Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|4329
Gene name
LocationContig_29:110519..112447
Strand+
Gene length (bp)1928
Transcript length (bp)1734
Coding sequence length (bp)1734
Protein length (aa) 578

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF14671 DSPn Dual specificity protein phosphatase, N-terminal half 2.4E-41 16 168
PF00782 DSPc Dual specificity phosphatase, catalytic domain 2.7E-15 255 362
PF00102 Y_phosphatase Protein-tyrosine phosphatase 3.8E-06 292 359

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q5B323|CDC14_EMENI Tyrosine-protein phosphatase cdcA OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=cdcA PE=3 SV=1 15 560 0.0E+00
sp|Q00684|CDC14_YEAST Tyrosine-protein phosphatase CDC14 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CDC14 PE=1 SV=2 11 555 3.0E-141
sp|Q9P7H1|FLP1_SCHPO Tyrosine-protein phosphatase CDC14 homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=clp1 PE=1 SV=1 11 513 3.0E-138
sp|Q59NH8|CDC14_CANAL Tyrosine-protein phosphatase CDC14 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CDC14 PE=1 SV=1 67 444 2.0E-115
sp|Q9UNH5|CC14A_HUMAN Dual specificity protein phosphatase CDC14A OS=Homo sapiens GN=CDC14A PE=1 SV=1 16 380 4.0E-73
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q5B323|CDC14_EMENI Tyrosine-protein phosphatase cdcA OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=cdcA PE=3 SV=1 15 560 0.0E+00
sp|Q00684|CDC14_YEAST Tyrosine-protein phosphatase CDC14 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CDC14 PE=1 SV=2 11 555 3.0E-141
sp|Q9P7H1|FLP1_SCHPO Tyrosine-protein phosphatase CDC14 homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=clp1 PE=1 SV=1 11 513 3.0E-138
sp|Q59NH8|CDC14_CANAL Tyrosine-protein phosphatase CDC14 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CDC14 PE=1 SV=1 67 444 2.0E-115
sp|Q9UNH5|CC14A_HUMAN Dual specificity protein phosphatase CDC14A OS=Homo sapiens GN=CDC14A PE=1 SV=1 16 380 4.0E-73
sp|Q6GQT0|CC14A_MOUSE Dual specificity protein phosphatase CDC14A OS=Mus musculus GN=Cdc14a PE=2 SV=2 16 380 9.0E-73
sp|Q6PFY9|CC14B_MOUSE Dual specificity protein phosphatase CDC14B OS=Mus musculus GN=Cdc14b PE=2 SV=1 52 396 2.0E-62
sp|A4D256|CC14C_HUMAN Dual specificity protein phosphatase CDC14C OS=Homo sapiens GN=CDC14C PE=2 SV=2 52 460 4.0E-62
sp|O60729|CC14B_HUMAN Dual specificity protein phosphatase CDC14B OS=Homo sapiens GN=CDC14B PE=1 SV=1 18 375 7.0E-62
sp|A6N3Q4|CC14C_SYMSY Dual specificity protein phosphatase CDC14C OS=Symphalangus syndactylus GN=CDC14C PE=3 SV=1 18 375 1.0E-61
sp|P81299|CDC14_CAEEL Probable tyrosine-protein phosphatase cdc-14 OS=Caenorhabditis elegans GN=cdc-14 PE=1 SV=2 16 366 6.0E-59
sp|A1L1R5|PTPC1_DANRE Protein tyrosine phosphatase domain-containing protein 1 OS=Danio rerio GN=ptpdc1 PE=2 SV=1 196 354 2.0E-10
sp|A7E379|PTPC1_BOVIN Protein tyrosine phosphatase domain-containing protein 1 OS=Bos taurus GN=PTPDC1 PE=2 SV=2 196 354 7.0E-10
sp|A2A3K4|PTPC1_HUMAN Protein tyrosine phosphatase domain-containing protein 1 OS=Homo sapiens GN=PTPDC1 PE=2 SV=1 196 354 2.0E-09
sp|Q6NZK8|PTPC1_MOUSE Protein tyrosine phosphatase domain-containing protein 1 OS=Mus musculus GN=Ptpdc1 PE=1 SV=1 196 354 4.0E-09
sp|Q6NT99|DUS23_MOUSE Dual specificity protein phosphatase 23 OS=Mus musculus GN=Dusp23 PE=1 SV=1 226 354 5.0E-09
sp|Q9BVJ7|DUS23_HUMAN Dual specificity protein phosphatase 23 OS=Homo sapiens GN=DUSP23 PE=1 SV=1 226 354 3.0E-07
sp|Q54DU9|TP4AA_DICDI Probable protein tyrosine phosphatase type IVA A OS=Dictyostelium discoideum GN=DDB_G0292024 PE=3 SV=1 247 362 1.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0008138 protein tyrosine/serine/threonine phosphatase activity Yes
GO:0016311 dephosphorylation Yes
GO:0004725 protein tyrosine phosphatase activity Yes
GO:0006470 protein dephosphorylation Yes
GO:0003824 catalytic activity No
GO:0043170 macromolecule metabolic process No
GO:0008150 biological_process No
GO:0016787 hydrolase activity No
GO:0003674 molecular_function No
GO:0006793 phosphorus metabolic process No
GO:0140096 catalytic activity, acting on a protein No
GO:0006796 phosphate-containing compound metabolic process No
GO:0042578 phosphoric ester hydrolase activity No
GO:0036211 protein modification process No
GO:0006807 nitrogen compound metabolic process No
GO:0071704 organic substance metabolic process No
GO:0044237 cellular metabolic process No
GO:0043412 macromolecule modification No
GO:0008152 metabolic process No
GO:0009987 cellular process No
GO:0044238 primary metabolic process No
GO:0016791 phosphatase activity No
GO:0019538 protein metabolic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0004721 phosphoprotein phosphatase activity No
GO:0016788 hydrolase activity, acting on ester bonds No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup2788
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|185
Ophiocordyceps australis map64 (Brazil) OphauB2|4329 (this protein)
Ophiocordyceps camponoti-floridani Ophcf2|00293
Ophiocordyceps camponoti-rufipedis Ophun1|7582
Ophiocordyceps kimflemingae Ophio5|7862
Ophiocordyceps subramaniannii Hirsu2|4467

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|4329
MARPSKASHNMTHYIEYIPDRLYLAAYVQPPLEADGANKSAKAYSASAAPCYFSVDEWLLYNAFHHDFGPMHIGH
LYRFAIRFHELLGAEENKERRVVFWSGADAKSRANAACLLACYMVLIQNWPPHLALAPIAQVNPPLMPFRDAGYS
QADYGISVQDVVYGVWKAKEEKCCDLDKFDLEMYERYERVENGDFNWITPHFVAFASPQLSPVEKVAEGSPQHQA
LPRSVAAVAAHPQLPSPFKHVLGHFAQQKIGLVVRLNSPLYSPSFFEALGMSHLDMIFDDGTCPSLATVRKFIRL
AHDTITVKKKAIAVHCKAGLGRTGCLIGAYLIYRHAFTANEIIAYMRFMRPGMVVGPQQHWLHMNQAVFREWWVE
ERVERRLRRHLAAPATPVRSKLPAHHNCQTATPPQNRSPSTRTPLGQVHDNSAPQDDCLPAPTPGQPRKTSRRHP
YTRTTTKTSDKPSDASSSDEQVALYTAQSHTRVETSTSSSSPVASTAAVFVLEQDASHDVENINSLRVKHDRSVV
LTKVRRRAADSPHRSRDAVAAGVRKTSGRVGSLGSMACSAAAVSTARKVSGS*
Coding >OphauB2|4329
ATGGCTCGACCGAGCAAGGCTTCGCACAACATGACGCACTATATCGAGTATATACCTGATCGGCTGTACCTCGCT
GCGTATGTGCAGCCGCCGCTAGAGGCTGATGGGGCGAACAAGAGTGCAAAGGCGTACTCGGCGAGCGCGGCGCCG
TGCTACTTTAGTGTGGACGAGTGGCTGCTGTATAATGCCTTTCACCACGACTTTGGGCCGATGCATATTGGGCAT
TTGTACCGGTTTGCCATTCGCTTCCATGAGCTGCTGGGGGCAGAGGAGAATAAGGAGCGGCGGGTGGTGTTTTGG
AGCGGCGCCGACGCAAAGAGCCGCGCCAATGCAGCCTGTCTGCTGGCCTGCTACATGGTGCTGATTCAAAACTGG
CCGCCGCACCTGGCCCTGGCGCCCATTGCGCAAGTGAACCCGCCGCTGATGCCGTTTCGCGACGCGGGCTACAGC
CAGGCCGACTATGGCATCAGCGTGCAAGACGTGGTGTACGGGGTGTGGAAGGCCAAGGAGGAAAAGTGCTGCGAC
CTGGACAAGTTTGACCTGGAAATGTACGAGCGGTACGAGCGCGTGGAAAACGGCGACTTCAACTGGATAACGCCG
CACTTTGTCGCCTTTGCCTCGCCGCAGCTGAGTCCGGTGGAAAAGGTGGCCGAGGGCTCGCCGCAGCATCAAGCC
CTGCCTCGCAGTGTGGCAGCCGTGGCGGCGCATCCTCAGCTGCCCTCGCCCTTTAAACACGTCTTGGGCCACTTT
GCCCAGCAAAAGATTGGCCTCGTGGTGCGTCTCAACTCGCCCCTCTACTCGCCCTCCTTCTTTGAGGCGCTCGGC
ATGTCCCACCTCGACATGATATTCGACGACGGCACCTGTCCCTCTCTCGCCACGGTGCGCAAATTCATCCGCCTC
GCCCACGACACCATTACCGTCAAGAAAAAGGCCATTGCCGTCCACTGCAAGGCTGGCCTCGGCCGCACCGGCTGT
CTGATTGGCGCTTACCTCATTTACCGCCACGCCTTTACCGCAAACGAAATCATTGCCTATATGCGCTTCATGCGC
CCCGGCATGGTGGTGGGACCCCAGCAGCACTGGCTGCACATGAACCAGGCCGTCTTTCGCGAGTGGTGGGTTGAG
GAGCGTGTCGAGCGCCGTCTGCGCCGCCACTTGGCCGCTCCCGCCACGCCTGTTCGCTCCAAGCTGCCCGCCCAC
CACAACTGCCAGACTGCCACGCCGCCCCAAAACCGCAGCCCCTCGACCCGCACGCCTCTTGGCCAGGTCCACGAC
AACTCGGCGCCCCAAGACGACTGTCTGCCCGCCCCCACGCCCGGCCAGCCCCGGAAAACTAGTCGCCGCCATCCC
TATACCCGCACCACCACCAAGACGTCTGACAAGCCCTCTGATGCTTCCAGCTCAGACGAACAAGTCGCCCTCTAC
ACCGCCCAGTCCCACACACGCGTCGAAACCTCCACCTCCTCCTCGTCTCCTGTTGCCTCCACCGCTGCAGTCTTT
GTCCTTGAGCAAGACGCCTCCCACGACGTGGAGAATATAAACTCCCTCCGCGTCAAACACGACCGCTCCGTCGTG
CTCACCAAGGTGCGCAGACGCGCCGCCGACTCGCCCCATCGCTCTAGAGACGCCGTCGCCGCTGGTGTCCGCAAA
ACTAGCGGCCGCGTCGGCAGCCTCGGCTCCATGGCTTGCTCTGCCGCTGCCGTGTCGACGGCCCGCAAGGTTTCA
GGATCATAG
Transcript >OphauB2|4329
ATGGCTCGACCGAGCAAGGCTTCGCACAACATGACGCACTATATCGAGTATATACCTGATCGGCTGTACCTCGCT
GCGTATGTGCAGCCGCCGCTAGAGGCTGATGGGGCGAACAAGAGTGCAAAGGCGTACTCGGCGAGCGCGGCGCCG
TGCTACTTTAGTGTGGACGAGTGGCTGCTGTATAATGCCTTTCACCACGACTTTGGGCCGATGCATATTGGGCAT
TTGTACCGGTTTGCCATTCGCTTCCATGAGCTGCTGGGGGCAGAGGAGAATAAGGAGCGGCGGGTGGTGTTTTGG
AGCGGCGCCGACGCAAAGAGCCGCGCCAATGCAGCCTGTCTGCTGGCCTGCTACATGGTGCTGATTCAAAACTGG
CCGCCGCACCTGGCCCTGGCGCCCATTGCGCAAGTGAACCCGCCGCTGATGCCGTTTCGCGACGCGGGCTACAGC
CAGGCCGACTATGGCATCAGCGTGCAAGACGTGGTGTACGGGGTGTGGAAGGCCAAGGAGGAAAAGTGCTGCGAC
CTGGACAAGTTTGACCTGGAAATGTACGAGCGGTACGAGCGCGTGGAAAACGGCGACTTCAACTGGATAACGCCG
CACTTTGTCGCCTTTGCCTCGCCGCAGCTGAGTCCGGTGGAAAAGGTGGCCGAGGGCTCGCCGCAGCATCAAGCC
CTGCCTCGCAGTGTGGCAGCCGTGGCGGCGCATCCTCAGCTGCCCTCGCCCTTTAAACACGTCTTGGGCCACTTT
GCCCAGCAAAAGATTGGCCTCGTGGTGCGTCTCAACTCGCCCCTCTACTCGCCCTCCTTCTTTGAGGCGCTCGGC
ATGTCCCACCTCGACATGATATTCGACGACGGCACCTGTCCCTCTCTCGCCACGGTGCGCAAATTCATCCGCCTC
GCCCACGACACCATTACCGTCAAGAAAAAGGCCATTGCCGTCCACTGCAAGGCTGGCCTCGGCCGCACCGGCTGT
CTGATTGGCGCTTACCTCATTTACCGCCACGCCTTTACCGCAAACGAAATCATTGCCTATATGCGCTTCATGCGC
CCCGGCATGGTGGTGGGACCCCAGCAGCACTGGCTGCACATGAACCAGGCCGTCTTTCGCGAGTGGTGGGTTGAG
GAGCGTGTCGAGCGCCGTCTGCGCCGCCACTTGGCCGCTCCCGCCACGCCTGTTCGCTCCAAGCTGCCCGCCCAC
CACAACTGCCAGACTGCCACGCCGCCCCAAAACCGCAGCCCCTCGACCCGCACGCCTCTTGGCCAGGTCCACGAC
AACTCGGCGCCCCAAGACGACTGTCTGCCCGCCCCCACGCCCGGCCAGCCCCGGAAAACTAGTCGCCGCCATCCC
TATACCCGCACCACCACCAAGACGTCTGACAAGCCCTCTGATGCTTCCAGCTCAGACGAACAAGTCGCCCTCTAC
ACCGCCCAGTCCCACACACGCGTCGAAACCTCCACCTCCTCCTCGTCTCCTGTTGCCTCCACCGCTGCAGTCTTT
GTCCTTGAGCAAGACGCCTCCCACGACGTGGAGAATATAAACTCCCTCCGCGTCAAACACGACCGCTCCGTCGTG
CTCACCAAGGTGCGCAGACGCGCCGCCGACTCGCCCCATCGCTCTAGAGACGCCGTCGCCGCTGGTGTCCGCAAA
ACTAGCGGCCGCGTCGGCAGCCTCGGCTCCATGGCTTGCTCTGCCGCTGCCGTGTCGACGGCCCGCAAGGTTTCA
GGATCATAG
Gene >OphauB2|4329
ATGGCTCGACCGAGCAAGGCTTCGCACAACATGACGCACTATATCGAGTATATACCTGGTGAGTCGAGAGTTGGG
GAAAAAAGGAGGGTTGAAGGAAAGGAAGAAGACAATGGGCTGGCTAACCATGAGGGCGCGCAGATCGGCTGTACC
TCGCTGCGTATGTGCAGCCGCCGCTAGAGGCTGATGGGGCGAACAAGAGTGCAAAGGCGTACTCGGCGAGCGCGG
CGCCGTGCTACTTTAGTGTGGACGAGTGGCTGCTGTATAATGCCTTTCACCACGACTTTGGGCCGATGCATATTG
GGCATTTGTACCGGTTTGCCATTCGCTTCCATGAGCTGCTGGGGGCAGAGGAGAATAAGGAGCGGCGGGTGGTGT
TTTGGAGCGGCGCCGACGCAAAGAGTAGGCCAGCCGTTTCTTGACACTTCTTTTTCCCTTACAACTTGTTTGACA
CGCTCATGTCTACAACCCCTCTGCTGCAAATGGCTAGACAATTCTAACGCTTGGTTTTTACAGGCCGCGCCAATG
CAGCCTGTCTGCTGGCCTGCTACATGGTGCTGATTCAAAACTGGCCGCCGCACCTGGCCCTGGCGCCCATTGCGC
AAGTGAACCCGCCGCTGATGCCGTTTCGCGACGCGGGCTACAGCCAGGCCGACTATGGCATCAGCGTGCAAGACG
TGGTGTACGGGGTGTGGAAGGCCAAGGAGGAAAAGTGCTGCGACCTGGACAAGTTTGACCTGGAAATGTACGAGC
GGTACGAGCGCGTGGAAAACGGCGACTTCAACTGGATAACGCCGCACTTTGTCGCCTTTGCCTCGCCGCAGCTGA
GTCCGGTGGAAAAGGTGGCCGAGGGCTCGCCGCAGCATCAAGCCCTGCCTCGCAGTGTGGCAGCCGTGGCGGCGC
ATCCTCAGCTGCCCTCGCCCTTTAAACACGTCTTGGGCCACTTTGCCCAGCAAAAGATTGGCCTCGTGGTGCGTC
TCAACTCGCCCCTCTACTCGCCCTCCTTCTTTGAGGCGCTCGGCATGTCCCACCTCGACATGATATTCGACGACG
GCACCTGTCCCTCTCTCGCCACGGTGCGCAAATTCATCCGCCTCGCCCACGACACCATTACCGTCAAGAAAAAGG
CCATTGCCGTCCACTGCAAGGCTGGCCTCGGCCGCACCGGCTGTCTGATTGGCGCTTACCTCATTTACCGCCACG
CCTTTACCGCAAACGAAATCATTGCCTATATGCGCTTCATGCGCCCCGGCATGGTGGTGGGACCCCAGCAGCACT
GGCTGCACATGAACCAGGCCGTCTTTCGCGAGTGGTGGGTTGAGGAGCGTGTCGAGCGCCGTCTGCGCCGCCACT
TGGCCGCTCCCGCCACGCCTGTTCGCTCCAAGCTGCCCGCCCACCACAACTGCCAGACTGCCACGCCGCCCCAAA
ACCGCAGCCCCTCGACCCGCACGCCTCTTGGCCAGGTCCACGACAACTCGGCGCCCCAAGACGACTGTCTGCCCG
CCCCCACGCCCGGCCAGCCCCGGAAAACTAGTCGCCGCCATCCCTATACCCGCACCACCACCAAGACGTCTGACA
AGCCCTCTGATGCTTCCAGCTCAGACGAACAAGTCGCCCTCTACACCGCCCAGTCCCACACACGCGTCGAAACCT
CCACCTCCTCCTCGTCTCCTGTTGCCTCCACCGCTGCAGTCTTTGTCCTTGAGCAAGACGCCTCCCACGACGTGG
AGAATATAAACTCCCTCCGCGTCAAACACGACCGCTCCGTCGTGCTCACCAAGGTGCGCAGACGCGCCGCCGACT
CGCCCCATCGCTCTAGAGACGCCGTCGCCGCTGGTGTCCGCAAAACTAGCGGCCGCGTCGGCAGCCTCGGCTCCA
TGGCTTGCTCTGCCGCTGCCGTGTCGACGGCCCGCAAGGTTTCAGGATCATAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail