Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|4324
Gene name
LocationContig_29:94275..97560
Strand-
Gene length (bp)3285
Transcript length (bp)3285
Coding sequence length (bp)3285
Protein length (aa) 1095

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04851 ResIII Type III restriction enzyme, res subunit 7.2E-21 174 327
PF00271 Helicase_C Helicase conserved C-terminal domain 1.6E-20 527 635
PF00270 DEAD DEAD/DEAH box helicase 1.6E-15 174 332

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|A4RN08|MPH1_MAGO7 ATP-dependent DNA helicase MPH1 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=MPH1 PE=3 SV=1 4 907 0.0E+00
sp|Q7SDF3|MPH1_NEUCR ATP-dependent DNA helicase mph1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=mph1 PE=3 SV=1 97 1003 0.0E+00
sp|Q2HG76|MPH1_CHAGB ATP-dependent DNA helicase MPH1 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=MPH1 PE=3 SV=1 10 862 0.0E+00
sp|A7EFH4|MPH1_SCLS1 ATP-dependent DNA helicase mph1 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=mph1 PE=3 SV=1 58 908 0.0E+00
sp|A6RIS1|MPH1_BOTFB ATP-dependent DNA helicase MPH1 OS=Botryotinia fuckeliana (strain B05.10) GN=mph1 PE=3 SV=2 58 862 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|A4RN08|MPH1_MAGO7 ATP-dependent DNA helicase MPH1 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=MPH1 PE=3 SV=1 4 907 0.0E+00
sp|Q7SDF3|MPH1_NEUCR ATP-dependent DNA helicase mph1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=mph1 PE=3 SV=1 97 1003 0.0E+00
sp|Q2HG76|MPH1_CHAGB ATP-dependent DNA helicase MPH1 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=MPH1 PE=3 SV=1 10 862 0.0E+00
sp|A7EFH4|MPH1_SCLS1 ATP-dependent DNA helicase mph1 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=mph1 PE=3 SV=1 58 908 0.0E+00
sp|A6RIS1|MPH1_BOTFB ATP-dependent DNA helicase MPH1 OS=Botryotinia fuckeliana (strain B05.10) GN=mph1 PE=3 SV=2 58 862 0.0E+00
sp|A1D4V5|MPH1_NEOFI ATP-dependent DNA helicase mph1 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=mph1 PE=3 SV=1 4 838 0.0E+00
sp|Q2URJ5|MPH1_ASPOR ATP-dependent DNA helicase mph1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=mph1 PE=3 SV=2 3 843 0.0E+00
sp|Q4WKB5|MPH1_ASPFU ATP-dependent DNA helicase mph1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=mph1 PE=3 SV=1 60 839 0.0E+00
sp|B0XMV6|MPH1_ASPFC ATP-dependent DNA helicase mph1 OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=mph1 PE=3 SV=1 60 839 0.0E+00
sp|Q0CWI2|MPH1_ASPTN ATP-dependent DNA helicase mph1 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=mph1 PE=3 SV=2 4 838 0.0E+00
sp|A2Q8R2|MPH1_ASPNC ATP-dependent DNA helicase mph1 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=mph1 PE=3 SV=2 111 843 0.0E+00
sp|A1CS00|MPH1_ASPCL ATP-dependent DNA helicase mph1 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=mph1 PE=3 SV=1 60 838 0.0E+00
sp|Q1DY43|MPH1_COCIM ATP-dependent DNA helicase MPH1 OS=Coccidioides immitis (strain RS) GN=MPH1 PE=3 SV=1 5 835 0.0E+00
sp|Q9UT23|MPH1_SCHPO ATP-dependent DNA helicase fml1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=fml1 PE=1 SV=2 150 748 6.0E-178
sp|Q6BRF0|MPH1_DEBHA ATP-dependent DNA helicase MPH1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=MPH1 PE=3 SV=2 148 761 1.0E-144
sp|Q9HE09|MFH2_SCHPO Putative ATP-dependent DNA helicase fml2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=fml2 PE=3 SV=1 154 690 2.0E-138
sp|Q75AA7|MPH1_ASHGO ATP-dependent DNA helicase MPH1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=MPH1 PE=3 SV=2 147 760 3.0E-137
sp|Q6FPQ3|MPH1_CANGA ATP-dependent DNA helicase MPH1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=MPH1 PE=3 SV=1 148 770 4.0E-136
sp|Q5A1A0|MPH1_CANAL ATP-dependent DNA helicase MPH1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=MPH1 PE=3 SV=1 148 755 4.0E-134
sp|A3GH78|MPH1_PICST ATP-dependent DNA helicase MPH1 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=MPH1 PE=3 SV=3 148 746 1.0E-133
sp|A7TSV4|MPH1_VANPO ATP-dependent DNA helicase MPH1 OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=MPH1 PE=3 SV=1 149 778 1.0E-132
sp|A6ZVS0|MPH1_YEAS7 ATP-dependent DNA helicase MPH1 OS=Saccharomyces cerevisiae (strain YJM789) GN=MPH1 PE=3 SV=1 67 738 2.0E-129
sp|Q8IYD8|FANCM_HUMAN Fanconi anemia group M protein OS=Homo sapiens GN=FANCM PE=1 SV=2 156 697 8.0E-129
sp|P40562|MPH1_YEAST ATP-dependent DNA helicase MPH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MPH1 PE=1 SV=1 67 738 2.0E-128
sp|Q8BGE5|FANCM_MOUSE Fanconi anemia group M protein homolog OS=Mus musculus GN=Fancm PE=1 SV=3 161 697 5.0E-127
sp|Q6CQX2|MPH1_KLULA ATP-dependent DNA helicase MPH1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=MPH1 PE=3 SV=2 148 570 1.0E-88
sp|Q58900|Y1505_METJA Putative ATP-dependent RNA helicase MJ1505 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ1505 PE=3 SV=2 161 656 2.0E-66
sp|Q6CQX2|MPH1_KLULA ATP-dependent DNA helicase MPH1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=MPH1 PE=3 SV=2 565 709 2.0E-30
sp|Q2VF18|DCL2_CRYPA Dicer-like protein 2 OS=Cryphonectria parasitica GN=DCL-2 PE=3 SV=1 171 644 2.0E-21
sp|Q0UI93|DCL1_PHANO Dicer-like protein 1 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=DCL1 PE=3 SV=2 171 669 3.0E-20
sp|A7LFZ6|DCL4_ORYSJ Endoribonuclease Dicer homolog 4 OS=Oryza sativa subsp. japonica GN=DCL4 PE=2 SV=1 171 653 1.0E-19
sp|A1C9M6|DCL2_ASPCL Dicer-like protein 2 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=dcl2 PE=3 SV=1 164 670 4.0E-19
sp|A1D9Z6|DCL2_NEOFI Dicer-like protein 2 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=dcl2 PE=3 SV=1 171 643 1.0E-18
sp|A4RHU9|DCL2_MAGO7 Dicer-like protein 2 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=DCL2 PE=3 SV=3 171 658 4.0E-18
sp|A1DE13|DCL1_NEOFI Dicer-like protein 1 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=dcl1 PE=3 SV=1 171 669 4.0E-17
sp|Q10HL3|DCL2A_ORYSJ Endoribonuclease Dicer homolog 2a OS=Oryza sativa subsp. japonica GN=DCL2A PE=2 SV=1 171 652 7.0E-17
sp|Q9GLV6|DDX58_PIG Probable ATP-dependent RNA helicase DDX58 OS=Sus scrofa GN=DDX58 PE=2 SV=1 185 643 4.0E-16
sp|Q69LX2|DCL2B_ORYSJ Endoribonuclease Dicer homolog 2b OS=Oryza sativa subsp. japonica GN=DCL2B PE=2 SV=2 171 650 2.0E-15
sp|Q4WVE3|DCL1_ASPFU Dicer-like protein 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=dcl1 PE=3 SV=3 171 669 4.0E-15
sp|Q7XD96|DCL3B_ORYSJ Endoribonuclease Dicer homolog 3b OS=Oryza sativa subsp. japonica GN=DCL3B PE=3 SV=2 177 652 7.0E-15
sp|Q8R5F7|IFIH1_MOUSE Interferon-induced helicase C domain-containing protein 1 OS=Mus musculus GN=Ifih1 PE=1 SV=1 170 663 9.0E-15
sp|Q1DW80|DCL2_COCIM Dicer-like protein 2 OS=Coccidioides immitis (strain RS) GN=DCL2 PE=3 SV=3 171 361 7.0E-14
sp|Q2UNX5|DCL2_ASPOR Dicer-like protein 2 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=dcl2 PE=3 SV=1 171 643 8.0E-14
sp|Q9SP32|DCL1_ARATH Endoribonuclease Dicer homolog 1 OS=Arabidopsis thaliana GN=DCL1 PE=1 SV=2 171 327 2.0E-11
sp|P84634|DCL4_ARATH Dicer-like protein 4 OS=Arabidopsis thaliana GN=DCL4 PE=1 SV=2 171 327 2.0E-11
sp|A0MQH0|DICER_CRIGR Endoribonuclease Dicer OS=Cricetulus griseus GN=DICER1 PE=2 SV=3 166 326 2.0E-11
sp|Q99J87|DHX58_MOUSE Probable ATP-dependent RNA helicase DHX58 OS=Mus musculus GN=Dhx58 PE=1 SV=2 511 641 2.0E-11
sp|Q9UPY3|DICER_HUMAN Endoribonuclease Dicer OS=Homo sapiens GN=DICER1 PE=1 SV=3 166 326 3.0E-11
sp|B3DLA6|DICER_XENTR Endoribonuclease Dicer OS=Xenopus tropicalis GN=dicer1 PE=2 SV=2 166 326 3.0E-11
sp|Q9BYX4|IFIH1_HUMAN Interferon-induced helicase C domain-containing protein 1 OS=Homo sapiens GN=IFIH1 PE=1 SV=3 513 663 4.0E-11
sp|Q6TUI4|DICER_BOVIN Endoribonuclease Dicer OS=Bos taurus GN=DICER1 PE=2 SV=3 166 326 4.0E-11
sp|Q8R418|DICER_MOUSE Endoribonuclease Dicer OS=Mus musculus GN=Dicer1 PE=1 SV=3 166 326 9.0E-11
sp|Q25BN1|DICER_CHICK Endoribonuclease Dicer OS=Gallus gallus GN=DICER1 PE=2 SV=3 166 326 1.0E-10
sp|Q0CEI2|DCL2_ASPTN Dicer-like protein 2 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=dcl2 PE=3 SV=2 508 643 1.0E-10
sp|Q5N870|DCL3A_ORYSJ Endoribonuclease Dicer homolog 3a OS=Oryza sativa subsp. japonica GN=DCL3A PE=2 SV=1 171 373 2.0E-10
sp|Q1DKI1|DCL1_COCIM Dicer-like protein 1 OS=Coccidioides immitis (strain RS) GN=DCL1 PE=3 SV=3 512 631 9.0E-10
sp|P0C5H7|DCL2_EMENI Dicer-like protein 2 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=dcl2 PE=3 SV=1 171 361 1.0E-09
sp|O95786|DDX58_HUMAN Probable ATP-dependent RNA helicase DDX58 OS=Homo sapiens GN=DDX58 PE=1 SV=2 534 643 2.0E-09
sp|Q0CW42|DCL1_ASPTN Dicer-like protein 1 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=dcl1 PE=3 SV=2 516 669 2.0E-09
sp|Q3EBC8|DCL2_ARATH Endoribonuclease Dicer homolog 2 OS=Arabidopsis thaliana GN=At3g03300 PE=1 SV=2 157 309 2.0E-09
sp|Q09884|DCR1_SCHPO Protein Dicer OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=dcr1 PE=1 SV=1 528 644 6.0E-09
sp|Q0UN57|PRP5_PHANO Pre-mRNA-processing ATP-dependent RNA helicase PRP5 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=PRP5 PE=3 SV=2 513 654 6.0E-09
sp|A4RKC3|DCL1_MAGO7 Dicer-like protein 1 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=DCL1 PE=3 SV=2 511 631 7.0E-09
sp|Q6TV19|DICER_DANRE Endoribonuclease Dicer OS=Danio rerio GN=dicer1 PE=2 SV=2 166 326 8.0E-09
sp|Q2VF19|DCL1_CRYPA Dicer-like protein 1 OS=Cryphonectria parasitica GN=DCL-1 PE=3 SV=1 513 668 1.0E-08
sp|A1CBC9|DCL1_ASPCL Dicer-like protein 1 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=dcl1 PE=3 SV=2 506 669 1.0E-08
sp|Q2H0G2|DCL1_CHAGB Dicer-like protein 1 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=DCL1 PE=3 SV=2 533 700 1.0E-08
sp|Q9LXW7|DCL3_ARATH Endoribonuclease Dicer homolog 3 OS=Arabidopsis thaliana GN=DCL3 PE=1 SV=2 173 326 2.0E-08
sp|Q96C10|DHX58_HUMAN Probable ATP-dependent RNA helicase DHX58 OS=Homo sapiens GN=DHX58 PE=1 SV=1 512 631 2.0E-08
sp|Q4WA22|DCL2_ASPFU Dicer-like protein 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=dcl2 PE=3 SV=2 171 327 5.0E-08
sp|Q0UL22|DCL2_PHANO Dicer-like protein 2 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=DCL2 PE=3 SV=2 170 361 6.0E-08
sp|Q2U6C4|DCL1_ASPOR Dicer-like protein 1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=dcl1 PE=3 SV=2 512 669 6.0E-08
sp|Q6Q899|DDX58_MOUSE Probable ATP-dependent RNA helicase DDX58 OS=Mus musculus GN=Ddx58 PE=1 SV=2 511 643 7.0E-08
sp|Q4WA22|DCL2_ASPFU Dicer-like protein 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=dcl2 PE=3 SV=2 522 643 8.0E-08
sp|Q7S8J7|DCL1_NEUCR Dicer-like protein 1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=dcl-1 PE=2 SV=1 513 634 8.0E-08
sp|A2RAF3|DCL1_ASPNC Dicer-like protein 1 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=dcl1 PE=3 SV=2 512 668 8.0E-08
sp|Q8LMR2|DCL1_ORYSJ Endoribonuclease Dicer homolog 1 OS=Oryza sativa subsp. japonica GN=DCL1 PE=3 SV=1 557 690 1.0E-07
sp|P25888|RHLE_ECOLI ATP-dependent RNA helicase RhlE OS=Escherichia coli (strain K12) GN=rhlE PE=1 SV=3 521 645 1.0E-07
sp|Q0UL22|DCL2_PHANO Dicer-like protein 2 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=DCL2 PE=3 SV=2 535 648 2.0E-07
sp|Q0DM51|RH3_ORYSJ DEAD-box ATP-dependent RNA helicase 3, chloroplastic OS=Oryza sativa subsp. japonica GN=Os03g0827700 PE=2 SV=2 575 675 2.0E-07
sp|Q54VT4|DDX47_DICDI Probable ATP-dependent RNA helicase ddx47 OS=Dictyostelium discoideum GN=ddx47 PE=3 SV=1 520 639 2.0E-07
sp|A2QX45|DCL22_ASPNC Dicer-like protein 2-2 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=dcl2-2 PE=3 SV=2 170 342 2.0E-07
sp|Q75F95|DRS1_ASHGO ATP-dependent RNA helicase DRS1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=DRS1 PE=3 SV=1 508 655 2.0E-07
sp|Q6FM43|PRP28_CANGA Pre-mRNA-splicing ATP-dependent RNA helicase PRP28 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=PRP28 PE=3 SV=1 535 662 2.0E-07
sp|A2RAF3|DCL1_ASPNC Dicer-like protein 1 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=dcl1 PE=3 SV=2 171 339 3.0E-07
sp|A2R345|DCL21_ASPNC Dicer-like protein 2-1 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=dcl2-1 PE=3 SV=2 551 663 3.0E-07
sp|Q7Y183|RH10_ORYSJ DEAD-box ATP-dependent RNA helicase 10 OS=Oryza sativa subsp. japonica GN=Os03g0669000 PE=2 SV=1 480 639 3.0E-07
sp|Q9SP32|DCL1_ARATH Endoribonuclease Dicer homolog 1 OS=Arabidopsis thaliana GN=DCL1 PE=1 SV=2 557 647 4.0E-07
sp|P44701|SRMB_HAEIN ATP-dependent RNA helicase SrmB OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=srmB PE=3 SV=1 504 634 4.0E-07
sp|A7TS37|RRP3_VANPO ATP-dependent rRNA helicase RRP3 OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=RRP3 PE=3 SV=1 517 644 4.0E-07
sp|P34529|DCR1_CAEEL Endoribonuclease dcr-1 OS=Caenorhabditis elegans GN=dcr-1 PE=1 SV=3 171 326 4.0E-07
sp|Q7SCC1|DCL2_NEUCR Dicer-like protein 2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=dcl-2 PE=2 SV=4 512 669 4.0E-07
sp|P0CQ98|PRP5_CRYNJ Pre-mRNA-processing ATP-dependent RNA helicase PRP5 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=PRP5 PE=3 SV=1 530 639 4.0E-07
sp|P0CQ99|PRP5_CRYNB Pre-mRNA-processing ATP-dependent RNA helicase PRP5 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=PRP5 PE=3 SV=1 530 639 4.0E-07
sp|A3LS22|RRP3_PICST ATP-dependent rRNA helicase RRP3 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=RRP3 PE=3 SV=3 522 644 5.0E-07
sp|Q4IP34|PRP5_GIBZE Pre-mRNA-processing ATP-dependent RNA helicase PRP5 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=PRP5 PE=3 SV=2 521 639 6.0E-07
sp|O22907|RH24_ARATH DEAD-box ATP-dependent RNA helicase 24 OS=Arabidopsis thaliana GN=RH24 PE=1 SV=2 522 654 7.0E-07
sp|Q6BQ61|RRP3_DEBHA ATP-dependent rRNA helicase RRP3 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=RRP3 PE=3 SV=2 522 634 7.0E-07
sp|Q8L7S8|RH3_ARATH DEAD-box ATP-dependent RNA helicase 3, chloroplastic OS=Arabidopsis thaliana GN=RH3 PE=1 SV=2 575 643 8.0E-07
sp|Q5ACU6|RRP3_CANAL ATP-dependent rRNA helicase RRP3 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=RRP3 PE=3 SV=2 519 644 9.0E-07
sp|Q0D1K3|PRP5_ASPTN Pre-mRNA-processing ATP-dependent RNA helicase prp5 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=prp5 PE=3 SV=1 527 639 9.0E-07
sp|Q10MH8|RH24_ORYSJ DEAD-box ATP-dependent RNA helicase 24 OS=Oryza sativa subsp. japonica GN=Os03g0308500 PE=2 SV=1 522 654 9.0E-07
sp|Q0CW42|DCL1_ASPTN Dicer-like protein 1 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=dcl1 PE=3 SV=2 102 371 1.0E-06
sp|A5DQF1|RRP3_PICGU ATP-dependent rRNA helicase RRP3 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=RRP3 PE=3 SV=2 521 634 1.0E-06
sp|Q1DHB2|PRP5_COCIM Pre-mRNA-processing ATP-dependent RNA helicase PRP5 OS=Coccidioides immitis (strain RS) GN=PRP5 PE=3 SV=1 513 665 1.0E-06
sp|P0C2N8|DRS1_NEUCR ATP-dependent RNA helicase drs1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=drh-11 PE=3 SV=1 575 643 1.0E-06
sp|Q75EW9|RRP3_ASHGO ATP-dependent rRNA helicase RRP3 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=RRP3 PE=3 SV=2 521 644 1.0E-06
sp|Q6CH58|RRP3_YARLI ATP-dependent rRNA helicase RRP3 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=RRP3 PE=3 SV=1 575 660 1.0E-06
sp|Q6HPE6|CSHA_BACHK DEAD-box ATP-dependent RNA helicase CshA OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=cshA PE=3 SV=1 567 653 1.0E-06
sp|Q81VG0|CSHA_BACAN DEAD-box ATP-dependent RNA helicase CshA OS=Bacillus anthracis GN=cshA PE=3 SV=1 567 653 1.0E-06
sp|A0R8U6|CSHA_BACAH DEAD-box ATP-dependent RNA helicase CshA OS=Bacillus thuringiensis (strain Al Hakam) GN=cshA PE=3 SV=1 567 653 1.0E-06
sp|Q81IT9|CSHA_BACCR DEAD-box ATP-dependent RNA helicase CshA OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=cshA PE=2 SV=2 567 653 1.0E-06
sp|Q63GX5|CSHA_BACCZ DEAD-box ATP-dependent RNA helicase CshA OS=Bacillus cereus (strain ZK / E33L) GN=cshA PE=3 SV=1 567 653 1.0E-06
sp|Q73EU1|CSHA_BACC1 DEAD-box ATP-dependent RNA helicase CshA OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=cshA PE=3 SV=1 567 653 1.0E-06
sp|Q8SR63|RRP3_ENCCU ATP-dependent rRNA helicase RRP3 OS=Encephalitozoon cuniculi (strain GB-M1) GN=RRP3 PE=3 SV=1 575 662 1.0E-06
sp|A3LP87|DBP8_PICST ATP-dependent RNA helicase DBP8 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=DBP8 PE=3 SV=2 575 694 2.0E-06
sp|Q2U2J6|PRP5_ASPOR Pre-mRNA-processing ATP-dependent RNA helicase prp5 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=prp5 PE=3 SV=1 524 639 2.0E-06
sp|Q9JIK5|DDX21_MOUSE Nucleolar RNA helicase 2 OS=Mus musculus GN=Ddx21 PE=1 SV=3 529 655 2.0E-06
sp|Q0ILZ4|RH9_ORYSJ DEAD-box ATP-dependent RNA helicase 9 OS=Oryza sativa subsp. japonica GN=Os12g0611200 PE=2 SV=1 510 642 2.0E-06
sp|Q3B8Q1|DDX21_RAT Nucleolar RNA helicase 2 OS=Rattus norvegicus GN=Ddx21 PE=2 SV=1 529 655 2.0E-06
sp|A1CQA9|PRP5_ASPCL Pre-mRNA-processing ATP-dependent RNA helicase prp5 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=prp5 PE=3 SV=1 513 665 2.0E-06
sp|Q9P7C7|PRP11_SCHPO Pre-mRNA-processing ATP-dependent RNA helicase prp11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=prp11 PE=3 SV=1 513 654 2.0E-06
sp|Q41382|RH7_SPIOL DEAD-box ATP-dependent RNA helicase 7 OS=Spinacia oleracea GN=RH7 PE=2 SV=1 529 645 3.0E-06
sp|Q9LUW6|RH9_ARATH DEAD-box ATP-dependent RNA helicase 9 OS=Arabidopsis thaliana GN=RH9 PE=2 SV=1 527 674 3.0E-06
sp|Q7SH33|PRP5_NEUCR Pre-mRNA-processing ATP-dependent RNA helicase prp-5 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=prp-5 PE=3 SV=1 521 639 3.0E-06
sp|Q9NR30|DDX21_HUMAN Nucleolar RNA helicase 2 OS=Homo sapiens GN=DDX21 PE=1 SV=5 529 655 4.0E-06
sp|Q4WT99|PRP5_ASPFU Pre-mRNA-processing ATP-dependent RNA helicase prp5 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=prp5 PE=3 SV=1 513 639 4.0E-06
sp|P42305|DBPA_BACSU ATP-dependent RNA helicase DbpA OS=Bacillus subtilis (strain 168) GN=dbpA PE=1 SV=2 574 639 4.0E-06
sp|A2QQA8|PRP5_ASPNC Pre-mRNA-processing ATP-dependent RNA helicase prp5 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=prp5 PE=3 SV=2 527 639 4.0E-06
sp|Q5BDW4|PRP5_EMENI Pre-mRNA-processing ATP-dependent RNA helicase prp5 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=prp5 PE=3 SV=1 513 639 4.0E-06
sp|Q6BLU9|PRP28_DEBHA Pre-mRNA-splicing ATP-dependent RNA helicase PRP28 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=PRP28 PE=3 SV=2 512 639 4.0E-06
sp|Q1DKI1|DCL1_COCIM Dicer-like protein 1 OS=Coccidioides immitis (strain RS) GN=DCL1 PE=3 SV=3 171 385 5.0E-06
sp|A1D373|PRP5_NEOFI Pre-mRNA-processing ATP-dependent RNA helicase prp5 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=prp5 PE=3 SV=1 513 639 5.0E-06
sp|Q8GY84|RH10_ARATH DEAD-box ATP-dependent RNA helicase 10 OS=Arabidopsis thaliana GN=RH10 PE=2 SV=2 575 653 5.0E-06
sp|P57453|DEAD_BUCAI ATP-dependent RNA helicase DeaD OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=deaD PE=3 SV=1 366 644 6.0E-06
sp|P0CR00|RRP3_CRYNJ ATP-dependent rRNA helicase RRP3 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=RRP3 PE=3 SV=1 575 644 7.0E-06
sp|P0CR01|RRP3_CRYNB ATP-dependent rRNA helicase RRP3 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=RRP3 PE=3 SV=1 575 644 7.0E-06
sp|Q8Y8N0|CSHA_LISMO ATP-dependent RNA helicase CshA OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=cshA PE=2 SV=1 567 634 7.0E-06
sp|Q9SA27|RH36_ARATH DEAD-box ATP-dependent RNA helicase 36 OS=Arabidopsis thaliana GN=RH36 PE=2 SV=1 577 662 8.0E-06
sp|Q9LUW5|RH53_ARATH DEAD-box ATP-dependent RNA helicase 53 OS=Arabidopsis thaliana GN=RH53 PE=2 SV=1 575 643 8.0E-06
sp|P0A9P8|DEAD_SHIFL ATP-dependent RNA helicase DeaD OS=Shigella flexneri GN=deaD PE=3 SV=2 522 644 9.0E-06
sp|P0A9P6|DEAD_ECOLI ATP-dependent RNA helicase DeaD OS=Escherichia coli (strain K12) GN=deaD PE=1 SV=2 522 644 9.0E-06
sp|P0A9P7|DEAD_ECOL6 ATP-dependent RNA helicase DeaD OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=deaD PE=3 SV=2 522 644 9.0E-06
sp|Q8XA87|DEAD_ECO57 ATP-dependent RNA helicase DeaD OS=Escherichia coli O157:H7 GN=deaD PE=3 SV=3 522 644 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0003676 nucleic acid binding Yes
GO:0005524 ATP binding Yes
GO:0016787 hydrolase activity Yes
GO:0003677 DNA binding Yes
GO:0017076 purine nucleotide binding No
GO:0005488 binding No
GO:0003674 molecular_function No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0000166 nucleotide binding No
GO:0043167 ion binding No
GO:0032553 ribonucleotide binding No
GO:0097367 carbohydrate derivative binding No
GO:0003824 catalytic activity No
GO:0043168 anion binding No
GO:0097159 organic cyclic compound binding No
GO:1901265 nucleoside phosphate binding No
GO:0032555 purine ribonucleotide binding No
GO:1901363 heterocyclic compound binding No
GO:0032559 adenyl ribonucleotide binding No
GO:0036094 small molecule binding No
GO:0030554 adenyl nucleotide binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 67 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|4324
MMLDDLDDEIADEDLLSAFEQVSSGSGNNARSRFPAPASLSSDQRPGLGSQASRSAAAQELRDLPPDAFSSPEPL
EQPQAHAQRPPPSKRHVTSRGAAPARTGLQRSSSSRQTTLWGTELIDAPLGSQTLSQTISARPFRTDTAREEPSH
HQLNRTAMETWVYPTNLGAIRDYQFSIVKNSLFNNTLVALPTGLGKTFIAATVMLNFYRWTETAKIVFVAPTKPL
VAQQVTACYSIAGIPRSDTTLLTGEIPPVLRVDEWQTKRVFFMTPQTLLNDISHGYADPKTIVLLVIDEAHRAVG
EYAYAKVTKLIRRYSKSFRVLALTATPGSKIETVQEVIDNLGISHCEIRTEESIDIRQYVHDRNTEVMVLDPSDE
MNLVSELFSQALKPLVDKLSSQNIYYGRNPMALTAYGLMQAQREWFATRGRNANQGVQFMMRATFSVLTSVAHSI
KLLNFHGIKPFYDNLFDFRNGVEGKGEQGSKYKRQLIEHPSFQEMMNKISGWLKLPSFVGHPKLTELASCVLNHF
MDQGDATRIIVFSEYRDSAEDIVCMLNKHRPLVKASVFVGQADGKRGEGMKQAQQIETIDKFKRGDFNVLVATSI
GEEGLDIGQVDLIVCYDSSASPIRMLQRMGRTGRKRAGNIVLLLMRGKEEEQFAKSKDSYEKMQQLICEGSRFNF
RFDLSTRIVPRDVRPEVDKRLVDIPIENTQNQSLPEPKKRRVPPGKKKPPKKFHMPDGVETGFQKLTHFIKPKAK
ADRGRPVKHSEVNDVVPIPDLESVMLTAAETEELDRSYRDLPFNHSMVEETDMPSMTAYPELQRRLQSAVNVKHG
EHTRRCVRVLGAMGLKPDSLVKPCRYTDESDFLEIPVREFINSDGEEEVGGSRATAMSEARLSIPGRARPLERSQ
EPRRKRKLSTRFDSQEPLNEEHESRPVLETSIQESDSATPPPASKRPKKAPRSKVGAKGRRGKQRGTGINSDELG
DDCEQDGDLLETSGSDDGEDLLDFVVADDASVSVNSQATPFPSSLDKRNSPPIETEPAYYVPMDFSATQDSQDMP
DVDALVDTACSNGQQDLTLEHDAIRTRRAVRRNRQRMSYDSDDD*
Coding >OphauB2|4324
ATGATGCTAGATGACTTGGACGACGAGATTGCCGATGAGGATCTTCTTTCGGCCTTTGAACAAGTCTCGTCTGGT
AGCGGCAACAATGCGCGGTCACGATTTCCGGCTCCGGCTTCTTTGAGTTCTGATCAGAGGCCTGGCTTAGGGTCC
CAGGCTTCGCGCTCAGCTGCAGCACAGGAGCTCCGAGACCTGCCTCCTGACGCCTTTTCGTCTCCCGAGCCTCTC
GAGCAGCCTCAAGCGCATGCTCAAAGGCCTCCACCGTCGAAACGTCATGTCACCAGTCGTGGTGCTGCGCCTGCC
AGGACTGGGCTTCAACGCTCCTCTTCCTCGCGACAGACGACTCTCTGGGGCACTGAACTCATTGATGCCCCTCTC
GGCTCTCAAACTCTATCTCAAACCATCAGCGCGCGCCCATTCCGAACAGACACTGCGAGGGAAGAACCAAGCCAT
CATCAGCTCAACAGAACGGCAATGGAGACCTGGGTCTATCCCACCAATCTTGGTGCCATCAGAGACTATCAGTTC
AGCATTGTTAAGAATAGCCTCTTCAATAACACGCTCGTGGCTTTGCCCACTGGACTTGGCAAAACCTTTATCGCT
GCCACGGTTATGTTGAACTTTTATCGATGGACTGAGACGGCCAAGATTGTCTTTGTGGCTCCGACAAAGCCCCTT
GTAGCCCAACAAGTGACGGCCTGCTACTCCATCGCGGGAATTCCACGATCTGATACGACACTGCTCACAGGAGAA
ATCCCACCTGTGCTGCGTGTCGATGAGTGGCAGACGAAGCGAGTCTTCTTCATGACGCCCCAGACGCTCCTCAAC
GATATTTCTCATGGTTACGCCGACCCCAAAACCATTGTGTTGCTCGTCATTGACGAGGCCCATCGCGCCGTGGGC
GAGTATGCGTATGCCAAGGTCACCAAGCTTATTCGCCGCTATTCGAAAAGCTTTCGCGTCTTGGCTCTGACGGCG
ACACCAGGGTCCAAGATTGAAACTGTACAGGAGGTTATTGATAACCTTGGCATCTCTCACTGCGAGATTCGTACC
GAGGAGTCCATTGACATTAGACAATACGTGCATGACAGAAACACAGAAGTCATGGTACTGGATCCTTCGGATGAA
ATGAATCTCGTTAGTGAGCTCTTTTCCCAAGCTCTGAAGCCTCTGGTGGACAAGCTCAGCTCGCAAAACATTTAC
TATGGGCGGAATCCTATGGCTCTTACGGCCTACGGCCTCATGCAAGCCCAGCGTGAATGGTTTGCTACACGCGGA
CGCAATGCCAATCAGGGTGTTCAATTCATGATGAGAGCCACTTTTAGCGTCTTGACCAGTGTCGCTCACTCCATC
AAACTGCTCAACTTTCACGGAATTAAGCCCTTTTACGATAATCTCTTCGATTTTCGCAATGGCGTGGAAGGCAAG
GGAGAGCAAGGATCAAAATATAAACGTCAATTGATTGAGCATCCGAGCTTCCAGGAAATGATGAACAAGATTTCG
GGCTGGCTCAAACTGCCTAGCTTTGTGGGCCACCCAAAACTGACTGAGCTGGCTAGCTGCGTCTTGAACCATTTC
ATGGACCAGGGCGACGCGACACGTATCATTGTCTTTAGCGAGTACCGTGATTCTGCCGAGGATATTGTATGCATG
CTCAACAAGCATCGGCCACTTGTCAAAGCTAGTGTTTTTGTCGGTCAGGCCGATGGCAAGCGAGGCGAAGGCATG
AAGCAAGCTCAGCAAATCGAGACGATTGACAAGTTCAAGAGAGGCGACTTCAACGTGCTGGTAGCCACCTCAATC
GGTGAAGAAGGCTTGGACATTGGGCAAGTCGATCTCATTGTCTGCTATGATTCATCAGCATCACCCATCCGGATG
CTTCAACGGATGGGACGGACAGGCCGAAAACGCGCCGGCAACATTGTGCTCTTGCTCATGAGGGGCAAGGAGGAG
GAACAGTTTGCCAAGTCCAAGGATAGTTACGAAAAGATGCAGCAACTCATATGTGAGGGCAGCAGATTCAACTTT
CGCTTCGACTTGTCAACACGCATCGTTCCACGCGACGTGCGCCCCGAAGTTGACAAGCGTCTTGTCGACATTCCT
ATTGAGAATACTCAGAATCAATCTCTACCAGAGCCCAAGAAGAGACGTGTCCCACCTGGCAAGAAGAAGCCACCA
AAGAAGTTCCACATGCCAGACGGCGTCGAGACGGGCTTCCAGAAGCTGACGCACTTTATCAAGCCAAAAGCCAAG
GCTGACCGAGGCAGGCCTGTCAAGCACTCTGAAGTAAACGATGTTGTCCCGATTCCAGACTTGGAGAGCGTTATG
CTCACCGCCGCGGAGACGGAGGAGCTGGACCGGTCCTACCGTGACCTACCCTTCAATCATAGTATGGTTGAGGAG
ACGGACATGCCCAGCATGACGGCATATCCAGAGTTGCAGAGACGGCTCCAGTCTGCGGTAAATGTGAAGCACGGC
GAGCATACGCGGCGCTGCGTCAGAGTTCTTGGAGCAATGGGCCTGAAACCAGATTCACTGGTAAAGCCATGTCGA
TATACCGATGAGAGCGATTTTCTGGAAATTCCTGTGAGAGAATTCATAAACTCGGATGGAGAAGAAGAAGTTGGA
GGCTCTCGGGCGACAGCCATGTCAGAAGCAAGATTGAGCATTCCCGGGCGAGCTAGACCACTTGAAAGAAGCCAG
GAGCCTAGGCGCAAAAGAAAGCTGTCAACAAGATTTGACTCTCAAGAACCTTTAAATGAGGAACATGAGTCGAGG
CCAGTACTAGAGACAAGCATACAAGAGAGCGACTCGGCAACGCCGCCCCCTGCCTCGAAACGGCCCAAGAAGGCT
CCAAGGTCGAAAGTCGGAGCCAAGGGTAGACGAGGGAAACAAAGAGGTACTGGCATCAACAGTGATGAACTCGGT
GACGACTGTGAGCAAGATGGCGATCTCTTGGAGACGAGCGGCTCTGATGATGGCGAGGATCTCCTGGACTTTGTG
GTTGCGGATGACGCGAGCGTATCGGTGAATTCGCAAGCGACGCCATTTCCTTCATCACTGGACAAGCGCAACAGT
CCACCAATAGAGACGGAGCCGGCCTATTATGTGCCGATGGACTTTTCTGCAACACAGGACAGCCAGGATATGCCA
GACGTGGACGCCTTGGTTGACACAGCTTGTAGCAATGGGCAACAAGACTTGACTTTGGAGCATGATGCCATCCGG
ACAAGAAGAGCTGTTAGACGAAATCGACAACGAATGAGCTACGACAGTGACGATGATTAG
Transcript >OphauB2|4324
ATGATGCTAGATGACTTGGACGACGAGATTGCCGATGAGGATCTTCTTTCGGCCTTTGAACAAGTCTCGTCTGGT
AGCGGCAACAATGCGCGGTCACGATTTCCGGCTCCGGCTTCTTTGAGTTCTGATCAGAGGCCTGGCTTAGGGTCC
CAGGCTTCGCGCTCAGCTGCAGCACAGGAGCTCCGAGACCTGCCTCCTGACGCCTTTTCGTCTCCCGAGCCTCTC
GAGCAGCCTCAAGCGCATGCTCAAAGGCCTCCACCGTCGAAACGTCATGTCACCAGTCGTGGTGCTGCGCCTGCC
AGGACTGGGCTTCAACGCTCCTCTTCCTCGCGACAGACGACTCTCTGGGGCACTGAACTCATTGATGCCCCTCTC
GGCTCTCAAACTCTATCTCAAACCATCAGCGCGCGCCCATTCCGAACAGACACTGCGAGGGAAGAACCAAGCCAT
CATCAGCTCAACAGAACGGCAATGGAGACCTGGGTCTATCCCACCAATCTTGGTGCCATCAGAGACTATCAGTTC
AGCATTGTTAAGAATAGCCTCTTCAATAACACGCTCGTGGCTTTGCCCACTGGACTTGGCAAAACCTTTATCGCT
GCCACGGTTATGTTGAACTTTTATCGATGGACTGAGACGGCCAAGATTGTCTTTGTGGCTCCGACAAAGCCCCTT
GTAGCCCAACAAGTGACGGCCTGCTACTCCATCGCGGGAATTCCACGATCTGATACGACACTGCTCACAGGAGAA
ATCCCACCTGTGCTGCGTGTCGATGAGTGGCAGACGAAGCGAGTCTTCTTCATGACGCCCCAGACGCTCCTCAAC
GATATTTCTCATGGTTACGCCGACCCCAAAACCATTGTGTTGCTCGTCATTGACGAGGCCCATCGCGCCGTGGGC
GAGTATGCGTATGCCAAGGTCACCAAGCTTATTCGCCGCTATTCGAAAAGCTTTCGCGTCTTGGCTCTGACGGCG
ACACCAGGGTCCAAGATTGAAACTGTACAGGAGGTTATTGATAACCTTGGCATCTCTCACTGCGAGATTCGTACC
GAGGAGTCCATTGACATTAGACAATACGTGCATGACAGAAACACAGAAGTCATGGTACTGGATCCTTCGGATGAA
ATGAATCTCGTTAGTGAGCTCTTTTCCCAAGCTCTGAAGCCTCTGGTGGACAAGCTCAGCTCGCAAAACATTTAC
TATGGGCGGAATCCTATGGCTCTTACGGCCTACGGCCTCATGCAAGCCCAGCGTGAATGGTTTGCTACACGCGGA
CGCAATGCCAATCAGGGTGTTCAATTCATGATGAGAGCCACTTTTAGCGTCTTGACCAGTGTCGCTCACTCCATC
AAACTGCTCAACTTTCACGGAATTAAGCCCTTTTACGATAATCTCTTCGATTTTCGCAATGGCGTGGAAGGCAAG
GGAGAGCAAGGATCAAAATATAAACGTCAATTGATTGAGCATCCGAGCTTCCAGGAAATGATGAACAAGATTTCG
GGCTGGCTCAAACTGCCTAGCTTTGTGGGCCACCCAAAACTGACTGAGCTGGCTAGCTGCGTCTTGAACCATTTC
ATGGACCAGGGCGACGCGACACGTATCATTGTCTTTAGCGAGTACCGTGATTCTGCCGAGGATATTGTATGCATG
CTCAACAAGCATCGGCCACTTGTCAAAGCTAGTGTTTTTGTCGGTCAGGCCGATGGCAAGCGAGGCGAAGGCATG
AAGCAAGCTCAGCAAATCGAGACGATTGACAAGTTCAAGAGAGGCGACTTCAACGTGCTGGTAGCCACCTCAATC
GGTGAAGAAGGCTTGGACATTGGGCAAGTCGATCTCATTGTCTGCTATGATTCATCAGCATCACCCATCCGGATG
CTTCAACGGATGGGACGGACAGGCCGAAAACGCGCCGGCAACATTGTGCTCTTGCTCATGAGGGGCAAGGAGGAG
GAACAGTTTGCCAAGTCCAAGGATAGTTACGAAAAGATGCAGCAACTCATATGTGAGGGCAGCAGATTCAACTTT
CGCTTCGACTTGTCAACACGCATCGTTCCACGCGACGTGCGCCCCGAAGTTGACAAGCGTCTTGTCGACATTCCT
ATTGAGAATACTCAGAATCAATCTCTACCAGAGCCCAAGAAGAGACGTGTCCCACCTGGCAAGAAGAAGCCACCA
AAGAAGTTCCACATGCCAGACGGCGTCGAGACGGGCTTCCAGAAGCTGACGCACTTTATCAAGCCAAAAGCCAAG
GCTGACCGAGGCAGGCCTGTCAAGCACTCTGAAGTAAACGATGTTGTCCCGATTCCAGACTTGGAGAGCGTTATG
CTCACCGCCGCGGAGACGGAGGAGCTGGACCGGTCCTACCGTGACCTACCCTTCAATCATAGTATGGTTGAGGAG
ACGGACATGCCCAGCATGACGGCATATCCAGAGTTGCAGAGACGGCTCCAGTCTGCGGTAAATGTGAAGCACGGC
GAGCATACGCGGCGCTGCGTCAGAGTTCTTGGAGCAATGGGCCTGAAACCAGATTCACTGGTAAAGCCATGTCGA
TATACCGATGAGAGCGATTTTCTGGAAATTCCTGTGAGAGAATTCATAAACTCGGATGGAGAAGAAGAAGTTGGA
GGCTCTCGGGCGACAGCCATGTCAGAAGCAAGATTGAGCATTCCCGGGCGAGCTAGACCACTTGAAAGAAGCCAG
GAGCCTAGGCGCAAAAGAAAGCTGTCAACAAGATTTGACTCTCAAGAACCTTTAAATGAGGAACATGAGTCGAGG
CCAGTACTAGAGACAAGCATACAAGAGAGCGACTCGGCAACGCCGCCCCCTGCCTCGAAACGGCCCAAGAAGGCT
CCAAGGTCGAAAGTCGGAGCCAAGGGTAGACGAGGGAAACAAAGAGGTACTGGCATCAACAGTGATGAACTCGGT
GACGACTGTGAGCAAGATGGCGATCTCTTGGAGACGAGCGGCTCTGATGATGGCGAGGATCTCCTGGACTTTGTG
GTTGCGGATGACGCGAGCGTATCGGTGAATTCGCAAGCGACGCCATTTCCTTCATCACTGGACAAGCGCAACAGT
CCACCAATAGAGACGGAGCCGGCCTATTATGTGCCGATGGACTTTTCTGCAACACAGGACAGCCAGGATATGCCA
GACGTGGACGCCTTGGTTGACACAGCTTGTAGCAATGGGCAACAAGACTTGACTTTGGAGCATGATGCCATCCGG
ACAAGAAGAGCTGTTAGACGAAATCGACAACGAATGAGCTACGACAGTGACGATGATTAG
Gene >OphauB2|4324
ATGATGCTAGATGACTTGGACGACGAGATTGCCGATGAGGATCTTCTTTCGGCCTTTGAACAAGTCTCGTCTGGT
AGCGGCAACAATGCGCGGTCACGATTTCCGGCTCCGGCTTCTTTGAGTTCTGATCAGAGGCCTGGCTTAGGGTCC
CAGGCTTCGCGCTCAGCTGCAGCACAGGAGCTCCGAGACCTGCCTCCTGACGCCTTTTCGTCTCCCGAGCCTCTC
GAGCAGCCTCAAGCGCATGCTCAAAGGCCTCCACCGTCGAAACGTCATGTCACCAGTCGTGGTGCTGCGCCTGCC
AGGACTGGGCTTCAACGCTCCTCTTCCTCGCGACAGACGACTCTCTGGGGCACTGAACTCATTGATGCCCCTCTC
GGCTCTCAAACTCTATCTCAAACCATCAGCGCGCGCCCATTCCGAACAGACACTGCGAGGGAAGAACCAAGCCAT
CATCAGCTCAACAGAACGGCAATGGAGACCTGGGTCTATCCCACCAATCTTGGTGCCATCAGAGACTATCAGTTC
AGCATTGTTAAGAATAGCCTCTTCAATAACACGCTCGTGGCTTTGCCCACTGGACTTGGCAAAACCTTTATCGCT
GCCACGGTTATGTTGAACTTTTATCGATGGACTGAGACGGCCAAGATTGTCTTTGTGGCTCCGACAAAGCCCCTT
GTAGCCCAACAAGTGACGGCCTGCTACTCCATCGCGGGAATTCCACGATCTGATACGACACTGCTCACAGGAGAA
ATCCCACCTGTGCTGCGTGTCGATGAGTGGCAGACGAAGCGAGTCTTCTTCATGACGCCCCAGACGCTCCTCAAC
GATATTTCTCATGGTTACGCCGACCCCAAAACCATTGTGTTGCTCGTCATTGACGAGGCCCATCGCGCCGTGGGC
GAGTATGCGTATGCCAAGGTCACCAAGCTTATTCGCCGCTATTCGAAAAGCTTTCGCGTCTTGGCTCTGACGGCG
ACACCAGGGTCCAAGATTGAAACTGTACAGGAGGTTATTGATAACCTTGGCATCTCTCACTGCGAGATTCGTACC
GAGGAGTCCATTGACATTAGACAATACGTGCATGACAGAAACACAGAAGTCATGGTACTGGATCCTTCGGATGAA
ATGAATCTCGTTAGTGAGCTCTTTTCCCAAGCTCTGAAGCCTCTGGTGGACAAGCTCAGCTCGCAAAACATTTAC
TATGGGCGGAATCCTATGGCTCTTACGGCCTACGGCCTCATGCAAGCCCAGCGTGAATGGTTTGCTACACGCGGA
CGCAATGCCAATCAGGGTGTTCAATTCATGATGAGAGCCACTTTTAGCGTCTTGACCAGTGTCGCTCACTCCATC
AAACTGCTCAACTTTCACGGAATTAAGCCCTTTTACGATAATCTCTTCGATTTTCGCAATGGCGTGGAAGGCAAG
GGAGAGCAAGGATCAAAATATAAACGTCAATTGATTGAGCATCCGAGCTTCCAGGAAATGATGAACAAGATTTCG
GGCTGGCTCAAACTGCCTAGCTTTGTGGGCCACCCAAAACTGACTGAGCTGGCTAGCTGCGTCTTGAACCATTTC
ATGGACCAGGGCGACGCGACACGTATCATTGTCTTTAGCGAGTACCGTGATTCTGCCGAGGATATTGTATGCATG
CTCAACAAGCATCGGCCACTTGTCAAAGCTAGTGTTTTTGTCGGTCAGGCCGATGGCAAGCGAGGCGAAGGCATG
AAGCAAGCTCAGCAAATCGAGACGATTGACAAGTTCAAGAGAGGCGACTTCAACGTGCTGGTAGCCACCTCAATC
GGTGAAGAAGGCTTGGACATTGGGCAAGTCGATCTCATTGTCTGCTATGATTCATCAGCATCACCCATCCGGATG
CTTCAACGGATGGGACGGACAGGCCGAAAACGCGCCGGCAACATTGTGCTCTTGCTCATGAGGGGCAAGGAGGAG
GAACAGTTTGCCAAGTCCAAGGATAGTTACGAAAAGATGCAGCAACTCATATGTGAGGGCAGCAGATTCAACTTT
CGCTTCGACTTGTCAACACGCATCGTTCCACGCGACGTGCGCCCCGAAGTTGACAAGCGTCTTGTCGACATTCCT
ATTGAGAATACTCAGAATCAATCTCTACCAGAGCCCAAGAAGAGACGTGTCCCACCTGGCAAGAAGAAGCCACCA
AAGAAGTTCCACATGCCAGACGGCGTCGAGACGGGCTTCCAGAAGCTGACGCACTTTATCAAGCCAAAAGCCAAG
GCTGACCGAGGCAGGCCTGTCAAGCACTCTGAAGTAAACGATGTTGTCCCGATTCCAGACTTGGAGAGCGTTATG
CTCACCGCCGCGGAGACGGAGGAGCTGGACCGGTCCTACCGTGACCTACCCTTCAATCATAGTATGGTTGAGGAG
ACGGACATGCCCAGCATGACGGCATATCCAGAGTTGCAGAGACGGCTCCAGTCTGCGGTAAATGTGAAGCACGGC
GAGCATACGCGGCGCTGCGTCAGAGTTCTTGGAGCAATGGGCCTGAAACCAGATTCACTGGTAAAGCCATGTCGA
TATACCGATGAGAGCGATTTTCTGGAAATTCCTGTGAGAGAATTCATAAACTCGGATGGAGAAGAAGAAGTTGGA
GGCTCTCGGGCGACAGCCATGTCAGAAGCAAGATTGAGCATTCCCGGGCGAGCTAGACCACTTGAAAGAAGCCAG
GAGCCTAGGCGCAAAAGAAAGCTGTCAACAAGATTTGACTCTCAAGAACCTTTAAATGAGGAACATGAGTCGAGG
CCAGTACTAGAGACAAGCATACAAGAGAGCGACTCGGCAACGCCGCCCCCTGCCTCGAAACGGCCCAAGAAGGCT
CCAAGGTCGAAAGTCGGAGCCAAGGGTAGACGAGGGAAACAAAGAGGTACTGGCATCAACAGTGATGAACTCGGT
GACGACTGTGAGCAAGATGGCGATCTCTTGGAGACGAGCGGCTCTGATGATGGCGAGGATCTCCTGGACTTTGTG
GTTGCGGATGACGCGAGCGTATCGGTGAATTCGCAAGCGACGCCATTTCCTTCATCACTGGACAAGCGCAACAGT
CCACCAATAGAGACGGAGCCGGCCTATTATGTGCCGATGGACTTTTCTGCAACACAGGACAGCCAGGATATGCCA
GACGTGGACGCCTTGGTTGACACAGCTTGTAGCAATGGGCAACAAGACTTGACTTTGGAGCATGATGCCATCCGG
ACAAGAAGAGCTGTTAGACGAAATCGACAACGAATGAGCTACGACAGTGACGATGATTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail