo sapiens GN=USP51 PE=2 SV=1 1071 1219 2.0E-16
sp|Q6PAW2|UBP16_XENLA Ubiquitin carboxyl-terminal hydrolase 16 OS=Xenopus laevis GN=usp16 PE=2 SV=1 433 620 3.0E-16
sp|Q8CEG8|UBP27_MOUSE Ubiquitin carboxyl-terminal hydrolase 27 OS=Mus musculus GN=Usp27 PE=2 SV=2 1071 1223 3.0E-16
sp|Q9P275|UBP36_HUMAN Ubiquitin carboxyl-terminal hydrolase 36 OS=Homo sapiens GN=USP36 PE=1 SV=3 1076 1218 8.0E-16
sp|P0C8Z3|UBP22_BOVIN Ubiquitin carboxyl-terminal hydrolase 22 OS=Bos taurus GN=USP22 PE=2 SV=1 1071 1219 2.0E-15
sp|O74442|UBP16_SCHPO Probable ubiquitin carboxyl-terminal hydrolase 16 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ubp16 PE=1 SV=1 1067 1221 2.0E-15
sp|B1AQJ2|UBP36_MOUSE Ubiquitin carboxyl-terminal hydrolase 36 OS=Mus musculus GN=Usp36 PE=1 SV=1 1076 1218 2.0E-15
sp|Q5DU02|UBP22_MOUSE Ubiquitin carboxyl-terminal hydrolase 22 OS=Mus musculus GN=Usp22 PE=2 SV=2 1071 1219 4.0E-15
sp|Q9UPT9|UBP22_HUMAN Ubiquitin carboxyl-terminal hydrolase 22 OS=Homo sapiens GN=USP22 PE=1 SV=2 1071 1219 5.0E-15
sp|Q9FPS4|UBP23_ARATH Ubiquitin carboxyl-terminal hydrolase 23 OS=Arabidopsis thaliana GN=UBP23 PE=2 SV=2 1067 1218 5.0E-15
sp|A6H8I0|UBP22_DANRE Ubiquitin carboxyl-terminal hydrolase 22 OS=Danio rerio GN=usp22 PE=2 SV=1 1063 1219 5.0E-15
sp|Q9FPS9|UBP15_ARATH Ubiquitin carboxyl-terminal hydrolase 15 OS=Arabidopsis thaliana GN=UBP15 PE=2 SV=2 1071 1226 6.0E-15
sp|Q6GNI6|UB22A_XENLA Ubiquitin carboxyl-terminal hydrolase 22-A OS=Xenopus laevis GN=usp22-a PE=2 SV=1 1071 1219 6.0E-15
sp|O60139|UBP4_SCHPO Probable ubiquitin carboxyl-terminal hydrolase 4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ubp4 PE=1 SV=2 1067 1220 1.0E-14
sp|A5PMR2|UBP33_DANRE Ubiquitin carboxyl-terminal hydrolase 33 OS=Danio rerio GN=usp33 PE=2 SV=1 430 562 2.0E-14
sp|Q6DCJ1|UB22B_XENLA Ubiquitin carboxyl-terminal hydrolase 22-B OS=Xenopus laevis GN=usp22-b PE=2 SV=2 1071 1219 2.0E-14
sp|E1B9W9|UBP42_BOVIN Ubiquitin carboxyl-terminal hydrolase 42 OS=Bos taurus GN=USP42 PE=3 SV=1 1071 1218 2.0E-14
sp|D3ZU96|UBP42_RAT Ubiquitin carboxyl-terminal hydrolase 42 OS=Rattus norvegicus GN=Usp42 PE=1 SV=1 1071 1226 2.0E-14
sp|Q6P9L4|UBP49_MOUSE Ubiquitin carboxyl-terminal hydrolase 49 OS=Mus musculus GN=Usp49 PE=2 SV=1 1072 1220 2.0E-14
sp|Q9H9J4|UBP42_HUMAN Ubiquitin carboxyl-terminal hydrolase 42 OS=Homo sapiens GN=USP42 PE=1 SV=3 1071 1218 2.0E-14
sp|Q9WTV6|UBP18_MOUSE Ubl carboxyl-terminal hydrolase 18 OS=Mus musculus GN=Usp18 PE=1 SV=2 1071 1221 2.0E-14
sp|Q91W36|UBP3_MOUSE Ubiquitin carboxyl-terminal hydrolase 3 OS=Mus musculus GN=Usp3 PE=2 SV=1 431 619 4.0E-14
sp|Q70EL3|UBP50_HUMAN Inactive ubiquitin carboxyl-terminal hydrolase 50 OS=Homo sapiens GN=USP50 PE=2 SV=1 1071 1183 4.0E-14
sp|Q9Y6I4|UBP3_HUMAN Ubiquitin carboxyl-terminal hydrolase 3 OS=Homo sapiens GN=USP3 PE=1 SV=2 431 619 5.0E-14
sp|B2RQC2|UBP42_MOUSE Ubiquitin carboxyl-terminal hydrolase 42 OS=Mus musculus GN=Usp42 PE=1 SV=1 1071 1226 5.0E-14
sp|Q99LG0|UBP16_MOUSE Ubiquitin carboxyl-terminal hydrolase 16 OS=Mus musculus GN=Usp16 PE=1 SV=2 1062 1218 5.0E-14
sp|Q70CQ1|UBP49_HUMAN Ubiquitin carboxyl-terminal hydrolase 49 OS=Homo sapiens GN=USP49 PE=1 SV=1 1072 1220 5.0E-14
sp|Q8K387|UBP45_MOUSE Ubiquitin carboxyl-terminal hydrolase 45 OS=Mus musculus GN=Usp45 PE=1 SV=1 1067 1218 5.0E-14
sp|Q8W4N3|UBP2_ARATH Ubiquitin carboxyl-terminal hydrolase 2 OS=Arabidopsis thaliana GN=UBP2 PE=1 SV=2 433 615 5.0E-14
sp|Q99LG0|UBP16_MOUSE Ubiquitin carboxyl-terminal hydrolase 16 OS=Mus musculus GN=Usp16 PE=1 SV=2 433 639 6.0E-14
sp|Q5REG5|UBP33_PONAB Ubiquitin carboxyl-terminal hydrolase 33 OS=Pongo abelii GN=USP33 PE=2 SV=1 430 539 7.0E-14
sp|Q9FPS2|UBP25_ARATH Ubiquitin carboxyl-terminal hydrolase 25 OS=Arabidopsis thaliana GN=UBP25 PE=2 SV=1 1071 1258 7.0E-14
sp|Q8R5K2|UBP33_MOUSE Ubiquitin carboxyl-terminal hydrolase 33 OS=Mus musculus GN=Usp33 PE=1 SV=2 430 539 8.0E-14
sp|Q0VA64|UBP16_XENTR Ubiquitin carboxyl-terminal hydrolase 16 OS=Xenopus tropicalis GN=usp16 PE=2 SV=2 433 620 8.0E-14
sp|Q4R6X7|UBP16_MACFA Ubiquitin carboxyl-terminal hydrolase 16 OS=Macaca fascicularis GN=USP16 PE=2 SV=2 1062 1218 9.0E-14
sp|Q9Y5T5|UBP16_HUMAN Ubiquitin carboxyl-terminal hydrolase 16 OS=Homo sapiens GN=USP16 PE=1 SV=1 1062 1218 9.0E-14
sp|Q2KJ09|UBP16_RAT Ubiquitin carboxyl-terminal hydrolase 16 OS=Rattus norvegicus GN=Usp16 PE=1 SV=2 1062 1218 9.0E-14
sp|A6QNM7|UBP33_BOVIN Ubiquitin carboxyl-terminal hydrolase 33 OS=Bos taurus GN=USP33 PE=2 SV=1 430 539 1.0E-13
sp|Q8TEY7|UBP33_HUMAN Ubiquitin carboxyl-terminal hydrolase 33 OS=Homo sapiens GN=USP33 PE=1 SV=2 430 539 1.0E-13
sp|A8HAL1|UBP16_DANRE Ubiquitin carboxyl-terminal hydrolase 16 OS=Danio rerio GN=usp16 PE=3 SV=1 1037 1220 1.0E-13
sp|Q6NTR6|UP44A_XENLA Ubiquitin carboxyl-terminal hydrolase 44-A OS=Xenopus laevis GN=usp44-a PE=2 SV=1 1062 1219 1.0E-13
sp|Q28CN3|UBP33_XENTR Ubiquitin carboxyl-terminal hydrolase 33 OS=Xenopus tropicalis GN=usp33 PE=2 SV=2 430 539 2.0E-13
sp|Q8K387|UBP45_MOUSE Ubiquitin carboxyl-terminal hydrolase 45 OS=Mus musculus GN=Usp45 PE=1 SV=1 433 617 2.0E-13
sp|A8HAL1|UBP16_DANRE Ubiquitin carboxyl-terminal hydrolase 16 OS=Danio rerio GN=usp16 PE=3 SV=1 433 617 2.0E-13
sp|Q5XGZ2|UP44B_XENLA Ubiquitin carboxyl-terminal hydrolase 44-B OS=Xenopus laevis GN=usp44-b PE=2 SV=1 1068 1219 2.0E-13
sp|Q9FPS7|UBP20_ARATH Ubiquitin carboxyl-terminal hydrolase 20 OS=Arabidopsis thaliana GN=UBP20 PE=2 SV=1 1066 1221 2.0E-13
sp|A7Z056|UBP20_BOVIN Ubiquitin carboxyl-terminal hydrolase 20 OS=Bos taurus GN=USP20 PE=2 SV=1 430 539 3.0E-13
sp|Q8C6M1|UBP20_MOUSE Ubiquitin carboxyl-terminal hydrolase 20 OS=Mus musculus GN=Usp20 PE=1 SV=1 430 539 3.0E-13
sp|Q08DA3|UBP16_BOVIN Ubiquitin carboxyl-terminal hydrolase 16 OS=Bos taurus GN=USP16 PE=2 SV=2 1062 1218 3.0E-13
sp|Q08DA3|UBP16_BOVIN Ubiquitin carboxyl-terminal hydrolase 16 OS=Bos taurus GN=USP16 PE=2 SV=2 433 622 3.0E-13
sp|Q9FIQ1|UBP21_ARATH Ubiquitin carboxyl-terminal hydrolase 21 OS=Arabidopsis thaliana GN=UBP21 PE=2 SV=1 1071 1237 3.0E-13
sp|Q5R5Z6|UBP20_PONAB Ubiquitin carboxyl-terminal hydrolase 20 OS=Pongo abelii GN=USP20 PE=2 SV=1 430 539 4.0E-13
sp|Q9Y2K6|UBP20_HUMAN Ubiquitin carboxyl-terminal hydrolase 20 OS=Homo sapiens GN=USP20 PE=1 SV=2 430 539 4.0E-13
sp|Q9UMW8|UBP18_HUMAN Ubl carboxyl-terminal hydrolase 18 OS=Homo sapiens GN=USP18 PE=1 SV=1 1071 1218 5.0E-13
sp|P36026|UBP11_YEAST Ubiquitin carboxyl-terminal hydrolase 11 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=UBP11 PE=3 SV=1 433 642 6.0E-13
sp|Q7ZUM8|UBP44_DANRE Ubiquitin carboxyl-terminal hydrolase 44 OS=Danio rerio GN=usp44 PE=2 SV=1 1072 1221 8.0E-13
sp|Q9H0E7|UBP44_HUMAN Ubiquitin carboxyl-terminal hydrolase 44 OS=Homo sapiens GN=USP44 PE=1 SV=2 1067 1219 8.0E-13
sp|P0C8Z3|UBP22_BOVIN Ubiquitin carboxyl-terminal hydrolase 22 OS=Bos taurus GN=USP22 PE=2 SV=1 430 633 1.0E-12
sp|Q5DU02|UBP22_MOUSE Ubiquitin carboxyl-terminal hydrolase 22 OS=Mus musculus GN=Usp22 PE=2 SV=2 430 633 1.0E-12
sp|Q9UPT9|UBP22_HUMAN Ubiquitin carboxyl-terminal hydrolase 22 OS=Homo sapiens GN=USP22 PE=1 SV=2 430 633 1.0E-12
sp|Q6GNI6|UB22A_XENLA Ubiquitin carboxyl-terminal hydrolase 22-A OS=Xenopus laevis GN=usp22-a PE=2 SV=1 430 633 1.0E-12
sp|Q6DCJ1|UB22B_XENLA Ubiquitin carboxyl-terminal hydrolase 22-B OS=Xenopus laevis GN=usp22-b PE=2 SV=2 430 633 1.0E-12
sp|Q4R6X7|UBP16_MACFA Ubiquitin carboxyl-terminal hydrolase 16 OS=Macaca fascicularis GN=USP16 PE=2 SV=2 433 627 1.0E-12
sp|Q2KJ09|UBP16_RAT Ubiquitin carboxyl-terminal hydrolase 16 OS=Rattus norvegicus GN=Usp16 PE=1 SV=2 433 638 1.0E-12
sp|A0JM59|UBP20_XENTR Ubiquitin carboxyl-terminal hydrolase 20 OS=Xenopus tropicalis GN=usp20 PE=2 SV=1 430 539 2.0E-12
sp|A6H8I0|UBP22_DANRE Ubiquitin carboxyl-terminal hydrolase 22 OS=Danio rerio GN=usp22 PE=2 SV=1 430 633 2.0E-12
sp|D2HBJ8|UBP44_AILME Ubiquitin carboxyl-terminal hydrolase 44 OS=Ailuropoda melanoleuca GN=USP44 PE=3 SV=1 1074 1219 2.0E-12
sp|Q70EL2|UBP45_HUMAN Ubiquitin carboxyl-terminal hydrolase 45 OS=Homo sapiens GN=USP45 PE=1 SV=3 427 617 2.0E-12
sp|Q3LFD5|UBP41_HUMAN Putative ubiquitin carboxyl-terminal hydrolase 41 OS=Homo sapiens GN=USP41 PE=2 SV=2 1071 1201 2.0E-12
sp|B1WBD7|UBP20_XENLA Ubiquitin carboxyl-terminal hydrolase 20 OS=Xenopus laevis GN=usp20 PE=2 SV=1 430 539 3.0E-12
sp|P53874|UBP10_YEAST Ubiquitin carboxyl-terminal hydrolase 10 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=UBP10 PE=1 SV=2 1067 1218 3.0E-12
sp|Q9LEW0|UBP22_ARATH Ubiquitin carboxyl-terminal hydrolase 22 OS=Arabidopsis thaliana GN=UBP22 PE=2 SV=1 1071 1216 4.0E-12
sp|Q8NFA0|UBP32_HUMAN Ubiquitin carboxyl-terminal hydrolase 32 OS=Homo sapiens GN=USP32 PE=1 SV=1 1070 1153 5.0E-12
sp|A5PN09|UBP20_DANRE Ubiquitin carboxyl-terminal hydrolase 20 OS=Danio rerio GN=usp20 PE=3 SV=1 430 539 5.0E-12
sp|Q9Y5T5|UBP16_HUMAN Ubiquitin carboxyl-terminal hydrolase 16 OS=Homo sapiens GN=USP16 PE=1 SV=1 433 622 5.0E-12
sp|Q8C2S0|UBP44_MOUSE Ubiquitin carboxyl-terminal hydrolase 44 OS=Mus musculus GN=Usp44 PE=2 SV=3 1076 1219 7.0E-12
sp|C9J2P7|U17LF_HUMAN Ubiquitin carboxyl-terminal hydrolase 17-like protein 15 OS=Homo sapiens GN=USP17L15 PE=3 SV=1 1071 1220 8.0E-12
sp|Q70EK9|UBP51_HUMAN Ubiquitin carboxyl-terminal hydrolase 51 OS=Homo sapiens GN=USP51 PE=2 SV=1 430 618 1.0E-11
sp|A6NNY8|UBP27_HUMAN Ubiquitin carboxyl-terminal hydrolase 27 OS=Homo sapiens GN=USP27X PE=2 SV=3 430 633 2.0E-11
sp|Q70EL2|UBP45_HUMAN Ubiquitin carboxyl-terminal hydrolase 45 OS=Homo sapiens GN=USP45 PE=1 SV=3 1067 1218 2.0E-11
sp|Q6R6M4|U17L2_HUMAN Ubiquitin carboxyl-terminal hydrolase 17 OS=Homo sapiens GN=USP17L2 PE=1 SV=2 1071 1220 2.0E-11
sp|B4IXE0|UBP36_DROGR Ubiquitin carboxyl-terminal hydrolase 36 OS=Drosophila grimshawi GN=Usp36 PE=3 SV=1 432 622 2.0E-11
sp|O24454|UBP3_ARATH Ubiquitin carboxyl-terminal hydrolase 3 OS=Arabidopsis thaliana GN=UBP3 PE=1 SV=1 1071 1223 2.0E-11
sp|C9JLJ4|U17LD_HUMAN Ubiquitin carboxyl-terminal hydrolase 17-like protein 13 OS=Homo sapiens GN=USP17L13 PE=3 SV=1 1071 1220 3.0E-11
sp|Q6QN14|U17L6_HUMAN Ubiquitin carboxyl-terminal hydrolase 17-like protein 6 OS=Homo sapiens GN=USP17L6P PE=1 SV=2 1071 1220 3.0E-11
sp|D6RA61|U17LM_HUMAN Ubiquitin carboxyl-terminal hydrolase 17-like protein 22 OS=Homo sapiens GN=USP17L22 PE=3 SV=1 1071 1220 3.0E-11
sp|D6RBQ6|U17LH_HUMAN Ubiquitin carboxyl-terminal hydrolase 17-like protein 17 OS=Homo sapiens GN=USP17L17 PE=3 SV=1 1071 1220 3.0E-11
sp|Q8CEG8|UBP27_MOUSE Ubiquitin carboxyl-terminal hydrolase 27 OS=Mus musculus GN=Usp27 PE=2 SV=2 430 633 4.0E-11
sp|Q9P275|UBP36_HUMAN Ubiquitin carboxyl-terminal hydrolase 36 OS=Homo sapiens GN=USP36 PE=1 SV=3 431 617 4.0E-11
sp|C9JJH3|U17LA_HUMAN Ubiquitin carboxyl-terminal hydrolase 17-like protein 10 OS=Homo sapiens GN=USP17L10 PE=3 SV=1 1071 1220 4.0E-11
sp|E7F6T8|UBP37_DANRE Ubiquitin carboxyl-terminal hydrolase 37 OS=Danio rerio GN=usp37 PE=2 SV=1 433 618 4.0E-11
sp|Q8LAM0|UBP4_ARATH Ubiquitin carboxyl-terminal hydrolase 4 OS=Arabidopsis thaliana GN=UBP4 PE=1 SV=2 986 1204 4.0E-11
sp|B1AQJ2|UBP36_MOUSE Ubiquitin carboxyl-terminal hydrolase 36 OS=Mus musculus GN=Usp36 PE=1 SV=1 431 617 5.0E-11
sp|C9JVI0|U17LB_HUMAN Ubiquitin carboxyl-terminal hydrolase 17-like protein 11 OS=Homo sapiens GN=USP17L11 PE=3 SV=1 1071 1220 5.0E-11
sp|D6R9N7|U17LI_HUMAN Ubiquitin carboxyl-terminal hydrolase 17-like protein 18 OS=Homo sapiens GN=USP17L18 PE=3 SV=1 1071 1220 5.0E-11
sp|D6RCP7|U17LJ_HUMAN Ubiquitin carboxyl-terminal hydrolase 17-like protein 19 OS=Homo sapiens GN=USP17L19 PE=3 SV=1 1071 1220 5.0E-11
sp|A8MUK1|U17L5_HUMAN Ubiquitin carboxyl-terminal hydrolase 17-like protein 5 OS=Homo sapiens GN=USP17L5 PE=3 SV=2 1071 1220 5.0E-11
sp|C9JPN9|UL17C_HUMAN Ubiquitin carboxyl-terminal hydrolase 17-like protein 12 OS=Homo sapiens GN=USP17L12 PE=3 SV=1 1071 1220 5.0E-11
sp|D6R901|U17LL_HUMAN Ubiquitin carboxyl-terminal hydrolase 17-like protein 21 OS=Homo sapiens GN=USP17L21 PE=3 SV=1 1071 1220 6.0E-11
sp|B4LG38|UBP36_DROVI Ubiquitin carboxyl-terminal hydrolase 36 OS=Drosophila virilis GN=Usp36 PE=3 SV=1 431 617 6.0E-11
sp|D6RJB6|U17LK_HUMAN Ubiquitin carboxyl-terminal hydrolase 17-like protein 20 OS=Homo sapiens GN=USP17L20 PE=3 SV=1 1071 1220 6.0E-11
sp|Q0WX57|U17LO_HUMAN Ubiquitin carboxyl-terminal hydrolase 17-like protein 24 OS=Homo sapiens GN=USP17L24 PE=1 SV=2 1071 1220 7.0E-11
sp|A6NCW0|U17L3_HUMAN Ubiquitin carboxyl-terminal hydrolase 17-like protein 3 OS=Homo sapiens GN=USP17L3 PE=3 SV=1 1071 1220 8.0E-11
sp|Q61068|U17PA_MOUSE Ubiquitin carboxyl-terminal hydrolase 17-like protein A OS=Mus musculus GN=Usp17la PE=1 SV=1 399 628 1.0E-10
sp|B1AY13|UBP24_MOUSE Ubiquitin carboxyl-terminal hydrolase 24 OS=Mus musculus GN=Usp24 PE=1 SV=1 1071 1197 1.0E-10
sp|Q9UPU5|UBP24_HUMAN Ubiquitin carboxyl-terminal hydrolase 24 OS=Homo sapiens GN=USP24 PE=1 SV=3 1071 1197 2.0E-10
sp|Q86UV5|UBP48_HUMAN Ubiquitin carboxyl-terminal hydrolase 48 OS=Homo sapiens GN=USP48 PE=1 SV=1 1072 1200 2.0E-10
sp|Q0CT11|CREB_ASPTN Probable ubiquitin carboxyl-terminal hydrolase creB OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=creB PE=3 SV=2 1075 1268 2.0E-10
sp|Q5RE63|UBP18_PONAB Ubl carboxyl-terminal hydrolase 18 OS=Pongo abelii GN=USP18 PE=2 SV=1 1073 1218 3.0E-10
sp|A5D9H7|UBP12_BOVIN Ubiquitin carboxyl-terminal hydrolase 12 OS=Bos taurus GN=USP12 PE=2 SV=1 1035 1219 3.0E-10
sp|A6NCW7|U17L4_HUMAN Inactive ubiquitin carboxyl-terminal hydrolase 17-like protein 4 OS=Homo sapiens GN=USP17L4 PE=3 SV=3 1071 1220 4.0E-10
sp|B4MLR8|UBP36_DROWI Ubiquitin carboxyl-terminal hydrolase 36 OS=Drosophila willistoni GN=Usp36 PE=3 SV=1 1063 1227 4.0E-10
sp|Q5RBQ4|UBP46_PONAB Ubiquitin carboxyl-terminal hydrolase 46 OS=Pongo abelii GN=USP46 PE=2 SV=1 1035 1219 4.0E-10
sp|P62069|UBP46_MOUSE Ubiquitin carboxyl-terminal hydrolase 46 OS=Mus musculus GN=Usp46 PE=1 SV=1 1035 1219 4.0E-10
sp|P62068|UBP46_HUMAN Ubiquitin carboxyl-terminal hydrolase 46 OS=Homo sapiens GN=USP46 PE=1 SV=1 1035 1219 4.0E-10
sp|Q3V0C5|UBP48_MOUSE Ubiquitin carboxyl-terminal hydrolase 48 OS=Mus musculus GN=Usp48 PE=1 SV=2 1072 1200 4.0E-10
sp|Q5M981|UB12B_XENLA Ubiquitin carboxyl-terminal hydrolase 12-B OS=Xenopus laevis GN=usp12-b PE=2 SV=2 1035 1219 5.0E-10
sp|Q52KZ6|UB12A_XENLA Ubiquitin carboxyl-terminal hydrolase 12-A OS=Xenopus laevis GN=usp12-a PE=2 SV=1 1035 1219 5.0E-10
sp|O75317|UBP12_HUMAN Ubiquitin carboxyl-terminal hydrolase 12 OS=Homo sapiens GN=USP12 PE=1 SV=2 1035 1219 5.0E-10
sp|Q7M764|U17PE_MOUSE Ubiquitin carboxyl-terminal hydrolase 17-like protein E OS=Mus musculus GN=Usp17le PE=3 SV=2 1081 1220 5.0E-10
sp|B4KXJ5|UBP36_DROMO Ubiquitin carboxyl-terminal hydrolase 36 OS=Drosophila mojavensis GN=Usp36 PE=3 SV=1 431 617 5.0E-10
sp|A5WWB0|UBP46_DANRE Ubiquitin carboxyl-terminal hydrolase 46 OS=Danio rerio GN=usp46 PE=3 SV=2 1035 1219 5.0E-10
sp|Q61068|U17PA_MOUSE Ubiquitin carboxyl-terminal hydrolase 17-like protein A OS=Mus musculus GN=Usp17la PE=1 SV=1 1067 1221 6.0E-10
sp|Q9D9M2|UBP12_MOUSE Ubiquitin carboxyl-terminal hydrolase 12 OS=Mus musculus GN=Usp12 PE=2 SV=2 1035 1219 6.0E-10
sp|Q5ZM45|UBP48_CHICK Ubiquitin carboxyl-terminal hydrolase 48 OS=Gallus gallus GN=USP48 PE=2 SV=1 1072 1245 6.0E-10
sp|Q9VVR1|NOT_DROME Ubiquitin carboxyl-terminal hydrolase nonstop OS=Drosophila melanogaster GN=not PE=1 SV=3 424 625 7.0E-10
sp|Q76LT8|UBP48_RAT Ubiquitin carboxyl-terminal hydrolase 48 OS=Rattus norvegicus GN=Usp48 PE=1 SV=1 1072 1200 7.0E-10
sp|C0HB46|UBP12_SALSA Ubiquitin carboxyl-terminal hydrolase 12 OS=Salmo salar GN=usp12 PE=2 SV=1 1035 1219 8.0E-10
sp|A4FUN7|UBP12_DANRE Ubiquitin carboxyl-terminal hydrolase 12A OS=Danio rerio GN=usp12a PE=2 SV=1 1035 1219 8.0E-10
sp|A1CIL1|CREB_ASPCL Probable ubiquitin carboxyl-terminal hydrolase creB OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=creB PE=3 SV=2 1075 1285 9.0E-10
sp|Q2UUG8|CREB_ASPOR Probable ubiquitin carboxyl-terminal hydrolase creB OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=creB PE=3 SV=2 1071 1217 1.0E-09
sp|B8NSV5|CREB_ASPFN Probable ubiquitin carboxyl-terminal hydrolase creB OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=creB PE=3 SV=1 1071 1217 1.0E-09
sp|A1CW53|CREB_NEOFI Probable ubiquitin carboxyl-terminal hydrolase creB OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=creB PE=3 SV=2 1075 1217 1.0E-09
sp|Q7RTZ2|U17L1_HUMAN Ubiquitin carboxyl-terminal hydrolase 17-like protein 1 OS=Homo sapiens GN=USP17L1 PE=3 SV=1 1071 1220 1.0E-09
sp|B0Y4P5|CREB_ASPFC Probable ubiquitin carboxyl-terminal hydrolase creB OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=creB PE=3 SV=1 1075 1217 1.0E-09
sp|P35125|UBP6_HUMAN Ubiquitin carboxyl-terminal hydrolase 6 OS=Homo sapiens GN=USP6 PE=1 SV=2 1070 1153 2.0E-09
sp|Q4WQI1|CREB_ASPFU Probable ubiquitin carboxyl-terminal hydrolase creB OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=creB PE=3 SV=3 1075 1217 2.0E-09
sp|Q2LZB1|UBP36_DROPS Ubiquitin carboxyl-terminal hydrolase 36 OS=Drosophila pseudoobscura pseudoobscura GN=Usp36 PE=3 SV=2 1063 1216 2.0E-09
sp|Q2LZB1|UBP36_DROPS Ubiquitin carboxyl-terminal hydrolase 36 OS=Drosophila pseudoobscura pseudoobscura GN=Usp36 PE=3 SV=2 431 622 2.0E-09
sp|A2Q9N1|CREB_ASPNC Probable ubiquitin carboxyl-terminal hydrolase creB OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=creB PE=3 SV=2 1071 1217 2.0E-09
sp|Q96V54|CREB_EMENI Ubiquitin carboxyl-terminal hydrolase creB OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=creB PE=1 SV=1 1075 1217 2.0E-09
sp|O24454|UBP3_ARATH Ubiquitin carboxyl-terminal hydrolase 3 OS=Arabidopsis thaliana GN=UBP3 PE=1 SV=1 421 630 3.0E-09
sp|P0C7I0|U17L8_HUMAN Inactive ubiquitin carboxyl-terminal hydrolase 17-like protein 8 OS=Homo sapiens GN=USP17L8 PE=3 SV=1 1071 1220 3.0E-09
sp|Q3TIX9|SNUT2_MOUSE U4/U6.U5 tri-snRNP-associated protein 2 OS=Mus musculus GN=Usp39 PE=1 SV=2 1104 1219 3.0E-09
sp|Q8W4N3|UBP2_ARATH Ubiquitin carboxyl-terminal hydrolase 2 OS=Arabidopsis thaliana GN=UBP2 PE=1 SV=2 1100 1218 4.0E-09
sp|O96612|UBPB_DICDI Ubiquitin hydrolase B OS=Dictyostelium discoideum GN=ubpB PE=1 SV=1 1063 1217 4.0E-09
sp|P0C7H9|U17L7_HUMAN Inactive ubiquitin carboxyl-terminal hydrolase 17-like protein 7 OS=Homo sapiens GN=USP17L7 PE=3 SV=1 1071 1220 4.0E-09
sp|Q8BW70|UBP38_MOUSE Ubiquitin carboxyl-terminal hydrolase 38 OS=Mus musculus GN=Usp38 PE=1 SV=2 429 615 4.0E-09
sp|Q53GS9|SNUT2_HUMAN U4/U6.U5 tri-snRNP-associated protein 2 OS=Homo sapiens GN=USP39 PE=1 SV=2 1104 1219 5.0E-09
sp|B4KXJ5|UBP36_DROMO Ubiquitin carboxyl-terminal hydrolase 36 OS=Drosophila mojavensis GN=Usp36 PE=3 SV=1 1071 1216 7.0E-09
sp|P38187|UBP13_YEAST Ubiquitin carboxyl-terminal hydrolase 13 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=UBP13 PE=1 SV=3 1072 1217 8.0E-09
sp|Q8NB14|UBP38_HUMAN Ubiquitin carboxyl-terminal hydrolase 38 OS=Homo sapiens GN=USP38 PE=1 SV=2 429 615 9.0E-09
sp|B3M3M6|UBP36_DROAN Ubiquitin carboxyl-terminal hydrolase 36 OS=Drosophila ananassae GN=Usp36 PE=3 SV=1 1063 1216 1.0E-08
sp|Q5R761|SNUT2_PONAB U4/U6.U5 tri-snRNP-associated protein 2 OS=Pongo abelii GN=USP39 PE=2 SV=1 1104 1219 1.0E-08
sp|O74442|UBP16_SCHPO Probable ubiquitin carboxyl-terminal hydrolase 16 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ubp16 PE=1 SV=1 430 615 2.0E-08
sp|B4IXE0|UBP36_DROGR Ubiquitin carboxyl-terminal hydrolase 36 OS=Drosophila grimshawi GN=Usp36 PE=3 SV=1 1063 1216 2.0E-08
sp|B4LG38|UBP36_DROVI Ubiquitin carboxyl-terminal hydrolase 36 OS=Drosophila virilis GN=Usp36 PE=3 SV=1 1071 1216 2.0E-08
sp|F1SRY5|UBP37_PIG Ubiquitin carboxyl-terminal hydrolase 37 OS=Sus scrofa GN=USP37 PE=3 SV=1 433 618 2.0E-08
sp|Q70CQ2|UBP34_HUMAN Ubiquitin carboxyl-terminal hydrolase 34 OS=Homo sapiens GN=USP34 PE=1 SV=2 1072 1218 3.0E-08
sp|B3NC86|UBP36_DROER Ubiquitin carboxyl-terminal hydrolase 36 OS=Drosophila erecta GN=Usp36 PE=3 SV=1 1071 1216 3.0E-08
sp|Q9FPT5|UBP1_ARATH Ubiquitin carboxyl-terminal hydrolase 1 OS=Arabidopsis thaliana GN=UBP1 PE=1 SV=2 1100 1218 4.0E-08
sp|Q86T82|UBP37_HUMAN Ubiquitin carboxyl-terminal hydrolase 37 OS=Homo sapiens GN=USP37 PE=1 SV=2 433 618 4.0E-08
sp|Q3KR59|UBP10_RAT Ubiquitin carboxyl-terminal hydrolase 10 OS=Rattus norvegicus GN=Usp10 PE=1 SV=1 1063 1218 6.0E-08
sp|F1N5V1|UBP37_BOVIN Ubiquitin carboxyl-terminal hydrolase 37 OS=Bos taurus GN=USP37 PE=3 SV=1 433 618 6.0E-08
sp|Q9H0E7|UBP44_HUMAN Ubiquitin carboxyl-terminal hydrolase 44 OS=Homo sapiens GN=USP44 PE=1 SV=2 482 669 7.0E-08
sp|Q92353|UBP6_SCHPO Ubiquitin carboxyl-terminal hydrolase 6 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ubp6 PE=1 SV=2 433 540 9.0E-08
sp|E1C213|UBP37_CHICK Ubiquitin carboxyl-terminal hydrolase 37 OS=Gallus gallus GN=USP37 PE=3 SV=1 433 631 9.0E-08
sp|Q8NFA0|UBP32_HUMAN Ubiquitin carboxyl-terminal hydrolase 32 OS=Homo sapiens GN=USP32 PE=1 SV=1 1151 1219 1.0E-07
sp|Q9FPS2|UBP25_ARATH Ubiquitin carboxyl-terminal hydrolase 25 OS=Arabidopsis thaliana GN=UBP25 PE=2 SV=1 427 617 1.0E-07
sp|P52479|UBP10_MOUSE Ubiquitin carboxyl-terminal hydrolase 10 OS=Mus musculus GN=Usp10 PE=1 SV=3 1063 1218 1.0E-07
sp|Q6ZQ93|UBP34_MOUSE Ubiquitin carboxyl-terminal hydrolase 34 OS=Mus musculus GN=Usp34 PE=1 SV=3 1072 1218 1.0E-07
sp|Q09738|UBP8_SCHPO Probable ubiquitin carboxyl-terminal hydrolase 8 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ubp8 PE=3 SV=1 1071 1219 1.0E-07
sp|Q14694|UBP10_HUMAN Ubiquitin carboxyl-terminal hydrolase 10 OS=Homo sapiens GN=USP10 PE=1 SV=2 1018 1218 1.0E-07
sp|Q93008|USP9X_HUMAN Probable ubiquitin carboxyl-terminal hydrolase FAF-X OS=Homo sapiens GN=USP9X PE=1 SV=3 1051 1197 1.0E-07
sp|Q9FPS3|UBP24_ARATH Ubiquitin carboxyl-terminal hydrolase 24 OS=Arabidopsis thaliana GN=UBP24 PE=1 SV=1 1102 1218 1.0E-07
sp|P70398|USP9X_MOUSE Probable ubiquitin carboxyl-terminal hydrolase FAF-X OS=Mus musculus GN=Usp9x PE=1 SV=2 1051 1197 1.0E-07
sp|Q8LAM0|UBP4_ARATH Ubiquitin carboxyl-terminal hydrolase 4 OS=Arabidopsis thaliana GN=UBP4 PE=1 SV=2 421 630 2.0E-07
sp|Q0IIF7|UBP14_BOVIN Ubiquitin carboxyl-terminal hydrolase 14 OS=Bos taurus GN=USP14 PE=2 SV=3 432 647 2.0E-07
sp|E2RK09|UBP37_CANLF Ubiquitin carboxyl-terminal hydrolase 37 OS=Canis lupus familiaris GN=USP37 PE=3 SV=1 433 618 2.0E-07
sp|Q9P7V9|UBP9_SCHPO Probable ubiquitin carboxyl-terminal hydrolase 9 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ubp9 PE=1 SV=1 1071 1216 5.0E-07
sp|P34547|UBP46_CAEEL Ubiquitin carboxyl-terminal hydrolase 46 OS=Caenorhabditis elegans GN=usp-46 PE=1 SV=3 1071 1219 5.0E-07
sp|Q7ZXR7|UB10B_XENLA Ubiquitin carboxyl-terminal hydrolase 10-B OS=Xenopus laevis GN=usp10-b PE=2 SV=1 1063 1218 5.0E-07
sp|P54578|UBP14_HUMAN Ubiquitin carboxyl-terminal hydrolase 14 OS=Homo sapiens GN=USP14 PE=1 SV=3 432 647 6.0E-07
sp|P60051|UBP14_PANTR Ubiquitin carboxyl-terminal hydrolase 14 OS=Pan troglodytes GN=USP14 PE=3 SV=2 432 647 6.0E-07
sp|B4MLR8|UBP36_DROWI Ubiquitin carboxyl-terminal hydrolase 36 OS=Drosophila willistoni GN=Usp36 PE=3 SV=1 431 622 8.0E-07
sp|P40826|UBP14_RABIT Ubiquitin carboxyl-terminal hydrolase 14 OS=Oryctolagus cuniculus GN=USP14 PE=1 SV=3 432 647 8.0E-07
sp|Q949Y0|UBP6_ARATH Ubiquitin carboxyl-terminal hydrolase 6 OS=Arabidopsis thaliana GN=UBP6 PE=1 SV=1 425 539 9.0E-07
sp|P35125|UBP6_HUMAN Ubiquitin carboxyl-terminal hydrolase 6 OS=Homo sapiens GN=USP6 PE=1 SV=2 1151 1219 1.0E-06
sp|Q5RBQ4|UBP46_PONAB Ubiquitin carboxyl-terminal hydrolase 46 OS=Pongo abelii GN=USP46 PE=2 SV=1 416 622 1.0E-06
sp|P62069|UBP46_MOUSE Ubiquitin carboxyl-terminal hydrolase 46 OS=Mus musculus GN=Usp46 PE=1 SV=1 416 622 1.0E-06
sp|P62068|UBP46_HUMAN Ubiquitin carboxyl-terminal hydrolase 46 OS=Homo sapiens GN=USP46 PE=1 SV=1 416 622 1.0E-06
sp|Q5U252|UBP47_XENLA Ubiquitin carboxyl-terminal hydrolase 47 OS=Xenopus laevis GN=usp47 PE=2 SV=1 1156 1231 1.0E-06
sp|P54201|UBPA_DICDI Ubiquitin carboxyl-terminal hydrolase A OS=Dictyostelium discoideum GN=ubpA PE=2 SV=2 430 536 1.0E-06
sp|A1A5G2|UBP47_XENTR Ubiquitin carboxyl-terminal hydrolase 47 OS=Xenopus tropicalis GN=usp47 PE=2 SV=1 1156 1220 1.0E-06
sp|O00507|USP9Y_HUMAN Probable ubiquitin carboxyl-terminal hydrolase FAF-Y OS=Homo sapiens GN=USP9Y PE=2 SV=2 1051 1197 1.0E-06
sp|Q9VRP5|UBP36_DROME Ubiquitin carboxyl-terminal hydrolase 36 OS=Drosophila melanogaster GN=scny PE=1 SV=3 1071 1216 1.0E-06
sp|Q8C0R0|UBP37_MOUSE Ubiquitin carboxyl-terminal hydrolase 37 OS=Mus musculus GN=Usp37 PE=1 SV=1 433 618 1.0E-06
sp|O60079|UBP12_SCHPO Probable ubiquitin carboxyl-terminal hydrolase 12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ubp12 PE=1 SV=1 68 284 2.0E-06
sp|Q9JMA1|UBP14_MOUSE Ubiquitin carboxyl-terminal hydrolase 14 OS=Mus musculus GN=Usp14 PE=1 SV=3 432 647 2.0E-06
sp|A2XDG4|UBP26_ORYSI Ubiquitin carboxyl-terminal hydrolase 26 OS=Oryza sativa subsp. indica GN=UBP26 PE=3 SV=1 1068 1197 2.0E-06
sp|Q9SCJ9|UBP26_ARATH Ubiquitin carboxyl-terminal hydrolase 26 OS=Arabidopsis thaliana GN=UBP26 PE=1 SV=3 1068 1197 2.0E-06
sp|A3AF13|UBP26_ORYSJ Ubiquitin carboxyl-terminal hydrolase 26 OS=Oryza sativa subsp. japonica GN=UBP26 PE=3 SV=2 1068 1197 2.0E-06
sp|P55824|FAF_DROME Probable ubiquitin carboxyl-terminal hydrolase FAF OS=Drosophila melanogaster GN=faf PE=1 SV=2 1063 1197 2.0E-06
sp|A5WWB0|UBP46_DANRE Ubiquitin carboxyl-terminal hydrolase 46 OS=Danio rerio GN=usp46 PE=3 SV=2 416 630 4.0E-06
sp|P50102|UBP8_YEAST Ubiquitin carboxyl-terminal hydrolase 8 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=UBP8 PE=1 SV=1 418 617 6.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0004843 cysteine-type deubiquitinase activity Yes
GO:0016579 protein deubiquitination Yes
GO:0006807 nitrogen compound metabolic process No
GO:0043170 macromolecule metabolic process No
GO:0008233 peptidase activity No
GO:0008150 biological_process No
GO:0016787 hydrolase activity No
GO:0003674 molecular_function No
GO:0006508 proteolysis No
GO:0070646 protein modification by small protein removal No
GO:0140096 catalytic activity, acting on a protein No
GO:0036211 protein modification process No
GO:0019783 ubiquitin-like protein peptidase activity No
GO:1901564 organonitrogen compound metabolic process No
GO:0003824 catalytic activity No
GO:0071704 organic substance metabolic process No
GO:0101005 deubiquitinase activity No
GO:0043412 macromolecule modification No
GO:0008234 cysteine-type peptidase activity No
GO:0008152 metabolic process No
GO:0070647 protein modification by small protein conjugation or removal No
GO:0044238 primary metabolic process No
GO:0019538 protein metabolic process No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup258
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6289
Ophiocordyceps australis 1348a (Ghana) OphauG2|6290
Ophiocordyceps australis map64 (Brazil) OphauB2|4366 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|4367
Ophiocordyceps camponoti-floridani Ophcf2|05034
Ophiocordyceps camponoti-rufipedis Ophun1|4211
Ophiocordyceps camponoti-rufipedis Ophun1|4212
Ophiocordyceps kimflemingae Ophio5|2102
Ophiocordyceps kimflemingae Ophio5|2103
Ophiocordyceps subramaniannii Hirsu2|1017
Ophiocordyceps subramaniannii Hirsu2|1018

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|4366
MNGDDELPRRSSSPLKRRASSMDPEIDSSHGAAETDGPMPSASHDASPPLHGLPRAMSIDTPEADSHDASPVSTA
AHAAKPPLLEQVKTIEMLLKAFAESPLEEGVVAYLVSRSWVDKALALGSQSKAPKDLAADVSLGPVDNSDIIDQV
IQDSSGLEFVCLKPGSSLESFELFSEDAWKLVMDWYGLQQGQIPIVRRAVNTAESKTSLPNIMYEFHPPVFRIYR
LWSSVSPLPIEQSLKARNPPPLVLVRSSASHAQTFLKELKTFAGVPMDRKVRLFSLPIDLHVPENSAQSASALTP
PDSPKTEGPELVRDVWTHLLLDTTSFTLVRDSRLTVKLADQTNSEKFNGQATIQIFLATNDQILVIDESIENHWV
STYTGCERLPQRSIPSRSGLLSLAPRPNNDRASPFHDGPVTRSRTLKKRLGQNSGAVGLHNLGNTCYMNSALQCV
RSVEELTKYFLSESYLAEINETNVLGYEGRVASAYGSLLAEIYEQGKSSVSPRDFKSTVGRCRPTFSGWGQQDTQ
EFLGFLLDALQEDLSRIKKKPYIEKPDSTDDMINNPDAIRKMADQVWDITRRRDDSVIADLFTGMYKSTLKCPEC
GKISITFDPFNNLTLPIPTDNTWAGKVKFFPLNDSPVKIEVELSKHSSVKMLKQFVSDRTGVPVERLMSAEEYKD
RFFKIYDDTGDVSEISDSDIATIHELDAVPTNWPGKATRARYRTLLDVDASYDASDSDDEQCQTMVVSVIHRRPK
ALDRDPEGLPPPHFITLNKKEARSYDMIQRKILEKIATFTTWSKLSNASRGDDQSDDFKVAAQSVEGEEDMVDVT
MKDANGMHSLIIKHFNKQRPKFLDSMAFLDPDLQNLFELGYFRGNSDGPVPTGWSGVDNTRQVPRLTDRLPDEER
GSPESFESFESGNDDSSNDGTGPDASQTRMAEESSDEDAMPAARLSSRPGRPHHRFGGGRKKFKGHKTYGKKGNK
RRDKQMRSGKQAQRAPGVAPQPMPVSVADGGPLVRLHEGIVVDWSEAAWETLFGSPVRRQGTIEGVRTFAEPETL
CEPAIKLLRKRRDARKSRGLTLEECLDEFERAEILSEQDMWYCPRCKEHRRASKKFDLWKTPDILVAHLKRFSNS
GWRREKLDTFVDFPVENLDLTSRVVQKEDGKNEIYDLIAVDDHYGGLGGGHYTAYAKNFMDGRWYSFNDSSVHAV
SDAGSVVTSAAYLLFYRRRSSGPLGGPRFVDLMNKYEREACRSDDDTITVGSSDDSNMAAFGKSPASGDDEDDEE
TLPSYKESIRRSIETDQGAPIKSLNMTQGWNFDGLDEGGKRNGDETVSGFSGHDGSDGDGVQEDASATKIGDGSK
WHGHQVMSVPAQTGSHGDSEVAEIHLDGDKRNRVE*
Coding >OphauB2|4366
ATGAATGGTGATGACGAGCTGCCTCGCCGATCGTCTTCGCCTCTGAAACGCCGGGCATCAAGTATGGACCCCGAG
ATTGACTCGAGCCATGGCGCTGCCGAGACGGACGGGCCCATGCCCTCTGCATCGCATGACGCGTCTCCCCCATTG
CATGGCCTGCCTCGAGCCATGAGCATAGATACTCCAGAGGCAGACTCTCATGACGCGTCGCCCGTCAGCACGGCG
GCTCACGCAGCTAAGCCGCCGCTGCTCGAACAGGTCAAGACGATTGAGATGCTGCTCAAGGCGTTTGCAGAGAGC
CCCTTGGAGGAGGGTGTAGTGGCTTACCTGGTATCGCGGTCGTGGGTAGACAAGGCCCTTGCCTTGGGTTCGCAG
TCGAAAGCCCCAAAGGATCTTGCTGCCGACGTCTCGCTGGGTCCTGTCGACAATTCAGACATCATCGACCAAGTC
ATTCAAGACTCGAGTGGTCTGGAATTTGTTTGTCTGAAGCCGGGCTCCAGCCTTGAATCCTTTGAACTGTTTTCA
GAAGATGCGTGGAAGCTGGTGATGGACTGGTACGGCCTGCAGCAAGGCCAAATCCCCATTGTTCGCCGCGCAGTC
AATACCGCCGAGAGCAAAACCTCTCTCCCAAACATCATGTACGAATTCCATCCACCAGTGTTTCGCATCTATCGC
CTGTGGTCTAGTGTTAGCCCTCTGCCTATTGAGCAATCTCTCAAGGCTCGAAACCCCCCTCCGCTCGTCCTCGTT
CGAAGCTCGGCTTCTCATGCTCAAACTTTTCTTAAGGAGCTCAAAACTTTTGCCGGTGTTCCCATGGATCGCAAA
GTCCGCCTCTTCTCCCTCCCCATAGACCTGCATGTCCCCGAAAACTCTGCACAATCAGCTTCAGCTCTCACTCCG
CCTGACTCTCCCAAGACGGAAGGGCCCGAGCTCGTCCGAGATGTCTGGACGCATCTCTTGCTCGACACCACCAGC
TTTACCTTGGTTCGAGACAGTCGACTCACGGTGAAGCTGGCAGACCAGACCAACAGCGAAAAGTTTAATGGTCAA
GCCACGATACAAATTTTCCTTGCAACCAATGATCAAATTCTCGTCATTGACGAATCCATCGAGAACCATTGGGTC
AGCACATATACTGGGTGCGAGAGACTCCCACAGAGGTCTATTCCCTCGAGATCTGGTCTGCTCTCTCTGGCTCCT
AGACCCAACAACGACAGAGCTAGCCCGTTTCACGATGGCCCAGTCACTCGCTCAAGGACTCTGAAGAAGCGCCTC
GGCCAGAACTCGGGCGCTGTAGGCTTGCATAACCTGGGAAATACTTGTTATATGAATTCTGCCCTGCAATGCGTC
CGCAGTGTAGAGGAGCTCACCAAGTATTTTCTTTCCGAGTCCTACCTTGCAGAGATCAATGAGACAAATGTGCTT
GGTTACGAAGGCCGGGTAGCAAGCGCCTATGGGAGTCTTTTGGCCGAGATTTATGAGCAAGGCAAAAGCTCAGTG
AGTCCACGCGATTTCAAATCAACAGTCGGCCGCTGTCGTCCTACCTTTTCCGGCTGGGGCCAACAAGACACGCAA
GAGTTTCTCGGTTTCCTCTTGGACGCTCTCCAAGAAGATCTCAGCCGTATCAAGAAGAAACCCTACATTGAAAAG
CCCGACTCTACCGACGACATGATTAATAACCCGGATGCCATTCGCAAGATGGCGGATCAAGTCTGGGATATCACC
CGCAGACGGGACGACTCCGTCATTGCTGACCTCTTTACCGGCATGTACAAGTCGACGTTGAAGTGTCCCGAGTGT
GGCAAGATCAGCATCACGTTTGATCCCTTCAACAATTTGACCCTGCCCATACCCACAGACAATACATGGGCTGGC
AAAGTCAAGTTTTTCCCACTCAATGATTCGCCCGTCAAGATTGAAGTAGAATTGTCAAAACACAGCTCTGTCAAA
ATGTTGAAGCAATTCGTTTCGGATCGTACTGGCGTTCCAGTCGAGCGACTAATGAGCGCCGAGGAATACAAGGAT
CGCTTCTTCAAGATTTACGATGACACTGGCGATGTCTCGGAGATTTCAGACTCGGACATTGCCACTATTCACGAG
CTGGATGCTGTCCCGACAAACTGGCCCGGTAAAGCCACTCGCGCCAGATATCGGACCTTGCTCGACGTTGATGCG
TCATATGATGCTTCAGACTCGGATGATGAACAATGCCAAACAATGGTGGTGTCTGTCATTCATCGCCGGCCCAAG
GCACTTGATCGAGACCCCGAGGGCCTTCCGCCCCCTCATTTCATCACACTAAACAAGAAGGAAGCCCGAAGCTAT
GACATGATTCAACGCAAGATTCTAGAAAAAATTGCTACTTTTACAACATGGAGCAAATTGTCAAACGCATCACGA
GGTGACGATCAGTCAGATGACTTCAAGGTTGCCGCTCAGTCTGTCGAGGGCGAAGAGGACATGGTTGATGTGACC
ATGAAGGATGCAAACGGAATGCATTCACTGATTATCAAGCACTTTAATAAACAACGGCCAAAGTTTCTAGATTCG
ATGGCCTTTTTAGATCCCGACTTACAGAATCTCTTCGAGCTGGGATATTTCAGGGGCAACTCGGATGGCCCGGTT
CCTACAGGCTGGTCTGGCGTTGATAACACTAGACAAGTGCCCCGGTTGACAGACCGCCTTCCTGATGAGGAACGA
GGGAGTCCCGAAAGCTTTGAGAGTTTTGAGTCTGGAAATGACGACAGCAGTAATGATGGTACCGGGCCTGATGCG
TCTCAGACACGCATGGCGGAGGAGTCGAGCGATGAAGATGCTATGCCCGCAGCACGGCTTTCCAGTCGCCCAGGT
CGTCCGCATCATAGATTTGGGGGTGGTCGGAAAAAGTTCAAGGGGCACAAGACATACGGCAAAAAGGGCAACAAG
CGACGAGACAAGCAAATGCGCTCTGGGAAGCAGGCGCAGCGGGCACCTGGTGTAGCACCACAGCCAATGCCTGTG
TCGGTGGCTGACGGGGGACCGCTGGTCCGCCTTCATGAGGGAATTGTGGTTGACTGGAGTGAAGCTGCGTGGGAA
ACATTGTTTGGTAGCCCGGTGAGACGCCAGGGTACCATTGAAGGGGTGCGGACATTTGCGGAACCGGAAACGCTG
TGTGAACCGGCCATCAAGCTTTTACGCAAGAGGCGGGACGCGCGCAAGTCGCGTGGTCTTACTCTTGAGGAATGT
CTTGACGAATTCGAGCGGGCAGAGATTCTATCAGAGCAGGACATGTGGTATTGCCCTCGCTGCAAGGAACACCGG
CGTGCCAGCAAAAAGTTTGATTTGTGGAAGACGCCAGACATTCTCGTGGCGCATTTGAAGAGGTTCAGCAATTCG
GGGTGGCGACGAGAAAAGCTGGACACATTTGTCGACTTTCCAGTCGAGAACCTCGATCTCACCTCGAGAGTTGTT
CAAAAGGAAGACGGCAAGAACGAGATTTACGACTTGATTGCCGTTGATGACCATTACGGCGGACTCGGTGGAGGC
CATTACACAGCCTACGCCAAAAACTTTATGGATGGACGCTGGTACAGCTTTAACGATTCATCAGTACATGCCGTT
TCGGATGCAGGGTCGGTGGTGACTAGCGCCGCCTATCTGCTCTTCTATCGCCGGCGTTCCAGTGGTCCCTTGGGT
GGGCCTCGCTTCGTGGATTTGATGAACAAGTACGAAAGAGAGGCTTGTAGGTCTGATGACGACACAATTACGGTC
GGGTCGAGCGATGATAGCAACATGGCGGCGTTTGGGAAAAGTCCAGCGTCAGGAGACGACGAAGACGATGAGGAA
ACCTTGCCGTCGTACAAGGAATCCATCCGTCGCAGCATTGAAACAGATCAAGGCGCACCTATAAAGTCTTTGAAT
ATGACTCAAGGCTGGAATTTTGATGGGCTCGACGAGGGTGGCAAACGCAATGGCGACGAGACAGTTTCCGGATTT
TCAGGCCACGACGGCAGCGATGGAGACGGTGTACAGGAGGATGCCAGTGCGACAAAGATTGGAGATGGCAGCAAG
TGGCATGGCCACCAAGTCATGTCGGTGCCTGCACAGACGGGCAGCCATGGTGACTCGGAGGTGGCCGAAATCCAT
TTGGACGGCGATAAGAGAAACCGCGTCGAATGA
Transcript >OphauB2|4366
ATGAATGGTGATGACGAGCTGCCTCGCCGATCGTCTTCGCCTCTGAAACGCCGGGCATCAAGTATGGACCCCGAG
ATTGACTCGAGCCATGGCGCTGCCGAGACGGACGGGCCCATGCCCTCTGCATCGCATGACGCGTCTCCCCCATTG
CATGGCCTGCCTCGAGCCATGAGCATAGATACTCCAGAGGCAGACTCTCATGACGCGTCGCCCGTCAGCACGGCG
GCTCACGCAGCTAAGCCGCCGCTGCTCGAACAGGTCAAGACGATTGAGATGCTGCTCAAGGCGTTTGCAGAGAGC
CCCTTGGAGGAGGGTGTAGTGGCTTACCTGGTATCGCGGTCGTGGGTAGACAAGGCCCTTGCCTTGGGTTCGCAG
TCGAAAGCCCCAAAGGATCTTGCTGCCGACGTCTCGCTGGGTCCTGTCGACAATTCAGACATCATCGACCAAGTC
ATTCAAGACTCGAGTGGTCTGGAATTTGTTTGTCTGAAGCCGGGCTCCAGCCTTGAATCCTTTGAACTGTTTTCA
GAAGATGCGTGGAAGCTGGTGATGGACTGGTACGGCCTGCAGCAAGGCCAAATCCCCATTGTTCGCCGCGCAGTC
AATACCGCCGAGAGCAAAACCTCTCTCCCAAACATCATGTACGAATTCCATCCACCAGTGTTTCGCATCTATCGC
CTGTGGTCTAGTGTTAGCCCTCTGCCTATTGAGCAATCTCTCAAGGCTCGAAACCCCCCTCCGCTCGTCCTCGTT
CGAAGCTCGGCTTCTCATGCTCAAACTTTTCTTAAGGAGCTCAAAACTTTTGCCGGTGTTCCCATGGATCGCAAA
GTCCGCCTCTTCTCCCTCCCCATAGACCTGCATGTCCCCGAAAACTCTGCACAATCAGCTTCAGCTCTCACTCCG
CCTGACTCTCCCAAGACGGAAGGGCCCGAGCTCGTCCGAGATGTCTGGACGCATCTCTTGCTCGACACCACCAGC
TTTACCTTGGTTCGAGACAGTCGACTCACGGTGAAGCTGGCAGACCAGACCAACAGCGAAAAGTTTAATGGTCAA
GCCACGATACAAATTTTCCTTGCAACCAATGATCAAATTCTCGTCATTGACGAATCCATCGAGAACCATTGGGTC
AGCACATATACTGGGTGCGAGAGACTCCCACAGAGGTCTATTCCCTCGAGATCTGGTCTGCTCTCTCTGGCTCCT
AGACCCAACAACGACAGAGCTAGCCCGTTTCACGATGGCCCAGTCACTCGCTCAAGGACTCTGAAGAAGCGCCTC
GGCCAGAACTCGGGCGCTGTAGGCTTGCATAACCTGGGAAATACTTGTTATATGAATTCTGCCCTGCAATGCGTC
CGCAGTGTAGAGGAGCTCACCAAGTATTTTCTTTCCGAGTCCTACCTTGCAGAGATCAATGAGACAAATGTGCTT
GGTTACGAAGGCCGGGTAGCAAGCGCCTATGGGAGTCTTTTGGCCGAGATTTATGAGCAAGGCAAAAGCTCAGTG
AGTCCACGCGATTTCAAATCAACAGTCGGCCGCTGTCGTCCTACCTTTTCCGGCTGGGGCCAACAAGACACGCAA
GAGTTTCTCGGTTTCCTCTTGGACGCTCTCCAAGAAGATCTCAGCCGTATCAAGAAGAAACCCTACATTGAAAAG
CCCGACTCTACCGACGACATGATTAATAACCCGGATGCCATTCGCAAGATGGCGGATCAAGTCTGGGATATCACC
CGCAGACGGGACGACTCCGTCATTGCTGACCTCTTTACCGGCATGTACAAGTCGACGTTGAAGTGTCCCGAGTGT
GGCAAGATCAGCATCACGTTTGATCCCTTCAACAATTTGACCCTGCCCATACCCACAGACAATACATGGGCTGGC
AAAGTCAAGTTTTTCCCACTCAATGATTCGCCCGTCAAGATTGAAGTAGAATTGTCAAAACACAGCTCTGTCAAA
ATGTTGAAGCAATTCGTTTCGGATCGTACTGGCGTTCCAGTCGAGCGACTAATGAGCGCCGAGGAATACAAGGAT
CGCTTCTTCAAGATTTACGATGACACTGGCGATGTCTCGGAGATTTCAGACTCGGACATTGCCACTATTCACGAG
CTGGATGCTGTCCCGACAAACTGGCCCGGTAAAGCCACTCGCGCCAGATATCGGACCTTGCTCGACGTTGATGCG
TCATATGATGCTTCAGACTCGGATGATGAACAATGCCAAACAATGGTGGTGTCTGTCATTCATCGCCGGCCCAAG
GCACTTGATCGAGACCCCGAGGGCCTTCCGCCCCCTCATTTCATCACACTAAACAAGAAGGAAGCCCGAAGCTAT
GACATGATTCAACGCAAGATTCTAGAAAAAATTGCTACTTTTACAACATGGAGCAAATTGTCAAACGCATCACGA
GGTGACGATCAGTCAGATGACTTCAAGGTTGCCGCTCAGTCTGTCGAGGGCGAAGAGGACATGGTTGATGTGACC
ATGAAGGATGCAAACGGAATGCATTCACTGATTATCAAGCACTTTAATAAACAACGGCCAAAGTTTCTAGATTCG
ATGGCCTTTTTAGATCCCGACTTACAGAATCTCTTCGAGCTGGGATATTTCAGGGGCAACTCGGATGGCCCGGTT
CCTACAGGCTGGTCTGGCGTTGATAACACTAGACAAGTGCCCCGGTTGACAGACCGCCTTCCTGATGAGGAACGA
GGGAGTCCCGAAAGCTTTGAGAGTTTTGAGTCTGGAAATGACGACAGCAGTAATGATGGTACCGGGCCTGATGCG
TCTCAGACACGCATGGCGGAGGAGTCGAGCGATGAAGATGCTATGCCCGCAGCACGGCTTTCCAGTCGCCCAGGT
CGTCCGCATCATAGATTTGGGGGTGGTCGGAAAAAGTTCAAGGGGCACAAGACATACGGCAAAAAGGGCAACAAG
CGACGAGACAAGCAAATGCGCTCTGGGAAGCAGGCGCAGCGGGCACCTGGTGTAGCACCACAGCCAATGCCTGTG
TCGGTGGCTGACGGGGGACCGCTGGTCCGCCTTCATGAGGGAATTGTGGTTGACTGGAGTGAAGCTGCGTGGGAA
ACATTGTTTGGTAGCCCGGTGAGACGCCAGGGTACCATTGAAGGGGTGCGGACATTTGCGGAACCGGAAACGCTG
TGTGAACCGGCCATCAAGCTTTTACGCAAGAGGCGGGACGCGCGCAAGTCGCGTGGTCTTACTCTTGAGGAATGT
CTTGACGAATTCGAGCGGGCAGAGATTCTATCAGAGCAGGACATGTGGTATTGCCCTCGCTGCAAGGAACACCGG
CGTGCCAGCAAAAAGTTTGATTTGTGGAAGACGCCAGACATTCTCGTGGCGCATTTGAAGAGGTTCAGCAATTCG
GGGTGGCGACGAGAAAAGCTGGACACATTTGTCGACTTTCCAGTCGAGAACCTCGATCTCACCTCGAGAGTTGTT
CAAAAGGAAGACGGCAAGAACGAGATTTACGACTTGATTGCCGTTGATGACCATTACGGCGGACTCGGTGGAGGC
CATTACACAGCCTACGCCAAAAACTTTATGGATGGACGCTGGTACAGCTTTAACGATTCATCAGTACATGCCGTT
TCGGATGCAGGGTCGGTGGTGACTAGCGCCGCCTATCTGCTCTTCTATCGCCGGCGTTCCAGTGGTCCCTTGGGT
GGGCCTCGCTTCGTGGATTTGATGAACAAGTACGAAAGAGAGGCTTGTAGGTCTGATGACGACACAATTACGGTC
GGGTCGAGCGATGATAGCAACATGGCGGCGTTTGGGAAAAGTCCAGCGTCAGGAGACGACGAAGACGATGAGGAA
ACCTTGCCGTCGTACAAGGAATCCATCCGTCGCAGCATTGAAACAGATCAAGGCGCACCTATAAAGTCTTTGAAT
ATGACTCAAGGCTGGAATTTTGATGGGCTCGACGAGGGTGGCAAACGCAATGGCGACGAGACAGTTTCCGGATTT
TCAGGCCACGACGGCAGCGATGGAGACGGTGTACAGGAGGATGCCAGTGCGACAAAGATTGGAGATGGCAGCAAG
TGGCATGGCCACCAAGTCATGTCGGTGCCTGCACAGACGGGCAGCCATGGTGACTCGGAGGTGGCCGAAATCCAT
TTGGACGGCGATAAGAGAAACCGCGTCGAATGA
Gene >OphauB2|4366
ATGAATGGTGATGACGAGCTGCCTCGCCGATCGTCTTCGCCTCTGAAACGCCGGGCATCAAGTATGGACCCCGAG
ATTGACTCGAGCCATGGCGCTGCCGAGACGGACGGGCCCATGCCCTCTGCATCGCATGACGCGTCTCCCCCATTG
CATGGCCTGCCTCGAGCCATGAGCATAGATACTCCAGAGGCAGACTCTCATGACGCGTCGCCCGTCAGCACGGCG
GCTCACGGTACGTTTCATGTTCCTACATGGCGTAACAAGCACAGTGTTACTTACAAGCTCTCTCAGCAGCTAAGC
CGCCGCTGCTCGAACAGGTCAAGACGATTGAGATGCTGCTCAAGGCGTTTGCAGAGAGCCCCTTGGAGGAGGGTG
TAGTGGCTTACCTGGTATCGCGGTCGTGGGTAGACAAGGCCCTTGCCTTGGGTTCGCAGTCGAAAGCCCCAAAGG
ATCTTGCTGCCGACGTCTCGCTGGGTCCTGTCGACAATTCAGACATCATCGACCAAGTCATTCAAGACTCGAGTG
GTCTGGAATTTGTTTGTCTGAAGCCGGGCTCCAGCCTTGAATCCTTTGAACTGTTTTCAGAAGATGCGTGGAAGC
TGGTGATGGACTGGTACGGCCTGCAGCAAGGCCAAATCCCCATTGTTCGCCGCGCAGTCAATACCGCCGAGAGCA
AAACCTCTCTCCCAAACATCATGTACGAATTCCATCCACCAGTGTTTCGCATCTATCGCCTGTGGTCTAGTGTTA
GCCCTCTGCCTATTGAGCAATCTCTCAAGGCTCGAAACCCCCCTCCGCTCGTCCTCGTTCGAAGCTCGGCTTCTC
ATGCTCAAACTTTTCTTAAGGAGCTCAAAACTTTTGCCGGTGTTCCCATGGATCGCAAAGTCCGCCTCTTCTCCC
TCCCCATAGACCTGCATGTCCCCGAAAACTCTGCACAATCAGCTTCAGCTCTCACTCCGCCTGACTCTCCCAAGA
CGGAAGGGCCCGAGCTCGTCCGAGATGTCTGGACGCATCTCTTGCTCGACACCACCAGCTTTACCTTGGTTCGAG
ACAGTCGACTCACGGTGAAGCTGGCAGACCAGACCAACAGCGAAAAGTTTAATGGTCAAGCCACGATACAAATTT
TCCTTGCAACCAATGATCAAATTCTCGTCATTGACGAATCCATCGAGAACCATTGGGTCAGCACATATACTGGGT
GCGAGAGACTCCCACAGAGGTCTATTCCCTCGAGATCTGGTCTGCTCTCTCTGGCTCCTAGACCCAACAACGACA
GAGCTAGCCCGTTTCACGATGGCCCAGTCACTCGCTCAAGGACTCTGAAGAAGCGCCTCGGCCAGAACTCGGGCG
CTGTAGGCTTGCATAACCTGGGAAATACTTGTTATATGAATTCTGCCCTGCAATGCGTCCGCAGTGTAGAGGAGC
TCACCAAGTATTTTCTTTCCGAGTCCTACCTTGCAGAGATCAATGAGACAAATGTGCTTGGTTACGAAGGCCGGG
TAGCAAGCGCCTATGGGAGTCTTTTGGCCGAGATTTATGAGCAAGGCAAAAGCTCAGTGAGTCCACGCGATTTCA
AATCAACAGTCGGCCGCTGTCGTCCTACCTTTTCCGGCTGGGGCCAACAAGACACGCAAGAGTTTCTCGGTTTCC
TCTTGGACGCTCTCCAAGAAGATCTCAGCCGTATCAAGAAGAAACCCTACATTGAAAAGCCCGACTCTACCGACG
ACATGATTAATAACCCGGATGCCATTCGCAAGATGGCGGATCAAGTCTGGGATATCACCCGCAGACGGGACGACT
CCGTCATTGCTGACCTCTTTACCGGCATGTACAAGTCGACGTTGAAGTGTCCCGAGTGTGGCAAGATCAGCATCA
CGTTTGATCCCTTCAACAATTTGACCCTGCCCATACCCACAGACAATACATGGGCTGGCAAAGTCAAGTTTTTCC
CACTCAATGATTCGCCCGTCAAGATTGAAGTAGAATTGTCAAAACACAGCTCTGTCAAAATGTTGAAGCAATTCG
TTTCGGATCGTACTGGCGTTCCAGTCGAGCGACTAATGAGCGCCGAGGAATACAAGGATCGCTTCTTCAAGATTT
ACGATGACACTGGCGATGTCTCGGAGATTTCAGACTCGGACATTGCCACTATTCACGAGCTGGATGCTGTCCCGA
CAAACTGGCCCGGTAAAGCCACTCGCGCCAGATATCGGACCTTGCTCGACGTTGATGCGTCATATGATGCTTCAG
ACTCGGATGATGAACAATGCCAAACAATGGTGGTGTCTGTCATTCATCGCCGGCCCAAGGCACTTGATCGAGACC
CCGAGGGCCTTCCGCCCCCTCATTTCATCACACTAAACAAGAAGGAAGCCCGAAGCTATGACATGATTCAACGCA
AGATTCTAGAAAAAATTGCTACTTTTACAACATGGAGCAAATTGTCAAACGCATCACGAGGTGACGATCAGTCAG
ATGGTACGGATGCAGATATGGTCATCACGACTGCTTCCGATGCTGACTCGTCTGGAGACTTCAAGGTTGCCGCTC
AGTCTGTCGAGGGCGAAGAGGACATGGTTGATGTGACCATGAAGGATGCAAACGGAATGCATTCACTGATTATCA
AGCACTTTAATAAACAACGGCCAAAGTTTCTAGATTCGATGGCCTTTTTAGATCCCGACTTACAGAATCTCTTCG
AGCTGGGATATTTCAGGGGCAACTCGGATGGCCCGGTTCCTACAGGCTGGTCTGGCGTTGATAACACTAGACAAG
TGCCCCGGTTGACAGACCGCCTTCCTGATGAGGAACGAGGGAGTCCCGAAAGCTTTGAGAGTTTTGAGTCTGGAA
ATGACGACAGCAGTAATGATGGTACCGGGCCTGATGCGTCTCAGACACGCATGGCGGAGGAGTCGAGCGATGAAG
ATGCTATGCCCGCAGCACGGGTAAGTTGAGACGAGTCATGTTGAATCTTCCAGCCGCCCTTTCTGATGAAGTTTT
AGCTTTCCAGTCGCCCAGGTCGTCCGCATCATAGATTTGGGGGTGGTCGGAAAAAGTTCAAGGGGCACAAGACAT
ACGGCAAAAAGGGCAACAAGCGACGAGACAAGCAAATGCGCTCTGGGAAGCAGGCGCAGCGGGCACCTGGTGTAG
CACCACAGCCAATGCCTGTGTCGGTGGCTGACGGGGGACCGCTGGTCCGCCTTCATGAGGGAATTGTGGTTGACT
GGAGTGAAGCTGCGTGGGAAACATTGTTTGGTAGCCCGGTGAGACGCCAGGGTACCATTGAAGGGGTGCGGACAT
TTGCGGAACCGGAAACGCTGTGTGAACCGGCCATCAAGCTTTTACGCAAGAGGCGGGACGCGCGCAAGTCGCGTG
GTCTTACTCTTGAGGAATGTCTTGACGAATTCGAGCGGGCAGAGATTCTATCAGAGCAGGACATGTGGTATTGCC
CTCGCTGCAAGGAACACCGGCGTGCCAGCAAAAAGTTTGATTTGTGGAAGACGCCAGACATTCTCGTGGCGCATT
TGAAGAGGTTCAGCAATTCGGGGTGGCGACGAGAAAAGCTGGACACATTTGTCGACTTTCCAGTCGAGAACCTCG
ATCTCACCTCGAGAGTTGTTCAAAAGGAAGACGGCAAGAACGAGATTTACGACTTGATTGCCGTTGATGACCATT
ACGGCGGACTCGGTGGAGGCCATTACACAGCCTACGCCAAAAACTTTATGGATGGACGCTGGTACAGCTTTAACG
GTTTGTTCAACTTTTTTTTTACCTTGTCAAGACAGTCTTGGCTGACTTTGAGGGCAGATTCATCAGTACATGCCG
TTTCGGATGCAGGGTCGGTGGTGACTAGCGCCGCCTATCTGCTCTTCTATCGCCGGCGTTCCAGTGGTCCCTTGG
GTGGGCCTCGCTTCGTGGATTTGATGAACAAGTACGAAAGAGAGGCTTGTAGGTCTGATGACGACACAATTACGG
TCGGGTCGAGCGATGATAGCAACATGGCGGCGTTTGGGAAAAGTCCAGCGTCAGGAGACGACGAAGACGATGAGG
AAACCTTGCCGTCGTACAAGGAATCCATCCGTCGCAGCATTGAAACAGATCAAGGCGCACCTATAAAGTCTTTGA
ATATGACTCAAGGCTGGAATTTTGATGGGCTCGACGAGGGTGGCAAACGCAATGGCGACGAGACAGTTTCCGGAT
TTTCAGGCCACGACGGCAGCGATGGAGACGGTGTACAGGAGGATGCCAGTGCGACAAAGATTGGAGATGGCAGCA
AGTGGCATGGCCACCAAGTCATGTCGGTGCCTGCACAGACGGGCAGCCATGGTGACTCGGAGGTGGCCGAAATCC
ATTTGGACGGCGATAAGAGAAACCGCGTCGAATGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail