Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|4345
Gene name
LocationContig_29:152142..152946
Strand+
Gene length (bp)804
Transcript length (bp)681
Coding sequence length (bp)681
Protein length (aa) 227

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF10342 Kre9_KNH Kre9/KNH-like N-terminal Ig-like domain 5.7E-09 29 103

Swissprot hits

(None)

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

SignalP signal predicted Location Score
Yes 1 - 17 0.999771

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup854
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6674
Ophiocordyceps australis map64 (Brazil) OphauB2|4345 (this protein)
Ophiocordyceps camponoti-floridani Ophcf2|00309
Ophiocordyceps camponoti-rufipedis Ophun1|1838
Ophiocordyceps camponoti-rufipedis Ophun1|2514
Ophiocordyceps kimflemingae Ophio5|1373
Ophiocordyceps subramaniannii Hirsu2|4665

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|4345
MKYSLVTLSALAAFAVAEQPKFLNTEFNVKEGQDFPLKFSGCASTCTISLRKGPSNNLETVQSLTTSASGGVFNF
SPKGLPSDTYAFEIKDNASGEVNYSVQFPYQGTGAVVSSAVSSAAMTASPTTASATKMPASSSLVSSAAMTSVAT
SAPVMSVKPVATSMVHRNTTMATSSARTSAALTSGMSTSTAPRPTGPATQVPTSDVGRLSAPLALAVGLVAAAFF
G*
Coding >OphauB2|4345
ATGAAGTACTCACTCGTCACTTTGTCGGCTCTCGCCGCCTTTGCCGTTGCTGAGCAGCCCAAGTTCCTCAATACG
GAATTCAACGTCAAGGAGGGCCAGGATTTCCCCCTCAAGTTCAGCGGCTGCGCCAGTACCTGCACTATTTCGCTG
CGCAAGGGCCCGAGCAACAACCTCGAGACTGTTCAGTCTCTGACGACCTCTGCCTCTGGCGGCGTCTTCAACTTT
TCGCCCAAGGGACTCCCATCCGACACGTATGCCTTTGAGATCAAGGACAATGCCTCTGGCGAGGTCAACTACAGT
GTCCAGTTCCCCTACCAGGGCACAGGCGCAGTCGTTTCGTCTGCTGTCTCTTCTGCTGCCATGACTGCGTCTCCC
ACGACTGCGTCTGCCACGAAGATGCCTGCCAGCTCGAGCCTAGTCTCGTCTGCCGCCATGACTTCTGTGGCCACG
TCTGCTCCCGTCATGTCTGTCAAGCCTGTTGCCACGTCTATGGTGCACCGCAACACGACCATGGCTACTAGCAGT
GCCCGCACCTCTGCCGCTCTCACGTCGGGCATGTCGACGTCTACTGCTCCCCGCCCGACTGGCCCTGCCACTCAG
GTCCCCACCAGCGACGTTGGCCGTCTGTCTGCGCCTCTTGCCCTTGCCGTTGGCCTTGTTGCCGCGGCTTTTTTC
GGTTAG
Transcript >OphauB2|4345
ATGAAGTACTCACTCGTCACTTTGTCGGCTCTCGCCGCCTTTGCCGTTGCTGAGCAGCCCAAGTTCCTCAATACG
GAATTCAACGTCAAGGAGGGCCAGGATTTCCCCCTCAAGTTCAGCGGCTGCGCCAGTACCTGCACTATTTCGCTG
CGCAAGGGCCCGAGCAACAACCTCGAGACTGTTCAGTCTCTGACGACCTCTGCCTCTGGCGGCGTCTTCAACTTT
TCGCCCAAGGGACTCCCATCCGACACGTATGCCTTTGAGATCAAGGACAATGCCTCTGGCGAGGTCAACTACAGT
GTCCAGTTCCCCTACCAGGGCACAGGCGCAGTCGTTTCGTCTGCTGTCTCTTCTGCTGCCATGACTGCGTCTCCC
ACGACTGCGTCTGCCACGAAGATGCCTGCCAGCTCGAGCCTAGTCTCGTCTGCCGCCATGACTTCTGTGGCCACG
TCTGCTCCCGTCATGTCTGTCAAGCCTGTTGCCACGTCTATGGTGCACCGCAACACGACCATGGCTACTAGCAGT
GCCCGCACCTCTGCCGCTCTCACGTCGGGCATGTCGACGTCTACTGCTCCCCGCCCGACTGGCCCTGCCACTCAG
GTCCCCACCAGCGACGTTGGCCGTCTGTCTGCGCCTCTTGCCCTTGCCGTTGGCCTTGTTGCCGCGGCTTTTTTC
GGTTAG
Gene >OphauB2|4345
ATGAAGTACTCACTCGTCACTTTGTCGGCTCTCGCCGCCTTTGCCGTTGCTGAGCAGCCCAAGTTCCTCAATACG
GAATTCAACGTCAAGGAGGGCCAGGATTTCCCCCTCAAGTTCAGCGGCTGCGCCAGTACCTGCACTATTTCGCTG
CGCAAGGGCCCGAGCAACAACCTCGAGACTGTTCAGTCTCTGACGAGTACGTGACCATTTCCAACCAACAGCCTC
GAGGGGGCAAATTGAGACTGACATTGGCCAACAGCCTCTGCCTCTGGCGGCGTCTTCAACTTTTCGCCCAAGGGA
CTCCCATCCGACACGTATGCCTTTGAGATCAAGGACAATGCCTCTGGCGAGGTCAACTACAGTGTCCAGTTCCCC
TACCAGGGCACAGGCGCAGTCGTTTCGTCTGCTGTCTCTTCTGCTGCCATGACTGCGTCTCCCACGACTGCGTCT
GCCACGAAGATGCCTGCCAGCTCGAGCCTAGTCTCGTCTGCCGCCATGACTTCTGTGGCCACGTCTGCTCCCGTC
ATGTCTGTCAAGCCTGTTGCCACGTCTATGGTGCACCGCAACACGACCATGGCTACTAGCAGTGCCCGTGAGTTT
TGCAAGGCGTCTGAAGTGGGTTGACTTGTGTGCTGATTGTGGTTGTTTATAGGCACCTCTGCCGCTCTCACGTCG
GGCATGTCGACGTCTACTGCTCCCCGCCCGACTGGCCCTGCCACTCAGGTCCCCACCAGCGACGTTGGCCGTCTG
TCTGCGCCTCTTGCCCTTGCCGTTGGCCTTGTTGCCGCGGCTTTTTTCGGTTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail