Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|4323
Gene name
LocationContig_29:92622..93278
Strand-
Gene length (bp)656
Transcript length (bp)588
Coding sequence length (bp)588
Protein length (aa) 196

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q06485|ATG33_YEAST Autophagy-related protein 33 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ATG33 PE=1 SV=1 8 186 7.0E-07
sp|C8ZDW3|ATG33_YEAS8 Autophagy-related protein 33 OS=Saccharomyces cerevisiae (strain Lalvin EC1118 / Prise de mousse) GN=ATG33 PE=3 SV=1 8 186 2.0E-06
sp|A7A1N4|ATG33_YEAS7 Autophagy-related protein 33 OS=Saccharomyces cerevisiae (strain YJM789) GN=ATG33 PE=3 SV=1 8 186 2.0E-06
sp|C7GRY1|ATG33_YEAS2 Autophagy-related protein 33 OS=Saccharomyces cerevisiae (strain JAY291) GN=ATG33 PE=3 SV=1 8 186 2.0E-06
sp|B3RHM5|ATG33_YEAS1 Autophagy-related protein 33 OS=Saccharomyces cerevisiae (strain RM11-1a) GN=ATG33 PE=3 SV=1 8 186 2.0E-06

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 18 0.5

Transmembrane Domains

Domain # Start End Length
1 9 31 22
2 62 79 17
3 163 185 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|4323
MACAGARALSVLKFVGTVSLGLLTGVSYTVSAVSLPSLLSLPSSASASHAITSLTTGLKTPLTVLTALASGPLLV
SFILSPRSVRHPYLAYTSLLAGLSMAVPLLLPQPQPRQSAAKKQARRSKMEASYEVLGEPQSESTSEGEADDMNG
EEVRTQVEGLSRAFLVRTSLAGLGFAMSVLGIWGDGVPQSLVFVS*
Coding >OphauB2|4323
ATGGCGTGCGCGGGAGCCAGAGCCCTTTCTGTGCTCAAGTTTGTGGGCACTGTGTCCCTCGGTTTGTTGACGGGC
GTCTCCTACACCGTTTCGGCTGTGTCGCTGCCTAGTCTTCTCTCCCTGCCGTCATCGGCCTCGGCCTCACATGCC
ATTACGTCGCTTACCACGGGCCTCAAGACGCCGCTGACGGTGCTTACGGCTCTCGCATCCGGCCCGCTCCTTGTT
TCCTTTATTTTGTCTCCGCGATCGGTTCGACACCCGTATCTGGCCTATACGTCGCTGCTTGCTGGGCTTTCAATG
GCTGTGCCGCTTCTCTTGCCTCAGCCGCAGCCGCGCCAGTCGGCTGCCAAGAAGCAGGCTCGTCGGTCCAAGATG
GAAGCAAGCTACGAGGTGCTGGGTGAGCCGCAGAGTGAGTCGACGAGTGAGGGCGAGGCCGATGACATGAATGGC
GAGGAGGTCCGGACTCAGGTTGAGGGTCTGTCGAGGGCCTTTTTGGTACGGACAAGTCTGGCTGGGCTGGGTTTT
GCCATGTCTGTTTTGGGAATCTGGGGTGATGGTGTGCCTCAGAGTCTTGTCTTTGTGTCGTGA
Transcript >OphauB2|4323
ATGGCGTGCGCGGGAGCCAGAGCCCTTTCTGTGCTCAAGTTTGTGGGCACTGTGTCCCTCGGTTTGTTGACGGGC
GTCTCCTACACCGTTTCGGCTGTGTCGCTGCCTAGTCTTCTCTCCCTGCCGTCATCGGCCTCGGCCTCACATGCC
ATTACGTCGCTTACCACGGGCCTCAAGACGCCGCTGACGGTGCTTACGGCTCTCGCATCCGGCCCGCTCCTTGTT
TCCTTTATTTTGTCTCCGCGATCGGTTCGACACCCGTATCTGGCCTATACGTCGCTGCTTGCTGGGCTTTCAATG
GCTGTGCCGCTTCTCTTGCCTCAGCCGCAGCCGCGCCAGTCGGCTGCCAAGAAGCAGGCTCGTCGGTCCAAGATG
GAAGCAAGCTACGAGGTGCTGGGTGAGCCGCAGAGTGAGTCGACGAGTGAGGGCGAGGCCGATGACATGAATGGC
GAGGAGGTCCGGACTCAGGTTGAGGGTCTGTCGAGGGCCTTTTTGGTACGGACAAGTCTGGCTGGGCTGGGTTTT
GCCATGTCTGTTTTGGGAATCTGGGGTGATGGTGTGCCTCAGAGTCTTGTCTTTGTGTCGTGA
Gene >OphauB2|4323
ATGGCGTGCGCGGGAGCCAGAGCCCTTTCTGTGCTCAAGTTTGTGGGCACTGTGTCCCTCGGTTTGTTGACGGTA
CGTCGCTCGGGCCGTCGCCTGTTGAGCTTTGCTCGTGTCATGCTAATTCATGCTGGCGGGTGCAGGGCGTCTCCT
ACACCGTTTCGGCTGTGTCGCTGCCTAGTCTTCTCTCCCTGCCGTCATCGGCCTCGGCCTCACATGCCATTACGT
CGCTTACCACGGGCCTCAAGACGCCGCTGACGGTGCTTACGGCTCTCGCATCCGGCCCGCTCCTTGTTTCCTTTA
TTTTGTCTCCGCGATCGGTTCGACACCCGTATCTGGCCTATACGTCGCTGCTTGCTGGGCTTTCAATGGCTGTGC
CGCTTCTCTTGCCTCAGCCGCAGCCGCGCCAGTCGGCTGCCAAGAAGCAGGCTCGTCGGTCCAAGATGGAAGCAA
GCTACGAGGTGCTGGGTGAGCCGCAGAGTGAGTCGACGAGTGAGGGCGAGGCCGATGACATGAATGGCGAGGAGG
TCCGGACTCAGGTTGAGGGTCTGTCGAGGGCCTTTTTGGTACGGACAAGTCTGGCTGGGCTGGGTTTTGCCATGT
CTGTTTTGGGAATCTGGGGTGATGGTGTGCCTCAGAGTCTTGTCTTTGTGTCGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail