Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|4324
Gene name
LocationContig_29:94275..97560
Strand-
Gene length (bp)3285
Transcript length (bp)3285
Coding sequence length (bp)3285
Protein length (aa) 1095

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04851 ResIII Type III restriction enzyme, res subunit 7.2E-21 174 327
PF00271 Helicase_C Helicase conserved C-terminal domain 1.6E-20 527 635
PF00270 DEAD DEAD/DEAH box helicase 1.6E-15 174 332

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|A4RN08|MPH1_MAGO7 ATP-dependent DNA helicase MPH1 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=MPH1 PE=3 SV=1 4 907 0.0E+00
sp|Q7SDF3|MPH1_NEUCR ATP-dependent DNA helicase mph1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=mph1 PE=3 SV=1 97 1003 0.0E+00
sp|Q2HG76|MPH1_CHAGB ATP-dependent DNA helicase MPH1 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=MPH1 PE=3 SV=1 10 862 0.0E+00
sp|A7EFH4|MPH1_SCLS1 ATP-dependent DNA helicase mph1 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=mph1 PE=3 SV=1 58 908 0.0E+00
sp|A6RIS1|MPH1_BOTFB ATP-dependent DNA helicase MPH1 OS=Botryotinia fuckeliana (strain B05.10) GN=mph1 PE=3 SV=2 58 862 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|A4RN08|MPH1_MAGO7 ATP-dependent DNA helicase MPH1 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=MPH1 PE=3 SV=1 4 907 0.0E+00
sp|Q7SDF3|MPH1_NEUCR ATP-dependent DNA helicase mph1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=mph1 PE=3 SV=1 97 1003 0.0E+00
sp|Q2HG76|MPH1_CHAGB ATP-dependent DNA helicase MPH1 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=MPH1 PE=3 SV=1 10 862 0.0E+00
sp|A7EFH4|MPH1_SCLS1 ATP-dependent DNA helicase mph1 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=mph1 PE=3 SV=1 58 908 0.0E+00
sp|A6RIS1|MPH1_BOTFB ATP-dependent DNA helicase MPH1 OS=Botryotinia fuckeliana (strain B05.10) GN=mph1 PE=3 SV=2 58 862 0.0E+00
sp|A1D4V5|MPH1_NEOFI ATP-dependent DNA helicase mph1 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=mph1 PE=3 SV=1 4 838 0.0E+00
sp|Q2URJ5|MPH1_ASPOR ATP-dependent DNA helicase mph1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=mph1 PE=3 SV=2 3 843 0.0E+00
sp|Q4WKB5|MPH1_ASPFU ATP-dependent DNA helicase mph1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=mph1 PE=3 SV=1 60 839 0.0E+00
sp|B0XMV6|MPH1_ASPFC ATP-dependent DNA helicase mph1 OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=mph1 PE=3 SV=1 60 839 0.0E+00
sp|Q0CWI2|MPH1_ASPTN ATP-dependent DNA helicase mph1 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=mph1 PE=3 SV=2 4 838 0.0E+00
sp|A2Q8R2|MPH1_ASPNC ATP-dependent DNA helicase mph1 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=mph1 PE=3 SV=2 111 843 0.0E+00
sp|A1CS00|MPH1_ASPCL ATP-dependent DNA helicase mph1 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=mph1 PE=3 SV=1 60 838 0.0E+00
sp|Q1DY43|MPH1_COCIM ATP-dependent DNA helicase MPH1 OS=Coccidioides immitis (strain RS) GN=MPH1 PE=3 SV=1 5 835 0.0E+00
sp|Q9UT23|MPH1_SCHPO ATP-dependent DNA helicase fml1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=fml1 PE=1 SV=2 150 748 6.0E-178
sp|Q6BRF0|MPH1_DEBHA ATP-dependent DNA helicase MPH1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=MPH1 PE=3 SV=2 148 761 1.0E-144
sp|Q9HE09|MFH2_SCHPO Putative ATP-dependent DNA helicase fml2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=fml2 PE=3 SV=1 154 690 2.0E-138
sp|Q75AA7|MPH1_ASHGO ATP-dependent DNA helicase MPH1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=MPH1 PE=3 SV=2 147 760 3.0E-137
sp|Q6FPQ3|MPH1_CANGA ATP-dependent DNA helicase MPH1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=MPH1 PE=3 SV=1 148 770 4.0E-136
sp|Q5A1A0|MPH1_CANAL ATP-dependent DNA helicase MPH1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=MPH1 PE=3 SV=1 148 755 4.0E-134
sp|A3GH78|MPH1_PICST ATP-dependent DNA helicase MPH1 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=MPH1 PE=3 SV=3 148 746 1.0E-133
sp|A7TSV4|MPH1_VANPO ATP-dependent DNA helicase MPH1 OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=MPH1 PE=3 SV=1 149 778 1.0E-132
sp|A6ZVS0|MPH1_YEAS7 ATP-dependent DNA helicase MPH1 OS=Saccharomyces cerevisiae (strain YJM789) GN=MPH1 PE=3 SV=1 67 738 2.0E-129
sp|Q8IYD8|FANCM_HUMAN Fanconi anemia group M protein OS=Homo sapiens GN=FANCM PE=1 SV=2 156 697 8.0E-129
sp|P40562|MPH1_YEAST ATP-dependent DNA helicase MPH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MPH1 PE=1 SV=1 67 738 2.0E-128
sp|Q8BGE5|FANCM_MOUSE Fanconi anemia group M protein homolog OS=Mus musculus GN=Fancm PE=1 SV=3 161 697 5.0E-127
sp|Q6CQX2|MPH1_KLULA ATP-dependent DNA helicase MPH1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=MPH1 PE=3 SV=2 148 570 1.0E-88
sp|Q58900|Y1505_METJA Putative ATP-dependent RNA helicase MJ1505 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ1505 PE=3 SV=2 161 656 2.0E-66
sp|Q6CQX2|MPH1_KLULA ATP-dependent DNA helicase MPH1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=MPH1 PE=3 SV=2 565 709 2.0E-30
sp|Q2VF18|DCL2_CRYPA Dicer-like protein 2 OS=Cryphonectria parasitica GN=DCL-2 PE=3 SV=1 171 644 2.0E-21
sp|Q0UI93|DCL1_PHANO Dicer-like protein 1 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=DCL1 PE=3 SV=2 171 669 3.0E-20
sp|A7LFZ6|DCL4_ORYSJ Endoribonuclease Dicer homolog 4 OS=Oryza sativa subsp. japonica GN=DCL4 PE=2 SV=1 171 653 1.0E-19
sp|A1C9M6|DCL2_ASPCL Dicer-like protein 2 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=dcl2 PE=3 SV=1 164 670 4.0E-19
sp|A1D9Z6|DCL2_NEOFI Dicer-like protein 2 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=dcl2 PE=3 SV=1 171 643 1.0E-18
sp|A4RHU9|DCL2_MAGO7 Dicer-like protein 2 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=DCL2 PE=3 SV=3 171 658 4.0E-18
sp|A1DE13|DCL1_NEOFI Dicer-like protein 1 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=dcl1 PE=3 SV=1 171 669 4.0E-17
sp|Q10HL3|DCL2A_ORYSJ Endoribonuclease Dicer homolog 2a OS=Oryza sativa subsp. japonica GN=DCL2A PE=2 SV=1 171 652 7.0E-17
sp|Q9GLV6|DDX58_PIG Probable ATP-dependent RNA helicase DDX58 OS=Sus scrofa GN=DDX58 PE=2 SV=1 185 643 4.0E-16
sp|Q69LX2|DCL2B_ORYSJ Endoribonuclease Dicer homolog 2b OS=Oryza sativa subsp. japonica GN=DCL2B PE=2 SV=2 171 650 2.0E-15
sp|Q4WVE3|DCL1_ASPFU Dicer-like protein 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=dcl1 PE=3 SV=3 171 669 4.0E-15
sp|Q7XD96|DCL3B_ORYSJ Endoribonuclease Dicer homolog 3b OS=Oryza sativa subsp. japonica GN=DCL3B PE=3 SV=2 177 652 7.0E-15
sp|Q8R5F7|IFIH1_MOUSE Interferon-induced helicase C domain-containing protein 1 OS=Mus musculus GN=Ifih1 PE=1 SV=1 170 663 9.0E-15
sp|Q1DW80|DCL2_COCIM Dicer-like protein 2 OS=Coccidioides immitis (strain RS) GN=DCL2 PE=3 SV=3 171 361 7.0E-14
sp|Q2UNX5|DCL2_ASPOR Dicer-like protein 2 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=dcl2 PE=3 SV=1 171 643 8.0E-14
sp|Q9SP32|DCL1_ARATH Endoribonuclease Dicer homolog 1 OS=Arabidopsis thaliana GN=DCL1 PE=1 SV=2 171 327 2.0E-11
sp|P84634|DCL4_ARATH Dicer-like protein 4 OS=Arabidopsis thaliana GN=DCL4 PE=1 SV=2 171 327 2.0E-11
sp|A0MQH0|DICER_CRIGR Endoribonuclease Dicer OS=Cricetulus griseus GN=DICER1 PE=2 SV=3 166 326 2.0E-11
sp|Q99J87|DHX58_MOUSE Probable ATP-dependent RNA helicase DHX58 OS=Mus musculus GN=Dhx58 PE=1 SV=2 511 641 2.0E-11
sp|Q9UPY3|DICER_HUMAN Endoribonuclease Dicer OS=Homo sapiens GN=DICER1 PE=1 SV=3 166 326 3.0E-11
sp|B3DLA6|DICER_XENTR Endoribonuclease Dicer OS=Xenopus tropicalis GN=dicer1 PE=2 SV=2 166 326 3.0E-11
sp|Q9BYX4|IFIH1_HUMAN Interferon-induced helicase C domain-containing protein 1 OS=Homo sapiens GN=IFIH1 PE=1 SV=3 513 663 4.0E-11
sp|Q6TUI4|DICER_BOVIN Endoribonuclease Dicer OS=Bos taurus GN=DICER1 PE=2 SV=3 166 326 4.0E-11
sp|Q8R418|DICER_MOUSE Endoribonuclease Dicer OS=Mus musculus GN=Dicer1 PE=1 SV=3 166 326 9.0E-11
sp|Q25BN1|DICER_CHICK Endoribonuclease Dicer OS=Gallus gallus GN=DICER1 PE=2 SV=3 166 326 1.0E-10
sp|Q0CEI2|DCL2_ASPTN Dicer-like protein 2 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=dcl2 PE=3 SV=2 508 643 1.0E-10
sp|Q5N870|DCL3A_ORYSJ Endoribonuclease Dicer homolog 3a OS=Oryza sativa subsp. japonica GN=DCL3A PE=2 SV=1 171 373 2.0E-10
sp|Q1DKI1|DCL1_COCIM Dicer-like protein 1 OS=Coccidioides immitis (strain RS) GN=DCL1 PE=3 SV=3 512 631 9.0E-10
sp|P0C5H7|DCL2_EMENI Dicer-like protein 2 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=dcl2 PE=3 SV=1 171 361 1.0E-09
sp|O95786|DDX58_HUMAN Probable ATP-dependent RNA helicase DDX58 OS=Homo sapiens GN=DDX58 PE=1 SV=2 534 643 2.0E-09
sp|Q0CW42|DCL1_ASPTN Dicer-like protein 1 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=dcl1 PE=3 SV=2 516 669 2.0E-09
sp|Q3EBC8|DCL2_ARATH Endoribonuclease Dicer homolog 2 OS=Arabidopsis thaliana GN=At3g03300 PE=1 SV=2 157 309 2.0E-09
sp|Q09884|DCR1_SCHPO Protein Dicer OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=dcr1 PE=1 SV=1 528 644 6.0E-09
sp|Q0UN57|PRP5_PHANO Pre-mRNA-processing ATP-dependent RNA helicase PRP5 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=PRP5 PE=3 SV=2 513 654 6.0E-09
sp|A4RKC3|DCL1_MAGO7 Dicer-like protein 1 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=DCL1 PE=3 SV=2 511 631 7.0E-09
sp|Q6TV19|DICER_DANRE Endoribonuclease Dicer OS=Danio rerio GN=dicer1 PE=2 SV=2 166 326 8.0E-09
sp|Q2VF19|DCL1_CRYPA Dicer-like protein 1 OS=Cryphonectria parasitica GN=DCL-1 PE=3 SV=1 513 668 1.0E-08
sp|A1CBC9|DCL1_ASPCL Dicer-like protein 1 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=dcl1 PE=3 SV=2 506 669 1.0E-08
sp|Q2H0G2|DCL1_CHAGB Dicer-like protein 1 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=DCL1 PE=3 SV=2 533 700 1.0E-08
sp|Q9LXW7|DCL3_ARATH Endoribonuclease Dicer homolog 3 OS=Arabidopsis thaliana GN=DCL3 PE=1 SV=2 173 326 2.0E-08
sp|Q96C10|DHX58_HUMAN Probable ATP-dependent RNA helicase DHX58 OS=Homo sapiens GN=DHX58 PE=1 SV=1 512 631 2.0E-08
sp|Q4WA22|DCL2_ASPFU Dicer-like protein 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=dcl2 PE=3 SV=2 171 327 5.0E-08
sp|Q0UL22|DCL2_PHANO Dicer-like protein 2 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=DCL2 PE=3 SV=2 170 361 6.0E-08
sp|Q2U6C4|DCL1_ASPOR Dicer-like protein 1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=dcl1 PE=3 SV=2 512 669 6.0E-08
sp|Q6Q899|DDX58_MOUSE Probable ATP-dependent RNA helicase DDX58 OS=Mus musculus GN=Ddx58 PE=1 SV=2 511 643 7.0E-08
sp|Q4WA22|DCL2_ASPFU Dicer-like protein 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=dcl2 PE=3 SV=2 522 643 8.0E-08
sp|Q7S8J7|DCL1_NEUCR Dicer-like protein 1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=dcl-1 PE=2 SV=1 513 634 8.0E-08
sp|A2RAF3|DCL1_ASPNC Dicer-like protein 1 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=dcl1 PE=3 SV=2 512 668 8.0E-08
sp|Q8LMR2|DCL1_ORYSJ Endoribonuclease Dicer homolog 1 OS=Oryza sativa subsp. japonica GN=DCL1 PE=3 SV=1 557 690 1.0E-07
sp|P25888|RHLE_ECOLI ATP-dependent RNA helicase RhlE OS=Escherichia coli (strain K12) GN=rhlE PE=1 SV=3 521 645 1.0E-07
sp|Q0UL22|DCL2_PHANO Dicer-like protein 2 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=DCL2 PE=3 SV=2 535 648 2.0E-07
sp|Q0DM51|RH3_ORYSJ DEAD-box ATP-dependent RNA helicase 3, chloroplastic OS=Oryza sativa subsp. japonica GN=Os03g0827700 PE=2 SV=2 575 675 2.0E-07
sp|Q54VT4|DDX47_DICDI Probable ATP-dependent RNA helicase ddx47 OS=Dictyostelium discoideum GN=ddx47 PE=3 SV=1 520 639 2.0E-07
sp|A2QX45|DCL22_ASPNC Dicer-like protein 2-2 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=dcl2-2 PE=3 SV=2 170 342 2.0E-07
sp|Q75F95|DRS1_ASHGO ATP-dependent RNA helicase DRS1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=DRS1 PE=3 SV=1 508 655 2.0E-07
sp|Q6FM43|PRP28_CANGA Pre-mRNA-splicing ATP-dependent RNA helicase PRP28 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=PRP28 PE=3 SV=1 535 662 2.0E-07
sp|A2RAF3|DCL1_ASPNC Dicer-like protein 1 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=dcl1 PE=3 SV=2 171 339 3.0E-07
sp|A2R345|DCL21_ASPNC Dicer-like protein 2-1 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=dcl2-1 PE=3 SV=2 551 663 3.0E-07
sp|Q7Y183|RH10_ORYSJ DEAD-box ATP-dependent RNA helicase 10 OS=Oryza sativa subsp. japonica GN=Os03g0669000 PE=2 SV=1 480 639 3.0E-07
sp|Q9SP32|DCL1_ARATH Endoribonuclease Dicer homolog 1 OS=Arabidopsis thaliana GN=DCL1 PE=1 SV=2 557 647 4.0E-07
sp|P44701|SRMB_HAEIN ATP-dependent RNA helicase SrmB OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=srmB PE=3 SV=1 504 634 4.0E-07
sp|A7TS37|RRP3_VANPO ATP-dependent rRNA helicase RRP3 OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=RRP3 PE=3 SV=1 517 644 4.0E-07
sp|P34529|DCR1_CAEEL Endoribonuclease dcr-1 OS=Caenorhabditis elegans GN=dcr-1 PE=1 SV=3 171 326 4.0E-07
sp|Q7SCC1|DCL2_NEUCR Dicer-like protein 2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=dcl-2 PE=2 SV=4 512 669 4.0E-07
sp|P0CQ98|PRP5_CRYNJ Pre-mRNA-processing ATP-dependent RNA helicase PRP5 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=PRP5 PE=3 SV=1 530 639 4.0E-07
sp|P0CQ99|PRP5_CRYNB Pre-mRNA-processing ATP-dependent RNA helicase PRP5 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=PRP5 PE=3 SV=1 530 639 4.0E-07
sp|A3LS22|RRP3_PICST ATP-dependent rRNA helicase RRP3 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=RRP3 PE=3 SV=3 522 644 5.0E-07
sp|Q4IP34|PRP5_GIBZE Pre-mRNA-processing ATP-dependent RNA helicase PRP5 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=PRP5 PE=3 SV=2 521 639 6.0E-07
sp|O22907|RH24_ARATH DEAD-box ATP-dependent RNA helicase 24 OS=Arabidopsis thaliana GN=RH24 PE=1 SV=2 522 654 7.0E-07
sp|Q6BQ61|RRP3_DEBHA ATP-dependent rRNA helicase RRP3 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=RRP3 PE=3 SV=2 522 634 7.0E-07
sp|Q8L7S8|RH3_ARATH DEAD-box ATP-dependent RNA helicase 3, chloroplastic OS=Arabidopsis thaliana GN=RH3 PE=1 SV=2 575 643 8.0E-07
sp|Q5ACU6|RRP3_CANAL ATP-dependent rRNA helicase RRP3 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=RRP3 PE=3 SV=2 519 644 9.0E-07
sp|Q0D1K3|PRP5_ASPTN Pre-mRNA-processing ATP-dependent RNA helicase prp5 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=prp5 PE=3 SV=1 527 639 9.0E-07
sp|Q10MH8|RH24_ORYSJ DEAD-box ATP-dependent RNA helicase 24 OS=Oryza sativa subsp. japonica GN=Os03g0308500 PE=2 SV=1 522 654 9.0E-07
sp|Q0CW42|DCL1_ASPTN Dicer-like protein 1 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=dcl1 PE=3 SV=2 102 371 1.0E-06
sp|A5DQF1|RRP3_PICGU ATP-dependent rRNA helicase RRP3 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=RRP3 PE=3 SV=2 521 634 1.0E-06
sp|Q1DHB2|PRP5_COCIM Pre-mRNA-processing ATP-dependent RNA helicase PRP5 OS=Coccidioides immitis (strain RS) GN=PRP5 PE=3 SV=1 513 665 1.0E-06
sp|P0C2N8|DRS1_NEUCR ATP-dependent RNA helicase drs1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=drh-11 PE=3 SV=1 575 643 1.0E-06
sp|Q75EW9|RRP3_ASHGO ATP-dependent rRNA helicase RRP3 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=RRP3 PE=3 SV=2 521 644 1.0E-06
sp|Q6CH58|RRP3_YARLI ATP-dependent rRNA helicase RRP3 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=RRP3 PE=3 SV=1 575 660 1.0E-06
sp|Q6HPE6|CSHA_BACHK DEAD-box ATP-dependent RNA helicase CshA OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=cshA PE=3 SV=1 567 653 1.0E-06
sp|Q81VG0|CSHA_BACAN DEAD-box ATP-dependent RNA helicase CshA OS=Bacillus anthracis GN=cshA PE=3 SV=1 567 653 1.0E-06
sp|A0R8U6|CSHA_BACAH DEAD-box ATP-dependent RNA helicase CshA OS=Bacillus thuringiensis (strain Al Hakam) GN=cshA PE=3 SV=1 567 653 1.0E-06
sp|Q81IT9|CSHA_BACCR DEAD-box ATP-dependent RNA helicase CshA OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=cshA PE=2 SV=2 567 653 1.0E-06
sp|Q63GX5|CSHA_BACCZ DEAD-box ATP-dependent RNA helicase CshA OS=Bacillus cereus (strain ZK / E33L) GN=cshA PE=3 SV=1 567 653 1.0E-06
sp|Q73EU1|CSHA_BACC1 DEAD-box ATP-dependent RNA helicase CshA OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=cshA PE=3 SV=1 567 653 1.0E-06
sp|Q8SR63|RRP3_ENCCU ATP-dependent rRNA helicase RRP3 OS=Encephalitozoon cuniculi (strain GB-M1) GN=RRP3 PE=3 SV=1 575 662 1.0E-06
sp|A3LP87|DBP8_PICST ATP-dependent RNA helicase DBP8 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=DBP8 PE=3 SV=2 575 694 2.0E-06
sp|Q2U2J6|PRP5_ASPOR Pre-mRNA-processing ATP-dependent RNA helicase prp5 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=prp5 PE=3 SV=1 524 639 2.0E-06
sp|Q9JIK5|DDX21_MOUSE Nucleolar RNA helicase 2 OS=Mus musculus GN=Ddx21 PE=1 SV=3 529 655 2.0E-06
sp|Q0ILZ4|RH9_ORYSJ DEAD-box ATP-dependent RNA helicase 9 OS=Oryza sativa subsp. japonica GN=Os12g0611200 PE=2 SV=1 510 642 2.0E-06
sp|Q3B8Q1|DDX21_RAT Nucleolar RNA helicase 2 OS=Rattus norvegicus GN=Ddx21 PE=2 SV=1 529 655 2.0E-06
sp|A1CQA9|PRP5_ASPCL Pre-mRNA-processing ATP-dependent RNA helicase prp5 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=prp5 PE=3 SV=1 513 665 2.0E-06
sp|Q9P7C7|PRP11_SCHPO Pre-mRNA-processing ATP-dependent RNA helicase prp11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=prp11 PE=3 SV=1 513 654 2.0E-06
sp|Q41382|RH7_SPIOL DEAD-box ATP-dependent RNA helicase 7 OS=Spinacia oleracea GN=RH7 PE=2 SV=1 529 645 3.0E-06
sp|Q9LUW6|RH9_ARATH DEAD-box ATP-dependent RNA helicase 9 OS=Arabidopsis thaliana GN=RH9 PE=2 SV=1 527 674 3.0E-06
sp|Q7SH33|PRP5_NEUCR Pre-mRNA-processing ATP-dependent RNA helicase prp-5 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=prp-5 PE=3 SV=1 521 639 3.0E-06
sp|Q9NR30|DDX21_HUMAN Nucleolar RNA helicase 2 OS=Homo sapiens GN=DDX21 PE=1 SV=5 529 655 4.0E-06
sp|Q4WT99|PRP5_ASPFU Pre-mRNA-processing ATP-dependent RNA helicase prp5 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=prp5 PE=3 SV=1 513 639 4.0E-06
sp|P42305|DBPA_BACSU ATP-dependent RNA helicase DbpA OS=Bacillus subtilis (strain 168) GN=dbpA PE=1 SV=2 574 639 4.0E-06
sp|A2QQA8|PRP5_ASPNC Pre-mRNA-processing ATP-dependent RNA helicase prp5 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=prp5 PE=3 SV=2 527 639 4.0E-06
sp|Q5BDW4|PRP5_EMENI Pre-mRNA-processing ATP-dependent RNA helicase prp5 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=prp5 PE=3 SV=1 513 639 4.0E-06
sp|Q6BLU9|PRP28_DEBHA Pre-mRNA-splicing ATP-dependent RNA helicase PRP28 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=PRP28 PE=3 SV=2 512 639 4.0E-06
sp|Q1DKI1|DCL1_COCIM Dicer-like protein 1 OS=Coccidioides immitis (strain RS) GN=DCL1 PE=3 SV=3 171 385 5.0E-06
sp|A1D373|PRP5_NEOFI Pre-mRNA-processing ATP-dependent RNA helicase prp5 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=prp5 PE=3 SV=1 513 639 5.0E-06
sp|Q8GY84|RH10_ARATH DEAD-box ATP-dependent RNA helicase 10 OS=Arabidopsis thaliana GN=RH10 PE=2 SV=2 575 653 5.0E-06
sp|P57453|DEAD_BUCAI ATP-dependent RNA helicase DeaD OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=deaD PE=3 SV=1 366 644 6.0E-06
sp|P0CR00|RRP3_CRYNJ ATP-dependent rRNA helicase RRP3 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=RRP3 PE=3 SV=1 575 644 7.0E-06
sp|P0CR01|RRP3_CRYNB ATP-dependent rRNA helicase RRP3 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=RRP3 PE=3 SV=1 575 644 7.0E-06
sp|Q8Y8N0|CSHA_LISMO ATP-dependent RNA helicase CshA OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=cshA PE=2 SV=1 567 634 7.0E-06
sp|Q9SA27|RH36_ARATH DEAD-box ATP-dependent RNA helicase 36 OS=Arabidopsis thaliana GN=RH36 PE=2 SV=1 577 662 8.0E-06
sp|Q9LUW5|RH53_ARATH DEAD-box ATP-dependent RNA helicase 53 OS=Arabidopsis thaliana GN=RH53 PE=2 SV=1 575 643 8.0E-06
sp|P0A9P8|DEAD_SHIFL ATP-dependent RNA helicase DeaD OS=Shigella flexneri GN=deaD PE=3 SV=2 522 644 9.0E-06
sp|P0A9P6|DEAD_ECOLI ATP-dependent RNA helicase DeaD OS=Escherichia coli (strain K12) GN=deaD PE=1 SV=2 522 644 9.0E-06
sp|P0A9P7|DEAD_ECOL6 ATP-dependent RNA helicase DeaD OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=deaD PE=3 SV=2 522 644 9.0E-06
sp|Q8XA87|DEAD_ECO57 ATP-dependent RNA helicase DeaD OS=Escherichia coli O157:H7 GN=deaD PE=3 SV=3 522 644 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0003676 nucleic acid binding Yes
GO:0005524 ATP binding Yes
GO:0016787 hydrolase activity Yes
GO:0003677 DNA binding Yes
GO:0017076 purine nucleotide binding No
GO:0005488 binding No
GO:0003674 molecular_function No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0000166 nucleotide binding No
GO:0043167 ion binding No
GO:0032553 ribonucleotide binding No
GO:0097367 carbohydrate derivative binding No
GO:0003824 catalytic activity No
GO:0043168 anion binding No
GO:0097159 organic cyclic compound binding No
GO:1901265 nucleoside phosphate binding No
GO:0032555 purine ribonucleotide binding No
GO:1901363 heterocyclic compound binding No
GO:0032559 adenyl ribonucleotide binding No
GO:0036094 small molecule binding No
GO:0030554 adenyl nucleotide binding No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup4135
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3751
Ophiocordyceps australis map64 (Brazil) OphauB2|4324 (this protein)
Ophiocordyceps camponoti-floridani Ophcf2|00288
Ophiocordyceps camponoti-rufipedis Ophun1|5073
Ophiocordyceps kimflemingae Ophio5|7390
Ophiocordyceps subramaniannii Hirsu2|8384

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|4324
MMLDDLDDEIADEDLLSAFEQVSSGSGNNARSRFPAPASLSSDQRPGLGSQASRSAAAQELRDLPPDAFSSPEPL
EQPQAHAQRPPPSKRHVTSRGAAPARTGLQRSSSSRQTTLWGTELIDAPLGSQTLSQTISARPFRTDTAREEPSH
HQLNRTAMETWVYPTNLGAIRDYQFSIVKNSLFNNTLVALPTGLGKTFIAATVMLNFYRWTETAKIVFVAPTKPL
VAQQVTACYSIAGIPRSDTTLLTGEIPPVLRVDEWQTKRVFFMTPQTLLNDISHGYADPKTIVLLVIDEAHRAVG
EYAYAKVTKLIRRYSKSFRVLALTATPGSKIETVQEVIDNLGISHCEIRTEESIDIRQYVHDRNTEVMVLDPSDE
MNLVSELFSQALKPLVDKLSSQNIYYGRNPMALTAYGLMQAQREWFATRGRNANQGVQFMMRATFSVLTSVAHSI
KLLNFHGIKPFYDNLFDFRNGVEGKGEQGSKYKRQLIEHPSFQEMMNKISGWLKLPSFVGHPKLTELASCVLNHF
MDQGDATRIIVFSEYRDSAEDIVCMLNKHRPLVKASVFVGQADGKRGEGMKQAQQIETIDKFKRGDFNVLVATSI
GEEGLDIGQVDLIVCYDSSASPIRMLQRMGRTGRKRAGNIVLLLMRGKEEEQFAKSKDSYEKMQQLICEGSRFNF
RFDLSTRIVPRDVRPEVDKRLVDIPIENTQNQSLPEPKKRRVPPGKKKPPKKFHMPDGVETGFQKLTHFIKPKAK
ADRGRPVKHSEVNDVVPIPDLESVMLTAAETEELDRSYRDLPFNHSMVEETDMPSMTAYPELQRRLQSAVNVKHG
EHTRRCVRVLGAMGLKPDSLVKPCRYTDESDFLEIPVREFINSDGEEEVGGSRATAMSEARLSIPGRARPLERSQ
EPRRKRKLSTRFDSQEPLNEEHESRPVLETSIQESDSATPPPASKRPKKAPRSKVGAKGRRGKQRGTGINSDELG
DDCEQDGDLLETSGSDDGEDLLDFVVADDASVSVNSQATPFPSSLDKRNSPPIETEPAYYVPMDFSATQDSQDMP
DVDALVDTACSNGQQDLTLEHDAIRTRRAVRRNRQRMSYDSDDD*
Coding >OphauB2|4324
ATGATGCTAGATGACTTGGACGACGAGATTGCCGATGAGGATCTTCTTTCGGCCTTTGAACAAGTCTCGTCTGGT
AGCGGCAACAATGCGCGGTCACGATTTCCGGCTCCGGCTTCTTTGAGTTCTGATCAGAGGCCTGGCTTAGGGTCC
CAGGCTTCGCGCTCAGCTGCAGCACAGGAGCTCCGAGACCTGCCTCCTGACGCCTTTTCGTCTCCCGAGCCTCTC
GAGCAGCCTCAAGCGCATGCTCAAAGGCCTCCACCGTCGAAACGTCATGTCACCAGTCGTGGTGCTGCGCCTGCC
AGGACTGGGCTTCAACGCTCCTCTTCCTCGCGACAGACGACTCTCTGGGGCACTGAACTCATTGATGCCCCTCTC
GGCTCTCAAACTCTATCTCAAACCATCAGCGCGCGCCCATTCCGAACAGACACTGCGAGGGAAGAACCAAGCCAT
CATCAGCTCAACAGAACGGCAATGGAGACCTGGGTCTATCCCACCAATCTTGGTGCCATCAGAGACTATCAGTTC
AGCATTGTTAAGAATAGCCTCTTCAATAACACGCTCGTGGCTTTGCCCACTGGACTTGGCAAAACCTTTATCGCT
GCCACGGTTATGTTGAACTTTTATCGATGGACTGAGACGGCCAAGATTGTCTTTGTGGCTCCGACAAAGCCCCTT
GTAGCCCAACAAGTGACGGCCTGCTACTCCATCGCGGGAATTCCACGATCTGATACGACACTGCTCACAGGAGAA
ATCCCACCTGTGCTGCGTGTCGATGAGTGGCAGACGAAGCGAGTCTTCTTCATGACGCCCCAGACGCTCCTCAAC
GATATTTCTCATGGTTACGCCGACCCCAAAACCATTGTGTTGCTCGTCATTGACGAGGCCCATCGCGCCGTGGGC
GAGTATGCGTATGCCAAGGTCACCAAGCTTATTCGCCGCTATTCGAAAAGCTTTCGCGTCTTGGCTCTGACGGCG
ACACCAGGGTCCAAGATTGAAACTGTACAGGAGGTTATTGATAACCTTGGCATCTCTCACTGCGAGATTCGTACC
GAGGAGTCCATTGACATTAGACAATACGTGCATGACAGAAACACAGAAGTCATGGTACTGGATCCTTCGGATGAA
ATGAATCTCGTTAGTGAGCTCTTTTCCCAAGCTCTGAAGCCTCTGGTGGACAAGCTCAGCTCGCAAAACATTTAC
TATGGGCGGAATCCTATGGCTCTTACGGCCTACGGCCTCATGCAAGCCCAGCGTGAATGGTTTGCTACACGCGGA
CGCAATGCCAATCAGGGTGTTCAATTCATGATGAGAGCCACTTTTAGCGTCTTGACCAGTGTCGCTCACTCCATC
AAACTGCTCAACTTTCACGGAATTAAGCCCTTTTACGATAATCTCTTCGATTTTCGCAATGGCGTGGAAGGCAAG
GGAGAGCAAGGATCAAAATATAAACGTCAATTGATTGAGCATCCGAGCTTCCAGGAAATGATGAACAAGATTTCG
GGCTGGCTCAAACTGCCTAGCTTTGTGGGCCACCCAAAACTGACTGAGCTGGCTAGCTGCGTCTTGAACCATTTC
ATGGACCAGGGCGACGCGACACGTATCATTGTCTTTAGCGAGTACCGTGATTCTGCCGAGGATATTGTATGCATG
CTCAACAAGCATCGGCCACTTGTCAAAGCTAGTGTTTTTGTCGGTCAGGCCGATGGCAAGCGAGGCGAAGGCATG
AAGCAAGCTCAGCAAATCGAGACGATTGACAAGTTCAAGAGAGGCGACTTCAACGTGCTGGTAGCCACCTCAATC
GGTGAAGAAGGCTTGGACATTGGGCAAGTCGATCTCATTGTCTGCTATGATTCATCAGCATCACCCATCCGGATG
CTTCAACGGATGGGACGGACAGGCCGAAAACGCGCCGGCAACATTGTGCTCTTGCTCATGAGGGGCAAGGAGGAG
GAACAGTTTGCCAAGTCCAAGGATAGTTACGAAAAGATGCAGCAACTCATATGTGAGGGCAGCAGATTCAACTTT
CGCTTCGACTTGTCAACACGCATCGTTCCACGCGACGTGCGCCCCGAAGTTGACAAGCGTCTTGTCGACATTCCT
ATTGAGAATACTCAGAATCAATCTCTACCAGAGCCCAAGAAGAGACGTGTCCCACCTGGCAAGAAGAAGCCACCA
AAGAAGTTCCACATGCCAGACGGCGTCGAGACGGGCTTCCAGAAGCTGACGCACTTTATCAAGCCAAAAGCCAAG
GCTGACCGAGGCAGGCCTGTCAAGCACTCTGAAGTAAACGATGTTGTCCCGATTCCAGACTTGGAGAGCGTTATG
CTCACCGCCGCGGAGACGGAGGAGCTGGACCGGTCCTACCGTGACCTACCCTTCAATCATAGTATGGTTGAGGAG
ACGGACATGCCCAGCATGACGGCATATCCAGAGTTGCAGAGACGGCTCCAGTCTGCGGTAAATGTGAAGCACGGC
GAGCATACGCGGCGCTGCGTCAGAGTTCTTGGAGCAATGGGCCTGAAACCAGATTCACTGGTAAAGCCATGTCGA
TATACCGATGAGAGCGATTTTCTGGAAATTCCTGTGAGAGAATTCATAAACTCGGATGGAGAAGAAGAAGTTGGA
GGCTCTCGGGCGACAGCCATGTCAGAAGCAAGATTGAGCATTCCCGGGCGAGCTAGACCACTTGAAAGAAGCCAG
GAGCCTAGGCGCAAAAGAAAGCTGTCAACAAGATTTGACTCTCAAGAACCTTTAAATGAGGAACATGAGTCGAGG
CCAGTACTAGAGACAAGCATACAAGAGAGCGACTCGGCAACGCCGCCCCCTGCCTCGAAACGGCCCAAGAAGGCT
CCAAGGTCGAAAGTCGGAGCCAAGGGTAGACGAGGGAAACAAAGAGGTACTGGCATCAACAGTGATGAACTCGGT
GACGACTGTGAGCAAGATGGCGATCTCTTGGAGACGAGCGGCTCTGATGATGGCGAGGATCTCCTGGACTTTGTG
GTTGCGGATGACGCGAGCGTATCGGTGAATTCGCAAGCGACGCCATTTCCTTCATCACTGGACAAGCGCAACAGT
CCACCAATAGAGACGGAGCCGGCCTATTATGTGCCGATGGACTTTTCTGCAACACAGGACAGCCAGGATATGCCA
GACGTGGACGCCTTGGTTGACACAGCTTGTAGCAATGGGCAACAAGACTTGACTTTGGAGCATGATGCCATCCGG
ACAAGAAGAGCTGTTAGACGAAATCGACAACGAATGAGCTACGACAGTGACGATGATTAG
Transcript >OphauB2|4324
ATGATGCTAGATGACTTGGACGACGAGATTGCCGATGAGGATCTTCTTTCGGCCTTTGAACAAGTCTCGTCTGGT
AGCGGCAACAATGCGCGGTCACGATTTCCGGCTCCGGCTTCTTTGAGTTCTGATCAGAGGCCTGGCTTAGGGTCC
CAGGCTTCGCGCTCAGCTGCAGCACAGGAGCTCCGAGACCTGCCTCCTGACGCCTTTTCGTCTCCCGAGCCTCTC
GAGCAGCCTCAAGCGCATGCTCAAAGGCCTCCACCGTCGAAACGTCATGTCACCAGTCGTGGTGCTGCGCCTGCC
AGGACTGGGCTTCAACGCTCCTCTTCCTCGCGACAGACGACTCTCTGGGGCACTGAACTCATTGATGCCCCTCTC
GGCTCTCAAACTCTATCTCAAACCATCAGCGCGCGCCCATTCCGAACAGACACTGCGAGGGAAGAACCAAGCCAT
CATCAGCTCAACAGAACGGCAATGGAGACCTGGGTCTATCCCACCAATCTTGGTGCCATCAGAGACTATCAGTTC
AGCATTGTTAAGAATAGCCTCTTCAATAACACGCTCGTGGCTTTGCCCACTGGACTTGGCAAAACCTTTATCGCT
GCCACGGTTATGTTGAACTTTTATCGATGGACTGAGACGGCCAAGATTGTCTTTGTGGCTCCGACAAAGCCCCTT
GTAGCCCAACAAGTGACGGCCTGCTACTCCATCGCGGGAATTCCACGATCTGATACGACACTGCTCACAGGAGAA
ATCCCACCTGTGCTGCGTGTCGATGAGTGGCAGACGAAGCGAGTCTTCTTCATGACGCCCCAGACGCTCCTCAAC
GATATTTCTCATGGTTACGCCGACCCCAAAACCATTGTGTTGCTCGTCATTGACGAGGCCCATCGCGCCGTGGGC
GAGTATGCGTATGCCAAGGTCACCAAGCTTATTCGCCGCTATTCGAAAAGCTTTCGCGTCTTGGCTCTGACGGCG
ACACCAGGGTCCAAGATTGAAACTGTACAGGAGGTTATTGATAACCTTGGCATCTCTCACTGCGAGATTCGTACC
GAGGAGTCCATTGACATTAGACAATACGTGCATGACAGAAACACAGAAGTCATGGTACTGGATCCTTCGGATGAA
ATGAATCTCGTTAGTGAGCTCTTTTCCCAAGCTCTGAAGCCTCTGGTGGACAAGCTCAGCTCGCAAAACATTTAC
TATGGGCGGAATCCTATGGCTCTTACGGCCTACGGCCTCATGCAAGCCCAGCGTGAATGGTTTGCTACACGCGGA
CGCAATGCCAATCAGGGTGTTCAATTCATGATGAGAGCCACTTTTAGCGTCTTGACCAGTGTCGCTCACTCCATC
AAACTGCTCAACTTTCACGGAATTAAGCCCTTTTACGATAATCTCTTCGATTTTCGCAATGGCGTGGAAGGCAAG
GGAGAGCAAGGATCAAAATATAAACGTCAATTGATTGAGCATCCGAGCTTCCAGGAAATGATGAACAAGATTTCG
GGCTGGCTCAAACTGCCTAGCTTTGTGGGCCACCCAAAACTGACTGAGCTGGCTAGCTGCGTCTTGAACCATTTC
ATGGACCAGGGCGACGCGACACGTATCATTGTCTTTAGCGAGTACCGTGATTCTGCCGAGGATATTGTATGCATG
CTCAACAAGCATCGGCCACTTGTCAAAGCTAGTGTTTTTGTCGGTCAGGCCGATGGCAAGCGAGGCGAAGGCATG
AAGCAAGCTCAGCAAATCGAGACGATTGACAAGTTCAAGAGAGGCGACTTCAACGTGCTGGTAGCCACCTCAATC
GGTGAAGAAGGCTTGGACATTGGGCAAGTCGATCTCATTGTCTGCTATGATTCATCAGCATCACCCATCCGGATG
CTTCAACGGATGGGACGGACAGGCCGAAAACGCGCCGGCAACATTGTGCTCTTGCTCATGAGGGGCAAGGAGGAG
GAACAGTTTGCCAAGTCCAAGGATAGTTACGAAAAGATGCAGCAACTCATATGTGAGGGCAGCAGATTCAACTTT
CGCTTCGACTTGTCAACACGCATCGTTCCACGCGACGTGCGCCCCGAAGTTGACAAGCGTCTTGTCGACATTCCT
ATTGAGAATACTCAGAATCAATCTCTACCAGAGCCCAAGAAGAGACGTGTCCCACCTGGCAAGAAGAAGCCACCA
AAGAAGTTCCACATGCCAGACGGCGTCGAGACGGGCTTCCAGAAGCTGACGCACTTTATCAAGCCAAAAGCCAAG
GCTGACCGAGGCAGGCCTGTCAAGCACTCTGAAGTAAACGATGTTGTCCCGATTCCAGACTTGGAGAGCGTTATG
CTCACCGCCGCGGAGACGGAGGAGCTGGACCGGTCCTACCGTGACCTACCCTTCAATCATAGTATGGTTGAGGAG
ACGGACATGCCCAGCATGACGGCATATCCAGAGTTGCAGAGACGGCTCCAGTCTGCGGTAAATGTGAAGCACGGC
GAGCATACGCGGCGCTGCGTCAGAGTTCTTGGAGCAATGGGCCTGAAACCAGATTCACTGGTAAAGCCATGTCGA
TATACCGATGAGAGCGATTTTCTGGAAATTCCTGTGAGAGAATTCATAAACTCGGATGGAGAAGAAGAAGTTGGA
GGCTCTCGGGCGACAGCCATGTCAGAAGCAAGATTGAGCATTCCCGGGCGAGCTAGACCACTTGAAAGAAGCCAG
GAGCCTAGGCGCAAAAGAAAGCTGTCAACAAGATTTGACTCTCAAGAACCTTTAAATGAGGAACATGAGTCGAGG
CCAGTACTAGAGACAAGCATACAAGAGAGCGACTCGGCAACGCCGCCCCCTGCCTCGAAACGGCCCAAGAAGGCT
CCAAGGTCGAAAGTCGGAGCCAAGGGTAGACGAGGGAAACAAAGAGGTACTGGCATCAACAGTGATGAACTCGGT
GACGACTGTGAGCAAGATGGCGATCTCTTGGAGACGAGCGGCTCTGATGATGGCGAGGATCTCCTGGACTTTGTG
GTTGCGGATGACGCGAGCGTATCGGTGAATTCGCAAGCGACGCCATTTCCTTCATCACTGGACAAGCGCAACAGT
CCACCAATAGAGACGGAGCCGGCCTATTATGTGCCGATGGACTTTTCTGCAACACAGGACAGCCAGGATATGCCA
GACGTGGACGCCTTGGTTGACACAGCTTGTAGCAATGGGCAACAAGACTTGACTTTGGAGCATGATGCCATCCGG
ACAAGAAGAGCTGTTAGACGAAATCGACAACGAATGAGCTACGACAGTGACGATGATTAG
Gene >OphauB2|4324
ATGATGCTAGATGACTTGGACGACGAGATTGCCGATGAGGATCTTCTTTCGGCCTTTGAACAAGTCTCGTCTGGT
AGCGGCAACAATGCGCGGTCACGATTTCCGGCTCCGGCTTCTTTGAGTTCTGATCAGAGGCCTGGCTTAGGGTCC
CAGGCTTCGCGCTCAGCTGCAGCACAGGAGCTCCGAGACCTGCCTCCTGACGCCTTTTCGTCTCCCGAGCCTCTC
GAGCAGCCTCAAGCGCATGCTCAAAGGCCTCCACCGTCGAAACGTCATGTCACCAGTCGTGGTGCTGCGCCTGCC
AGGACTGGGCTTCAACGCTCCTCTTCCTCGCGACAGACGACTCTCTGGGGCACTGAACTCATTGATGCCCCTCTC
GGCTCTCAAACTCTATCTCAAACCATCAGCGCGCGCCCATTCCGAACAGACACTGCGAGGGAAGAACCAAGCCAT
CATCAGCTCAACAGAACGGCAATGGAGACCTGGGTCTATCCCACCAATCTTGGTGCCATCAGAGACTATCAGTTC
AGCATTGTTAAGAATAGCCTCTTCAATAACACGCTCGTGGCTTTGCCCACTGGACTTGGCAAAACCTTTATCGCT
GCCACGGTTATGTTGAACTTTTATCGATGGACTGAGACGGCCAAGATTGTCTTTGTGGCTCCGACAAAGCCCCTT
GTAGCCCAACAAGTGACGGCCTGCTACTCCATCGCGGGAATTCCACGATCTGATACGACACTGCTCACAGGAGAA
ATCCCACCTGTGCTGCGTGTCGATGAGTGGCAGACGAAGCGAGTCTTCTTCATGACGCCCCAGACGCTCCTCAAC
GATATTTCTCATGGTTACGCCGACCCCAAAACCATTGTGTTGCTCGTCATTGACGAGGCCCATCGCGCCGTGGGC
GAGTATGCGTATGCCAAGGTCACCAAGCTTATTCGCCGCTATTCGAAAAGCTTTCGCGTCTTGGCTCTGACGGCG
ACACCAGGGTCCAAGATTGAAACTGTACAGGAGGTTATTGATAACCTTGGCATCTCTCACTGCGAGATTCGTACC
GAGGAGTCCATTGACATTAGACAATACGTGCATGACAGAAACACAGAAGTCATGGTACTGGATCCTTCGGATGAA
ATGAATCTCGTTAGTGAGCTCTTTTCCCAAGCTCTGAAGCCTCTGGTGGACAAGCTCAGCTCGCAAAACATTTAC
TATGGGCGGAATCCTATGGCTCTTACGGCCTACGGCCTCATGCAAGCCCAGCGTGAATGGTTTGCTACACGCGGA
CGCAATGCCAATCAGGGTGTTCAATTCATGATGAGAGCCACTTTTAGCGTCTTGACCAGTGTCGCTCACTCCATC
AAACTGCTCAACTTTCACGGAATTAAGCCCTTTTACGATAATCTCTTCGATTTTCGCAATGGCGTGGAAGGCAAG
GGAGAGCAAGGATCAAAATATAAACGTCAATTGATTGAGCATCCGAGCTTCCAGGAAATGATGAACAAGATTTCG
GGCTGGCTCAAACTGCCTAGCTTTGTGGGCCACCCAAAACTGACTGAGCTGGCTAGCTGCGTCTTGAACCATTTC
ATGGACCAGGGCGACGCGACACGTATCATTGTCTTTAGCGAGTACCGTGATTCTGCCGAGGATATTGTATGCATG
CTCAACAAGCATCGGCCACTTGTCAAAGCTAGTGTTTTTGTCGGTCAGGCCGATGGCAAGCGAGGCGAAGGCATG
AAGCAAGCTCAGCAAATCGAGACGATTGACAAGTTCAAGAGAGGCGACTTCAACGTGCTGGTAGCCACCTCAATC
GGTGAAGAAGGCTTGGACATTGGGCAAGTCGATCTCATTGTCTGCTATGATTCATCAGCATCACCCATCCGGATG
CTTCAACGGATGGGACGGACAGGCCGAAAACGCGCCGGCAACATTGTGCTCTTGCTCATGAGGGGCAAGGAGGAG
GAACAGTTTGCCAAGTCCAAGGATAGTTACGAAAAGATGCAGCAACTCATATGTGAGGGCAGCAGATTCAACTTT
CGCTTCGACTTGTCAACACGCATCGTTCCACGCGACGTGCGCCCCGAAGTTGACAAGCGTCTTGTCGACATTCCT
ATTGAGAATACTCAGAATCAATCTCTACCAGAGCCCAAGAAGAGACGTGTCCCACCTGGCAAGAAGAAGCCACCA
AAGAAGTTCCACATGCCAGACGGCGTCGAGACGGGCTTCCAGAAGCTGACGCACTTTATCAAGCCAAAAGCCAAG
GCTGACCGAGGCAGGCCTGTCAAGCACTCTGAAGTAAACGATGTTGTCCCGATTCCAGACTTGGAGAGCGTTATG
CTCACCGCCGCGGAGACGGAGGAGCTGGACCGGTCCTACCGTGACCTACCCTTCAATCATAGTATGGTTGAGGAG
ACGGACATGCCCAGCATGACGGCATATCCAGAGTTGCAGAGACGGCTCCAGTCTGCGGTAAATGTGAAGCACGGC
GAGCATACGCGGCGCTGCGTCAGAGTTCTTGGAGCAATGGGCCTGAAACCAGATTCACTGGTAAAGCCATGTCGA
TATACCGATGAGAGCGATTTTCTGGAAATTCCTGTGAGAGAATTCATAAACTCGGATGGAGAAGAAGAAGTTGGA
GGCTCTCGGGCGACAGCCATGTCAGAAGCAAGATTGAGCATTCCCGGGCGAGCTAGACCACTTGAAAGAAGCCAG
GAGCCTAGGCGCAAAAGAAAGCTGTCAACAAGATTTGACTCTCAAGAACCTTTAAATGAGGAACATGAGTCGAGG
CCAGTACTAGAGACAAGCATACAAGAGAGCGACTCGGCAACGCCGCCCCCTGCCTCGAAACGGCCCAAGAAGGCT
CCAAGGTCGAAAGTCGGAGCCAAGGGTAGACGAGGGAAACAAAGAGGTACTGGCATCAACAGTGATGAACTCGGT
GACGACTGTGAGCAAGATGGCGATCTCTTGGAGACGAGCGGCTCTGATGATGGCGAGGATCTCCTGGACTTTGTG
GTTGCGGATGACGCGAGCGTATCGGTGAATTCGCAAGCGACGCCATTTCCTTCATCACTGGACAAGCGCAACAGT
CCACCAATAGAGACGGAGCCGGCCTATTATGTGCCGATGGACTTTTCTGCAACACAGGACAGCCAGGATATGCCA
GACGTGGACGCCTTGGTTGACACAGCTTGTAGCAATGGGCAACAAGACTTGACTTTGGAGCATGATGCCATCCGG
ACAAGAAGAGCTGTTAGACGAAATCGACAACGAATGAGCTACGACAGTGACGATGATTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail