Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|4321
Gene name
LocationContig_29:85380..90509
Strand-
Gene length (bp)5129
Transcript length (bp)5055
Coding sequence length (bp)5055
Protein length (aa) 1685

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00270 DEAD DEAD/DEAH box helicase 4.1E-21 817 989
PF09382 RQC RQC domain 1.8E-16 1218 1330
PF00271 Helicase_C Helicase conserved C-terminal domain 6.9E-13 1040 1135
PF16124 RecQ_Zn_bind RecQ zinc-binding 2.8E-14 1148 1213
PF04851 ResIII Type III restriction enzyme, res subunit 1.2E-07 813 985

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q09811|HUS2_SCHPO ATP-dependent DNA helicase hus2/rqh1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rqh1 PE=1 SV=1 724 1527 3.0E-158
sp|P35187|SGS1_YEAST ATP-dependent helicase SGS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SGS1 PE=1 SV=1 797 1329 5.0E-151
sp|P46063|RECQ1_HUMAN ATP-dependent DNA helicase Q1 OS=Homo sapiens GN=RECQL PE=1 SV=3 797 1313 8.0E-128
sp|Q5RF63|RECQ1_PONAB ATP-dependent DNA helicase Q1 OS=Pongo abelii GN=RECQL PE=2 SV=1 797 1313 1.0E-127
sp|Q6AYJ1|RECQ1_RAT ATP-dependent DNA helicase Q1 OS=Rattus norvegicus GN=Recql PE=1 SV=1 797 1312 2.0E-124
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q09811|HUS2_SCHPO ATP-dependent DNA helicase hus2/rqh1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rqh1 PE=1 SV=1 724 1527 3.0E-158
sp|P35187|SGS1_YEAST ATP-dependent helicase SGS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SGS1 PE=1 SV=1 797 1329 5.0E-151
sp|P46063|RECQ1_HUMAN ATP-dependent DNA helicase Q1 OS=Homo sapiens GN=RECQL PE=1 SV=3 797 1313 8.0E-128
sp|Q5RF63|RECQ1_PONAB ATP-dependent DNA helicase Q1 OS=Pongo abelii GN=RECQL PE=2 SV=1 797 1313 1.0E-127
sp|Q6AYJ1|RECQ1_RAT ATP-dependent DNA helicase Q1 OS=Rattus norvegicus GN=Recql PE=1 SV=1 797 1312 2.0E-124
sp|Q9Z129|RECQ1_MOUSE ATP-dependent DNA helicase Q1 OS=Mus musculus GN=Recql PE=1 SV=2 797 1312 2.0E-123
sp|Q9VGI8|BLM_DROME Bloom syndrome protein homolog OS=Drosophila melanogaster GN=Blm PE=1 SV=1 809 1306 2.0E-122
sp|Q8L840|RQL4A_ARATH ATP-dependent DNA helicase Q-like 4A OS=Arabidopsis thaliana GN=RECQL4A PE=2 SV=1 797 1293 1.0E-119
sp|P54132|BLM_HUMAN Bloom syndrome protein OS=Homo sapiens GN=BLM PE=1 SV=1 800 1317 2.0E-117
sp|Q9I920|BLM_CHICK Bloom syndrome protein homolog (Fragment) OS=Gallus gallus GN=BLM PE=2 SV=1 793 1317 8.0E-117
sp|O88700|BLM_MOUSE Bloom syndrome protein homolog OS=Mus musculus GN=Blm PE=1 SV=1 800 1316 1.0E-116
sp|Q9FT73|MED34_ARATH Mediator of RNA polymerase II transcription subunit 34 OS=Arabidopsis thaliana GN=MED34 PE=1 SV=1 809 1324 3.0E-116
sp|Q9FT70|RQL4B_ARATH ATP-dependent DNA helicase Q-like 4B OS=Arabidopsis thaliana GN=RECQL4B PE=2 SV=1 797 1355 9.0E-116
sp|Q9DEY9|BLM_XENLA Bloom syndrome protein homolog OS=Xenopus laevis GN=blm PE=2 SV=1 798 1317 1.0E-113
sp|Q9TXJ8|RECQ1_CAEEL Putative ATP-dependent DNA helicase Q1 OS=Caenorhabditis elegans GN=K02F3.12 PE=3 SV=3 797 1235 1.0E-111
sp|O18017|BLM_CAEEL Bloom syndrome protein homolog OS=Caenorhabditis elegans GN=him-6 PE=2 SV=2 786 1292 2.0E-111
sp|A8WK63|RECQ1_CAEBR Putative ATP-dependent DNA helicase Q1 OS=Caenorhabditis briggsae GN=CBG24191 PE=3 SV=1 797 1213 1.0E-109
sp|Q9FT74|RQL1_ARATH ATP-dependent DNA helicase Q-like 1 OS=Arabidopsis thaliana GN=RECQL1 PE=2 SV=1 809 1213 6.0E-107
sp|Q9FT72|RQL3_ARATH ATP-dependent DNA helicase Q-like 3 OS=Arabidopsis thaliana GN=RECQL3 PE=1 SV=1 803 1220 2.0E-96
sp|Q9CL21|RECQ_PASMU ATP-dependent DNA helicase RecQ OS=Pasteurella multocida (strain Pm70) GN=recQ PE=3 SV=1 804 1212 4.0E-92
sp|P71359|RECQ_HAEIN ATP-dependent DNA helicase RecQ OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=recQ PE=3 SV=1 799 1212 2.0E-91
sp|P15043|RECQ_ECOLI ATP-dependent DNA helicase RecQ OS=Escherichia coli (strain K12) GN=recQ PE=1 SV=5 802 1212 6.0E-91
sp|Q8VID5|RECQ5_MOUSE ATP-dependent DNA helicase Q5 OS=Mus musculus GN=Recql5 PE=1 SV=1 801 1214 5.0E-90
sp|P40724|RECQ_SALTY ATP-dependent DNA helicase RecQ OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=recQ PE=3 SV=3 802 1212 7.0E-90
sp|D4ACP5|RECQ5_RAT ATP-dependent DNA helicase Q5 OS=Rattus norvegicus GN=Recql5 PE=1 SV=1 801 1214 2.0E-89
sp|O94762|RECQ5_HUMAN ATP-dependent DNA helicase Q5 OS=Homo sapiens GN=RECQL5 PE=1 SV=2 801 1214 8.0E-89
sp|Q5UPX0|YR290_MIMIV Putative ATP-dependent RNA helicase R290 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R290 PE=3 SV=1 814 1284 4.0E-80
sp|Q19546|WRN_CAEEL Probable Werner syndrome ATP-dependent helicase homolog 1 OS=Caenorhabditis elegans GN=wrn-1 PE=3 SV=2 805 1212 2.0E-77
sp|O34748|RECQ_BACSU Probable ATP-dependent DNA helicase RecQ OS=Bacillus subtilis (strain 168) GN=recQ PE=3 SV=1 802 1212 9.0E-73
sp|O93530|WRN_XENLA Werner syndrome ATP-dependent helicase homolog OS=Xenopus laevis GN=wrn PE=2 SV=1 805 1214 2.0E-72
sp|Q14191|WRN_HUMAN Werner syndrome ATP-dependent helicase OS=Homo sapiens GN=WRN PE=1 SV=2 805 1225 2.0E-66
sp|O09053|WRN_MOUSE Werner syndrome ATP-dependent helicase homolog OS=Mus musculus GN=Wrn PE=1 SV=3 805 1213 5.0E-66
sp|P50729|RECS_BACSU Probable ATP-dependent DNA helicase RecS OS=Bacillus subtilis (strain 168) GN=recS PE=3 SV=1 801 1166 2.0E-65
sp|Q0WVW7|RQL5_ARATH ATP-dependent DNA helicase Q-like 5 OS=Arabidopsis thaliana GN=RECQL5 PE=2 SV=2 800 1165 7.0E-56
sp|P73421|RECQ_SYNY3 ATP-dependent DNA helicase RecQ OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=recQ PE=3 SV=1 814 1142 2.0E-54
sp|O94761|RECQ4_HUMAN ATP-dependent DNA helicase Q4 OS=Homo sapiens GN=RECQL4 PE=1 SV=1 704 1157 3.0E-51
sp|Q75NR7|RECQ4_MOUSE ATP-dependent DNA helicase Q4 OS=Mus musculus GN=Recql4 PE=2 SV=2 762 1144 2.0E-50
sp|Q9FT69|RQSIM_ARATH ATP-dependent DNA helicase Q-like SIM OS=Arabidopsis thaliana GN=RECQSIM PE=2 SV=1 797 1055 6.0E-37
sp|Q9FT69|RQSIM_ARATH ATP-dependent DNA helicase Q-like SIM OS=Arabidopsis thaliana GN=RECQSIM PE=2 SV=1 1041 1215 2.0E-28
sp|P0CT33|TLH1_SCHPO ATP-dependent DNA helicase tlh1 (Fragment) OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tlh1 PE=3 SV=1 818 1149 9.0E-25
sp|Q1RKN3|TLH2_SCHPO ATP-dependent DNA helicase tlh2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tlh2 PE=2 SV=1 818 1149 1.0E-24
sp|Q4PFD9|PRP5_USTMA Pre-mRNA-processing ATP-dependent RNA helicase PRP5 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=PRP5 PE=3 SV=1 818 1164 5.0E-12
sp|Q5VQL1|RH14_ORYSJ DEAD-box ATP-dependent RNA helicase 14 OS=Oryza sativa subsp. japonica GN=Os01g0172200 PE=2 SV=1 818 1216 8.0E-12
sp|Q2HAD8|PRP5_CHAGB Pre-mRNA-processing ATP-dependent RNA helicase PRP5 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=PRP5 PE=3 SV=1 818 1144 9.0E-12
sp|Q7SH33|PRP5_NEUCR Pre-mRNA-processing ATP-dependent RNA helicase prp-5 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=prp-5 PE=3 SV=1 783 1144 9.0E-12
sp|Q5R4I9|DDX5_PONAB Probable ATP-dependent RNA helicase DDX5 OS=Pongo abelii GN=DDX5 PE=2 SV=1 818 1158 1.0E-11
sp|Q9C718|RH20_ARATH DEAD-box ATP-dependent RNA helicase 20 OS=Arabidopsis thaliana GN=RH20 PE=2 SV=1 818 1179 1.0E-11
sp|P17844|DDX5_HUMAN Probable ATP-dependent RNA helicase DDX5 OS=Homo sapiens GN=DDX5 PE=1 SV=1 818 1158 1.0E-11
sp|Q61656|DDX5_MOUSE Probable ATP-dependent RNA helicase DDX5 OS=Mus musculus GN=Ddx5 PE=1 SV=2 818 1158 1.0E-11
sp|Q84UQ1|RH42_ORYSJ DEAD-box ATP-dependent RNA helicase 42 OS=Oryza sativa subsp. japonica GN=Os08g0159900 PE=2 SV=1 772 1157 2.0E-11
sp|Q4R6M5|DDX5_MACFA Probable ATP-dependent RNA helicase DDX5 OS=Macaca fascicularis GN=DDX5 PE=2 SV=1 818 1158 2.0E-11
sp|Q5QMN3|RH20_ORYSJ DEAD-box ATP-dependent RNA helicase 20 OS=Oryza sativa subsp. japonica GN=Os01g0197200 PE=3 SV=2 818 1157 4.0E-11
sp|Q92841|DDX17_HUMAN Probable ATP-dependent RNA helicase DDX17 OS=Homo sapiens GN=DDX17 PE=1 SV=2 818 1157 4.0E-11
sp|Q501J6|DDX17_MOUSE Probable ATP-dependent RNA helicase DDX17 OS=Mus musculus GN=Ddx17 PE=1 SV=1 818 1157 4.0E-11
sp|A5A6J2|DDX5_PANTR Probable ATP-dependent RNA helicase DDX5 OS=Pan troglodytes GN=DDX5 PE=2 SV=1 818 1158 6.0E-11
sp|Q0D1K3|PRP5_ASPTN Pre-mRNA-processing ATP-dependent RNA helicase prp5 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=prp5 PE=3 SV=1 783 1144 1.0E-10
sp|Q2U2J6|PRP5_ASPOR Pre-mRNA-processing ATP-dependent RNA helicase prp5 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=prp5 PE=3 SV=1 807 1144 1.0E-10
sp|P46942|DB10_NICSY ATP-dependent RNA helicase-like protein DB10 OS=Nicotiana sylvestris PE=2 SV=1 703 1149 2.0E-10
sp|Q755N4|DBP2_ASHGO ATP-dependent RNA helicase DBP2 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=DBP2 PE=3 SV=2 818 1158 3.0E-10
sp|Q4WT99|PRP5_ASPFU Pre-mRNA-processing ATP-dependent RNA helicase prp5 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=prp5 PE=3 SV=1 783 1144 3.0E-10
sp|A1D373|PRP5_NEOFI Pre-mRNA-processing ATP-dependent RNA helicase prp5 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=prp5 PE=3 SV=1 783 1144 3.0E-10
sp|A2QQA8|PRP5_ASPNC Pre-mRNA-processing ATP-dependent RNA helicase prp5 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=prp5 PE=3 SV=2 783 1144 6.0E-10
sp|Q9LYJ9|RH46_ARATH DEAD-box ATP-dependent RNA helicase 46 OS=Arabidopsis thaliana GN=RH46 PE=2 SV=2 772 1166 7.0E-10
sp|Q4PHU9|DBP2_USTMA ATP-dependent RNA helicase DBP2 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=DBP2 PE=3 SV=2 818 1158 9.0E-10
sp|Q5BDW4|PRP5_EMENI Pre-mRNA-processing ATP-dependent RNA helicase prp5 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=prp5 PE=3 SV=1 783 1145 9.0E-10
sp|Q55BR9|DDX49_DICDI Probable ATP-dependent RNA helicase ddx49 OS=Dictyostelium discoideum GN=ddx49 PE=3 SV=1 818 1154 9.0E-10
sp|Q5N7W4|RH30_ORYSJ DEAD-box ATP-dependent RNA helicase 30 OS=Oryza sativa subsp. japonica GN=Os01g0911100 PE=2 SV=2 818 1157 1.0E-09
sp|A1CQA9|PRP5_ASPCL Pre-mRNA-processing ATP-dependent RNA helicase prp5 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=prp5 PE=3 SV=1 818 1144 2.0E-09
sp|Q55D61|IF4A_DICDI Eukaryotic initiation factor 4A OS=Dictyostelium discoideum GN=tifA PE=3 SV=1 1044 1156 2.0E-09
sp|A6RGE3|DBP2_AJECN ATP-dependent RNA helicase DBP2 OS=Ajellomyces capsulatus (strain NAm1 / WU24) GN=DBP2 PE=3 SV=1 740 1176 2.0E-09
sp|Q2HEB0|PRP28_CHAGB Pre-mRNA-splicing ATP-dependent RNA helicase PRP28 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=PRP28 PE=3 SV=1 1045 1158 3.0E-09
sp|Q94A52|RH2_ARATH DEAD-box ATP-dependent RNA helicase 2 OS=Arabidopsis thaliana GN=RH2 PE=2 SV=2 818 1156 3.0E-09
sp|Q9FNM7|RH26_ARATH DEAD-box ATP-dependent RNA helicase 26 OS=Arabidopsis thaliana GN=RH26 PE=1 SV=2 826 1144 3.0E-09
sp|A3LQ01|DED1_PICST ATP-dependent RNA helicase DED1 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=DED1 PE=3 SV=3 798 1157 3.0E-09
sp|Q4IP34|PRP5_GIBZE Pre-mRNA-processing ATP-dependent RNA helicase PRP5 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=PRP5 PE=3 SV=2 818 1144 3.0E-09
sp|A5DZE6|DED1_LODEL ATP-dependent RNA helicase DED1 OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=DED1 PE=3 SV=1 798 1157 3.0E-09
sp|Q10055|FAL1_SCHPO ATP-dependent RNA helicase fal1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tif412 PE=1 SV=1 1044 1156 3.0E-09
sp|Q49Z29|CSHA_STAS1 DEAD-box ATP-dependent RNA helicase CshA OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=cshA PE=3 SV=1 818 1156 3.0E-09
sp|O13983|HRQ1_SCHPO ATP-dependent helicase hrq1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=hrq1 PE=1 SV=4 812 1139 3.0E-09
sp|Q5RC67|DDX23_PONAB Probable ATP-dependent RNA helicase DDX23 OS=Pongo abelii GN=DDX23 PE=2 SV=1 818 1156 4.0E-09
sp|Q1DP69|DBP2_COCIM ATP-dependent RNA helicase DBP2 OS=Coccidioides immitis (strain RS) GN=DBP2 PE=3 SV=2 737 1157 4.0E-09
sp|Q4L7W0|CSHA_STAHJ DEAD-box ATP-dependent RNA helicase CshA OS=Staphylococcus haemolyticus (strain JCSC1435) GN=cshA PE=3 SV=1 818 1162 4.0E-09
sp|Q9BUQ8|DDX23_HUMAN Probable ATP-dependent RNA helicase DDX23 OS=Homo sapiens GN=DDX23 PE=1 SV=3 818 1156 4.0E-09
sp|Q9VHS8|IF4A3_DROME Eukaryotic initiation factor 4A-III OS=Drosophila melanogaster GN=eIF4AIII PE=1 SV=1 1044 1156 4.0E-09
sp|P27639|IF4A_CAEEL Eukaryotic initiation factor 4A OS=Caenorhabditis elegans GN=inf-1 PE=2 SV=1 834 1156 4.0E-09
sp|Q9P7C7|PRP11_SCHPO Pre-mRNA-processing ATP-dependent RNA helicase prp11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=prp11 PE=3 SV=1 818 1144 4.0E-09
sp|P0CQ72|FAL1_CRYNJ ATP-dependent RNA helicase FAL1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=FAL1 PE=3 SV=1 1044 1156 6.0E-09
sp|P0CQ73|FAL1_CRYNB ATP-dependent RNA helicase FAL1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=FAL1 PE=3 SV=1 1044 1156 6.0E-09
sp|A5E058|PRP5_LODEL Pre-mRNA-processing ATP-dependent RNA helicase PRP5 OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=PRP5 PE=3 SV=1 818 1144 6.0E-09
sp|Q5B0J9|DBP2_EMENI ATP-dependent RNA helicase dbp2 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=dbp2 PE=3 SV=1 818 1158 6.0E-09
sp|A6RW79|PRP5_BOTFB Pre-mRNA-processing ATP-dependent RNA helicase prp5 OS=Botryotinia fuckeliana (strain B05.10) GN=prp5 PE=3 SV=1 818 1144 7.0E-09
sp|Q9NXZ2|DDX43_HUMAN Probable ATP-dependent RNA helicase DDX43 OS=Homo sapiens GN=DDX43 PE=2 SV=2 818 1157 7.0E-09
sp|Q6CIV2|DBP2_KLULA ATP-dependent RNA helicase DBP2 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=DBP2 PE=3 SV=1 818 1155 7.0E-09
sp|Q3EBD3|RH41_ARATH DEAD-box ATP-dependent RNA helicase 41 OS=Arabidopsis thaliana GN=RH41 PE=2 SV=1 818 1175 8.0E-09
sp|Q2GWJ5|FAL1_CHAGB ATP-dependent RNA helicase FAL1 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=FAL1 PE=3 SV=1 1044 1156 8.0E-09
sp|P0CQ76|DBP2_CRYNJ ATP-dependent RNA helicase DBP2-A OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=DBP2 PE=3 SV=1 818 1157 8.0E-09
sp|P0CQ77|DBP2_CRYNB ATP-dependent RNA helicase DBP2-A OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=DBP2 PE=3 SV=1 818 1157 8.0E-09
sp|Q8CRP6|CSHA_STAES DEAD-box ATP-dependent RNA helicase CshA OS=Staphylococcus epidermidis (strain ATCC 12228) GN=cshA PE=3 SV=1 818 1156 9.0E-09
sp|A6ZRX0|DBP2_YEAS7 ATP-dependent RNA helicase DBP2 OS=Saccharomyces cerevisiae (strain YJM789) GN=DBP2 PE=3 SV=1 818 1158 9.0E-09
sp|Q1DTB3|FAL1_COCIM ATP-dependent RNA helicase FAL1 OS=Coccidioides immitis (strain RS) GN=FAL1 PE=3 SV=2 1044 1156 9.0E-09
sp|Q55804|CRHR_SYNY3 RNA helicase CrhR OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=crhR PE=1 SV=1 818 1156 1.0E-08
sp|Q9P735|FAL1_NEUCR ATP-dependent RNA helicase fal-1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=fal-1 PE=3 SV=2 1044 1156 1.0E-08
sp|P24783|DBP2_YEAST ATP-dependent RNA helicase DBP2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DBP2 PE=1 SV=1 818 1158 1.0E-08
sp|Q4IAA0|FAL1_GIBZE ATP-dependent RNA helicase FAL1 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=FAL1 PE=3 SV=1 1044 1156 1.0E-08
sp|A4QU31|FAL1_MAGO7 ATP-dependent RNA helicase FAL1 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=FAL1 PE=3 SV=1 1044 1156 1.0E-08
sp|A4RN46|PRP5_MAGO7 Pre-mRNA-processing ATP-dependent RNA helicase PRP5 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=PRP5 PE=3 SV=1 818 1144 1.0E-08
sp|A6QSQ0|FAL1_AJECN ATP-dependent RNA helicase FAL1 OS=Ajellomyces capsulatus (strain NAm1 / WU24) GN=FAL1 PE=3 SV=1 1044 1156 1.0E-08
sp|Q4P184|FAL1_USTMA ATP-dependent RNA helicase FAL1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=FAL1 PE=3 SV=1 1044 1156 1.0E-08
sp|A6S4N4|FAL1_BOTFB ATP-dependent RNA helicase fal1 OS=Botryotinia fuckeliana (strain B05.10) GN=fal1 PE=3 SV=1 1044 1156 1.0E-08
sp|A7EM88|FAL1_SCLS1 ATP-dependent RNA helicase fal1 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=fal1 PE=3 SV=1 1044 1156 1.0E-08
sp|Q5AUL4|FAL1_EMENI ATP-dependent RNA helicase fal1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=fal1 PE=3 SV=1 1044 1156 1.0E-08
sp|A1C595|FAL1_ASPCL ATP-dependent RNA helicase fal1 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=fal1 PE=3 SV=1 1044 1156 1.0E-08
sp|A5AAE5|FAL1_ASPNC ATP-dependent RNA helicase fal1 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=fal1 PE=3 SV=2 1044 1156 2.0E-08
sp|Q0CAS8|FAL1_ASPTN ATP-dependent RNA helicase fal1 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=fal1 PE=3 SV=1 1044 1156 2.0E-08
sp|A1D071|FAL1_NEOFI ATP-dependent RNA helicase fal1 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=fal1 PE=3 SV=1 1044 1156 2.0E-08
sp|Q2UAK1|FAL1_ASPOR ATP-dependent RNA helicase fal1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=fal1 PE=3 SV=1 1044 1156 2.0E-08
sp|Q5HME0|CSHA_STAEQ DEAD-box ATP-dependent RNA helicase CshA OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=cshA PE=3 SV=1 818 1156 2.0E-08
sp|Q4WEB4|FAL1_ASPFU ATP-dependent RNA helicase fal1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=fal1 PE=3 SV=2 1044 1156 2.0E-08
sp|O02494|IF4A_CRYPV Eukaryotic initiation factor 4A OS=Cryptosporidium parvum GN=EIF4-A PE=2 SV=1 1042 1156 2.0E-08
sp|Q2U070|DBP2_ASPOR ATP-dependent RNA helicase dbp2 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=dbp2 PE=3 SV=1 818 1145 2.0E-08
sp|Q8H136|RH14_ARATH DEAD-box ATP-dependent RNA helicase 14 OS=Arabidopsis thaliana GN=RH14 PE=1 SV=2 818 1167 2.0E-08
sp|Q0E2Z7|RH41_ORYSJ DEAD-box ATP-dependent RNA helicase 41 OS=Oryza sativa subsp. japonica GN=Os02g0201900 PE=2 SV=2 818 1157 3.0E-08
sp|Q9FFQ1|RH31_ARATH DEAD-box ATP-dependent RNA helicase 31 OS=Arabidopsis thaliana GN=RH31 PE=2 SV=2 826 1144 3.0E-08
sp|Q8W4R3|RH30_ARATH DEAD-box ATP-dependent RNA helicase 30 OS=Arabidopsis thaliana GN=RH30 PE=2 SV=2 818 1157 3.0E-08
sp|Q8L7S8|RH3_ARATH DEAD-box ATP-dependent RNA helicase 3, chloroplastic OS=Arabidopsis thaliana GN=RH3 PE=1 SV=2 1022 1156 3.0E-08
sp|A1DGZ7|DBP2_NEOFI ATP-dependent RNA helicase dbp2 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=dbp2 PE=3 SV=1 818 1158 4.0E-08
sp|A2QC74|DBP2_ASPNC ATP-dependent RNA helicase dbp2 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=dbp2 PE=3 SV=1 818 1145 4.0E-08
sp|Q7ZVA6|IF4A3_DANRE Eukaryotic initiation factor 4A-III OS=Danio rerio GN=eif4a3 PE=2 SV=1 1044 1156 4.0E-08
sp|Q6FLF3|DBP2_CANGA ATP-dependent RNA helicase DBP2 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=DBP2 PE=3 SV=1 705 1145 4.0E-08
sp|Q1DHB2|PRP5_COCIM Pre-mRNA-processing ATP-dependent RNA helicase PRP5 OS=Coccidioides immitis (strain RS) GN=PRP5 PE=3 SV=1 783 1144 4.0E-08
sp|Q5A4E2|DED1_CANAL ATP-dependent RNA helicase DED1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=DED1 PE=3 SV=1 1030 1157 4.0E-08
sp|Q54E49|DDX6_DICDI Probable ATP-dependent RNA helicase ddx6 OS=Dictyostelium discoideum GN=ddx6 PE=3 SV=1 818 1136 4.0E-08
sp|Q5VNM3|RH2_ORYSJ DEAD-box ATP-dependent RNA helicase 2 OS=Oryza sativa subsp. japonica GN=Os01g0639100 PE=2 SV=1 1044 1156 5.0E-08
sp|Q98I01|UVRB_RHILO UvrABC system protein B OS=Rhizobium loti (strain MAFF303099) GN=uvrB PE=3 SV=1 942 1212 5.0E-08
sp|Q10I26|RH34_ORYSJ DEAD-box ATP-dependent RNA helicase 34 OS=Oryza sativa subsp. japonica GN=Os03g0566800 PE=2 SV=1 1044 1156 5.0E-08
sp|Q0UAT0|FAL1_PHANO ATP-dependent RNA helicase FAL1 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=FAL1 PE=3 SV=3 1044 1156 5.0E-08
sp|B7ZTW1|IF4A3_XENTR Eukaryotic initiation factor 4A-III OS=Xenopus tropicalis GN=eif4a3 PE=2 SV=1 1044 1156 5.0E-08
sp|Q91VC3|IF4A3_MOUSE Eukaryotic initiation factor 4A-III OS=Mus musculus GN=Eif4a3 PE=1 SV=3 1044 1156 6.0E-08
sp|Q5JKF2|RH40_ORYSJ DEAD-box ATP-dependent RNA helicase 40 OS=Oryza sativa subsp. japonica GN=Os01g0549400 PE=2 SV=2 796 1171 6.0E-08
sp|Q3B8Q2|IF4A3_RAT Eukaryotic initiation factor 4A-III OS=Rattus norvegicus GN=Eif4a3 PE=1 SV=1 1044 1156 6.0E-08
sp|A6M931|IF4A3_PIG Eukaryotic initiation factor 4A-III OS=Sus scrofa GN=EIF4A3 PE=2 SV=1 1044 1156 6.0E-08
sp|Q2NL22|IF4A3_BOVIN Eukaryotic initiation factor 4A-III OS=Bos taurus GN=EIF4A3 PE=2 SV=3 1044 1156 6.0E-08
sp|Q4R3Q1|IF4A3_MACFA Eukaryotic initiation factor 4A-III OS=Macaca fascicularis GN=EIF4A3 PE=2 SV=3 1044 1156 6.0E-08
sp|P38919|IF4A3_HUMAN Eukaryotic initiation factor 4A-III OS=Homo sapiens GN=EIF4A3 PE=1 SV=4 1044 1156 6.0E-08
sp|B5DG42|IF4A3_SALSA Eukaryotic initiation factor 4A-III OS=Salmo salar GN=eif4a3 PE=2 SV=1 1044 1156 6.0E-08
sp|A7ENE0|PRP5_SCLS1 Pre-mRNA-processing ATP-dependent RNA helicase prp5 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=prp5 PE=3 SV=1 818 1144 7.0E-08
sp|Q4X195|DBP2_ASPFU ATP-dependent RNA helicase dbp2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=dbp2 PE=3 SV=2 818 1158 7.0E-08
sp|B5FZY7|IF4A3_TAEGU Eukaryotic initiation factor 4A-III OS=Taeniopygia guttata GN=EIF4A3 PE=2 SV=1 1044 1156 7.0E-08
sp|O42226|I4A3B_XENLA Eukaryotic initiation factor 4A-III-B OS=Xenopus laevis GN=eif4a3-b PE=2 SV=1 1044 1156 7.0E-08
sp|Q5ZM36|IF4A3_CHICK Eukaryotic initiation factor 4A-III OS=Gallus gallus GN=EIF4A3 PE=2 SV=1 1044 1156 8.0E-08
sp|P19109|DDX17_DROME ATP-dependent RNA helicase p62 OS=Drosophila melanogaster GN=Rm62 PE=1 SV=3 818 1157 9.0E-08
sp|Q4WPE9|PRP28_ASPFU Pre-mRNA-splicing ATP-dependent RNA helicase prp28 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=prp28 PE=3 SV=1 1031 1156 9.0E-08
sp|Q0DM51|RH3_ORYSJ DEAD-box ATP-dependent RNA helicase 3, chloroplastic OS=Oryza sativa subsp. japonica GN=Os03g0827700 PE=2 SV=2 1030 1156 9.0E-08
sp|Q75B50|DED1_ASHGO ATP-dependent RNA helicase DED1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=DED1 PE=3 SV=2 798 1157 1.0E-07
sp|Q7SBC6|DBP2_NEUCR ATP-dependent RNA helicase dbp2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=drh-1 PE=3 SV=2 803 1158 1.0E-07
sp|A1CX72|PRP28_NEOFI Pre-mRNA-splicing ATP-dependent RNA helicase prp28 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=prp28 PE=3 SV=1 1031 1156 1.0E-07
sp|Q58083|H669_METJA Probable ATP-dependent RNA helicase MJ0669 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ0669 PE=1 SV=1 1044 1154 1.0E-07
sp|B6EGH8|UVRB_ALISL UvrABC system protein B OS=Aliivibrio salmonicida (strain LFI1238) GN=uvrB PE=3 SV=1 944 1187 1.0E-07
sp|A1C6C4|DBP2_ASPCL ATP-dependent RNA helicase dbp2 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=dbp2 PE=3 SV=1 741 1145 1.0E-07
sp|Q1DMX8|PRP28_COCIM Pre-mRNA-splicing ATP-dependent RNA helicase PRP28 OS=Coccidioides immitis (strain RS) GN=PRP28 PE=3 SV=2 1031 1156 1.0E-07
sp|Q0UWC8|PRP28_PHANO Pre-mRNA-splicing ATP-dependent RNA helicase PRP28 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=PRP28 PE=3 SV=1 1045 1156 1.0E-07
sp|Q2UH00|PRP28_ASPOR Pre-mRNA-splicing ATP-dependent RNA helicase prp28 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=prp28 PE=3 SV=1 1045 1178 1.0E-07
sp|Q7A0D2|CSHA_STAAW DEAD-box ATP-dependent RNA helicase CshA OS=Staphylococcus aureus (strain MW2) GN=cshA PE=3 SV=1 818 1162 1.0E-07
sp|Q6G7M9|CSHA_STAAS DEAD-box ATP-dependent RNA helicase CshA OS=Staphylococcus aureus (strain MSSA476) GN=cshA PE=3 SV=1 818 1162 1.0E-07
sp|Q7A4G0|CSHA_STAAN DEAD-box ATP-dependent RNA helicase CshA OS=Staphylococcus aureus (strain N315) GN=cshA PE=1 SV=1 818 1162 1.0E-07
sp|Q99SH6|CSHA_STAAM DEAD-box ATP-dependent RNA helicase CshA OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=cshA PE=3 SV=1 818 1162 1.0E-07
sp|Q5HEB9|CSHA_STAAC DEAD-box ATP-dependent RNA helicase CshA OS=Staphylococcus aureus (strain COL) GN=cshA PE=3 SV=1 818 1162 1.0E-07
sp|Q2FWH5|CSHA_STAA8 DEAD-box ATP-dependent RNA helicase CshA OS=Staphylococcus aureus (strain NCTC 8325) GN=cshA PE=1 SV=1 818 1162 1.0E-07
sp|Q2FF45|CSHA_STAA3 DEAD-box ATP-dependent RNA helicase CshA OS=Staphylococcus aureus (strain USA300) GN=cshA PE=3 SV=1 818 1162 1.0E-07
sp|Q59LU0|DBP2_CANAL ATP-dependent RNA helicase DBP2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=DBP2 PE=3 SV=2 818 1152 1.0E-07
sp|Q6GEZ3|CSHA_STAAR DEAD-box ATP-dependent RNA helicase CshA OS=Staphylococcus aureus (strain MRSA252) GN=cshA PE=3 SV=1 818 1162 2.0E-07
sp|Q5BCU6|PRP28_EMENI Pre-mRNA-splicing ATP-dependent RNA helicase prp28 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=prp28 PE=3 SV=2 1045 1156 2.0E-07
sp|Q2YUH3|CSHA_STAAB DEAD-box ATP-dependent RNA helicase CshA OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=cshA PE=3 SV=1 818 1162 2.0E-07
sp|Q6CX73|FAL1_KLULA ATP-dependent RNA helicase FAL1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=FAL1 PE=3 SV=1 1045 1149 2.0E-07
sp|Q6CKI1|PRP5_KLULA Pre-mRNA-processing ATP-dependent RNA helicase PRP5 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=PRP5 PE=3 SV=1 796 1134 2.0E-07
sp|Q0CLX0|PRP28_ASPTN Pre-mRNA-splicing ATP-dependent RNA helicase prp28 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=prp28 PE=3 SV=1 1045 1156 2.0E-07
sp|Q5U526|I4A3A_XENLA Eukaryotic initiation factor 4A-III-A OS=Xenopus laevis GN=eif4a3-a PE=2 SV=1 1044 1156 2.0E-07
sp|Q73EU1|CSHA_BACC1 DEAD-box ATP-dependent RNA helicase CshA OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=cshA PE=3 SV=1 818 1144 2.0E-07
sp|P9WH05|DEAD_MYCTU ATP-dependent RNA helicase DeaD OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=deaD PE=1 SV=1 1045 1156 2.0E-07
sp|P9WH04|DEAD_MYCTO ATP-dependent RNA helicase DeaD OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=deaD PE=3 SV=1 1045 1156 2.0E-07
sp|A1CHL3|PRP28_ASPCL Pre-mRNA-splicing ATP-dependent RNA helicase prp28 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=prp28 PE=3 SV=1 1031 1156 2.0E-07
sp|Q7FGZ2|RH1_ARATH DEAD-box ATP-dependent RNA helicase 1 OS=Arabidopsis thaliana GN=RH1 PE=2 SV=3 829 1157 2.0E-07
sp|Q9LUW6|RH9_ARATH DEAD-box ATP-dependent RNA helicase 9 OS=Arabidopsis thaliana GN=RH9 PE=2 SV=1 796 1156 2.0E-07
sp|Q814I2|DBPA_BACCR ATP-dependent RNA helicase DbpA OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=dbpA PE=2 SV=1 818 1156 2.0E-07
sp|Q9SQV1|RH40_ARATH DEAD-box ATP-dependent RNA helicase 40 OS=Arabidopsis thaliana GN=RH40 PE=2 SV=1 818 1171 3.0E-07
sp|Q6BU54|DED1_DEBHA ATP-dependent RNA helicase DED1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=DED1 PE=3 SV=1 771 1157 3.0E-07
sp|Q7SEL0|PRP28_NEUCR Pre-mRNA-splicing ATP-dependent RNA helicase prp-28 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=prp-28 PE=3 SV=1 1045 1156 3.0E-07
sp|Q6HPE6|CSHA_BACHK DEAD-box ATP-dependent RNA helicase CshA OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=cshA PE=3 SV=1 818 1144 3.0E-07
sp|Q81VG0|CSHA_BACAN DEAD-box ATP-dependent RNA helicase CshA OS=Bacillus anthracis GN=cshA PE=3 SV=1 818 1144 3.0E-07
sp|A0R8U6|CSHA_BACAH DEAD-box ATP-dependent RNA helicase CshA OS=Bacillus thuringiensis (strain Al Hakam) GN=cshA PE=3 SV=1 818 1144 3.0E-07
sp|Q0U8V9|DBP8_PHANO ATP-dependent RNA helicase DBP8 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=DBP8 PE=3 SV=1 818 1153 3.0E-07
sp|A2QIL2|PRP28_ASPNC Pre-mRNA-splicing ATP-dependent RNA helicase prp28 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=prp28 PE=3 SV=1 1045 1156 3.0E-07
sp|Q63GX5|CSHA_BACCZ DEAD-box ATP-dependent RNA helicase CshA OS=Bacillus cereus (strain ZK / E33L) GN=cshA PE=3 SV=1 818 1144 4.0E-07
sp|Q4TVV3|DDX46_DANRE Probable ATP-dependent RNA helicase DDX46 OS=Danio rerio GN=ddx46 PE=2 SV=1 818 1160 4.0E-07
sp|Q6LT47|UVRB_PHOPR UvrABC system protein B OS=Photobacterium profundum GN=uvrB PE=3 SV=1 944 1135 4.0E-07
sp|Q8SQK9|DHH1_ENCCU ATP-dependent RNA helicase DHH1 OS=Encephalitozoon cuniculi (strain GB-M1) GN=DHH1 PE=3 SV=2 1045 1142 5.0E-07
sp|A6RJA2|PRP28_BOTFB Pre-mRNA-splicing ATP-dependent RNA helicase prp28 OS=Botryotinia fuckeliana (strain B05.10) GN=prp28 PE=3 SV=1 1045 1149 5.0E-07
sp|A7EGG4|PRP28_SCLS1 Pre-mRNA-splicing ATP-dependent RNA helicase prp28 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=prp28 PE=3 SV=1 1045 1156 5.0E-07
sp|Q81IT9|CSHA_BACCR DEAD-box ATP-dependent RNA helicase CshA OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=cshA PE=2 SV=2 818 1144 5.0E-07
sp|Q12099|FAL1_YEAST ATP-dependent RNA helicase FAL1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FAL1 PE=1 SV=1 1018 1156 5.0E-07
sp|A6ZXY5|FAL1_YEAS7 ATP-dependent RNA helicase FAL1 OS=Saccharomyces cerevisiae (strain YJM789) GN=FAL1 PE=3 SV=1 1018 1156 5.0E-07
sp|Q86TM3|DDX53_HUMAN Probable ATP-dependent RNA helicase DDX53 OS=Homo sapiens GN=DDX53 PE=1 SV=3 818 1174 5.0E-07
sp|P44701|SRMB_HAEIN ATP-dependent RNA helicase SrmB OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=srmB PE=3 SV=1 798 1156 5.0E-07
sp|Q94C75|RH25_ARATH DEAD-box ATP-dependent RNA helicase 25 OS=Arabidopsis thaliana GN=RH25 PE=2 SV=2 826 1144 5.0E-07
sp|Q7RY59|RRP3_NEUCR ATP-dependent rRNA helicase rrp-3 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=rrp-3 PE=3 SV=1 1035 1152 5.0E-07
sp|A6R3L3|DED1_AJECN ATP-dependent RNA helicase DED1 OS=Ajellomyces capsulatus (strain NAm1 / WU24) GN=DED1 PE=3 SV=1 818 1157 5.0E-07
sp|P41380|IF4A3_NICPL Eukaryotic initiation factor 4A-3 OS=Nicotiana plumbaginifolia PE=2 SV=1 1044 1156 6.0E-07
sp|A5DQS0|DED1_PICGU ATP-dependent RNA helicase DED1 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=DED1 PE=3 SV=3 1030 1157 6.0E-07
sp|O34750|YFML_BACSU Probable ATP-dependent RNA helicase YfmL OS=Bacillus subtilis (strain 168) GN=yfmL PE=1 SV=1 800 1156 7.0E-07
sp|P0CQ88|PRP28_CRYNJ Pre-mRNA-splicing ATP-dependent RNA helicase PRP28 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=PRP28 PE=3 SV=1 1045 1156 8.0E-07
sp|P0CQ89|PRP28_CRYNB Pre-mRNA-splicing ATP-dependent RNA helicase PRP28 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=PRP28 PE=3 SV=1 1045 1156 8.0E-07
sp|Q9Y7C4|ROK1_CANAL ATP-dependent RNA helicase CHR1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CHR1 PE=3 SV=1 1072 1157 8.0E-07
sp|Q9CWX9|DDX47_MOUSE Probable ATP-dependent RNA helicase DDX47 OS=Mus musculus GN=Ddx47 PE=2 SV=2 818 1156 8.0E-07
sp|Q9H0S4|DDX47_HUMAN Probable ATP-dependent RNA helicase DDX47 OS=Homo sapiens GN=DDX47 PE=1 SV=1 818 1156 8.0E-07
sp|Q553B1|DDX46_DICDI ATP-dependent RNA helicase ddx46 OS=Dictyostelium discoideum GN=helB1 PE=2 SV=1 796 1136 9.0E-07
sp|A7E436|DBP8_SCLS1 ATP-dependent RNA helicase dbp8 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=dbp8 PE=3 SV=1 821 1153 1.0E-06
sp|A7EML8|RRP3_SCLS1 ATP-dependent rRNA helicase rrp3 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=rrp3 PE=3 SV=1 1035 1156 1.0E-06
sp|Q3MSQ8|DDX4_PELLE Probable ATP-dependent RNA helicase DDX4 OS=Pelophylax lessonae GN=ddx4 PE=2 SV=1 818 1157 1.0E-06
sp|P93008|RH21_ARATH DEAD-box ATP-dependent RNA helicase 21 OS=Arabidopsis thaliana GN=RH21 PE=2 SV=1 1035 1156 1.0E-06
sp|Q5E6B5|UVRB_VIBF1 UvrABC system protein B OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=uvrB PE=3 SV=1 944 1135 1.0E-06
sp|Q4P9P3|DRS1_USTMA ATP-dependent RNA helicase DRS1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=DRS1 PE=3 SV=1 1065 1172 1.0E-06
sp|Q4I7F9|PRP28_GIBZE Pre-mRNA-splicing ATP-dependent RNA helicase PRP28 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=PRP28 PE=3 SV=1 1031 1156 1.0E-06
sp|Q8TFK8|DED1_CANGA ATP-dependent RNA helicase DED1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=DED1 PE=3 SV=1 771 1156 1.0E-06
sp|Q6C347|FAL1_YARLI ATP-dependent RNA helicase FAL1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=FAL1 PE=3 SV=1 1044 1156 2.0E-06
sp|Q6C024|PRP28_YARLI Pre-mRNA-splicing ATP-dependent RNA helicase PRP28 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=PRP28 PE=3 SV=1 1045 1168 2.0E-06
sp|A7TEF4|FAL1_VANPO ATP-dependent RNA helicase FAL1 OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=FAL1 PE=3 SV=1 1018 1156 2.0E-06
sp|Q9DF35|DD21A_XENLA Nucleolar RNA helicase 2-A OS=Xenopus laevis GN=ddx21-a PE=2 SV=2 818 1145 2.0E-06
sp|Q6BP45|ROK1_DEBHA ATP-dependent RNA helicase ROK1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=ROK1 PE=3 SV=2 1072 1157 2.0E-06
sp|A4RK80|PRP28_MAGO7 Pre-mRNA-splicing ATP-dependent RNA helicase PRP28 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=PRP28 PE=3 SV=1 1035 1156 2.0E-06
sp|Q6CLR3|DED1_KLULA ATP-dependent RNA helicase DED1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=DED1 PE=3 SV=1 1029 1158 2.0E-06
sp|Q2FY15|CSHB_STAA8 DEAD-box ATP-dependent RNA helicase CshB OS=Staphylococcus aureus (strain NCTC 8325) GN=cshB PE=3 SV=1 837 1145 2.0E-06
sp|Q5ADL0|PRP5_CANAL Pre-mRNA-processing ATP-dependent RNA helicase PRP5 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PRP5 PE=3 SV=1 783 1144 3.0E-06
sp|Q605S7|UVRB_METCA UvrABC system protein B OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=uvrB PE=3 SV=1 942 1135 3.0E-06
sp|Q9P6U9|DED1_NEUCR ATP-dependent RNA helicase ded1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=drh-9 PE=3 SV=1 818 1157 3.0E-06
sp|Q4I662|DBP8_GIBZE ATP-dependent RNA helicase DBP8 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=DBP8 PE=3 SV=1 821 1152 3.0E-06
sp|A3GHW9|ROK1_PICST ATP-dependent RNA helicase ROK1 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=ROK1 PE=3 SV=1 1045 1157 3.0E-06
sp|Q29S22|DDX47_BOVIN Probable ATP-dependent RNA helicase DDX47 OS=Bos taurus GN=DDX47 PE=2 SV=1 818 1156 3.0E-06
sp|Q5R6D8|DDX46_PONAB Probable ATP-dependent RNA helicase DDX46 OS=Pongo abelii GN=DDX46 PE=2 SV=1 818 1144 4.0E-06
sp|Q8Y7M8|DBPA_LISMO ATP-dependent RNA helicase DbpA OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=dbpA PE=2 SV=1 1001 1198 4.0E-06
sp|O13792|SUB2_SCHPO ATP-dependent RNA helicase uap56 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=uap56 PE=1 SV=3 813 1156 4.0E-06
sp|Q84TG1|RH57_ARATH DEAD-box ATP-dependent RNA helicase 57 OS=Arabidopsis thaliana GN=RH57 PE=2 SV=1 1045 1156 4.0E-06
sp|A6RW56|RRP3_BOTFB ATP-dependent rRNA helicase rrp3 OS=Botryotinia fuckeliana (strain B05.10) GN=rrp3 PE=3 SV=1 1035 1156 4.0E-06
sp|Q0E3X4|RH35A_ORYSJ DEAD-box ATP-dependent RNA helicase 35A OS=Oryza sativa subsp. japonica GN=Os02g0150100 PE=2 SV=2 1045 1147 4.0E-06
sp|Q6D3C4|UVRB_PECAS UvrABC system protein B OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=uvrB PE=3 SV=1 944 1168 4.0E-06
sp|Q9LUW5|RH53_ARATH DEAD-box ATP-dependent RNA helicase 53 OS=Arabidopsis thaliana GN=RH53 PE=2 SV=1 796 1156 4.0E-06
sp|Q0DB53|RH52A_ORYSJ DEAD-box ATP-dependent RNA helicase 52A OS=Oryza sativa subsp. japonica GN=Os06g0602400 PE=2 SV=2 818 1157 5.0E-06
sp|C6DDU0|UVRB_PECCP UvrABC system protein B OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=uvrB PE=3 SV=1 944 1168 5.0E-06
sp|P0A4D8|CSHA_STRR6 DEAD-box ATP-dependent RNA helicase CshA OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=cshA PE=3 SV=1 1044 1144 5.0E-06
sp|P0A4D7|CSHA_STRPN DEAD-box ATP-dependent RNA helicase CshA OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=cshA PE=3 SV=1 1044 1144 5.0E-06
sp|Q6CH90|SUB2_YARLI ATP-dependent RNA helicase SUB2 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=SUB2 PE=3 SV=2 937 1156 5.0E-06
sp|Q5GXX4|UVRB_XANOR UvrABC system protein B OS=Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85) GN=uvrB PE=3 SV=1 1045 1171 6.0E-06
sp|Q4P733|DED1_USTMA ATP-dependent RNA helicase DED1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=DED1 PE=3 SV=1 1030 1157 6.0E-06
sp|Q6FJG1|FAL1_CANGA ATP-dependent RNA helicase FAL1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=FAL1 PE=3 SV=1 1045 1156 6.0E-06
sp|Q9C8J1|RH34_ARATH DEAD-box ATP-dependent RNA helicase 34 OS=Arabidopsis thaliana GN=RH34 PE=2 SV=2 1044 1156 6.0E-06
sp|B2SUN1|UVRB_XANOP UvrABC system protein B OS=Xanthomonas oryzae pv. oryzae (strain PXO99A) GN=uvrB PE=3 SV=1 1045 1171 6.0E-06
sp|A3LQ55|PRP5_PICST Pre-mRNA-processing ATP-dependent RNA helicase PRP5 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=PRP5 PE=3 SV=2 783 1157 7.0E-06
sp|Q9DF36|DD21B_XENLA Nucleolar RNA helicase 2-B OS=Xenopus laevis GN=ddx21-b PE=2 SV=2 818 1145 7.0E-06
sp|Q8PFZ3|RHLB_XANAC ATP-dependent RNA helicase RhlB OS=Xanthomonas axonopodis pv. citri (strain 306) GN=rhlB PE=3 SV=1 1035 1144 8.0E-06
sp|Q5GUR8|RHLB_XANOR ATP-dependent RNA helicase RhlB OS=Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85) GN=rhlB PE=3 SV=2 1035 1144 9.0E-06
sp|Q91VN6|DDX41_MOUSE Probable ATP-dependent RNA helicase DDX41 OS=Mus musculus GN=Ddx41 PE=1 SV=2 1045 1148 9.0E-06
sp|Q6GVM6|DDX3Y_PANTR ATP-dependent RNA helicase DDX3Y OS=Pan troglodytes GN=DDX3Y PE=2 SV=1 1045 1157 1.0E-05
sp|Q9UJV9|DDX41_HUMAN Probable ATP-dependent RNA helicase DDX41 OS=Homo sapiens GN=DDX41 PE=1 SV=2 1045 1148 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0003677 DNA binding Yes
GO:0006281 DNA repair Yes
GO:0003676 nucleic acid binding Yes
GO:0006260 DNA replication Yes
GO:0005524 ATP binding Yes
GO:0043138 3'-5' DNA helicase activity Yes
GO:0016787 hydrolase activity Yes
GO:0033554 cellular response to stress No
GO:0003678 DNA helicase activity No
GO:0043167 ion binding No
GO:0140640 catalytic activity, acting on a nucleic acid No
GO:0032553 ribonucleotide binding No
GO:0004386 helicase activity No
GO:0006807 nitrogen compound metabolic process No
GO:0097367 carbohydrate derivative binding No
GO:0051716 cellular response to stimulus No
GO:1901360 organic cyclic compound metabolic process No
GO:0000166 nucleotide binding No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0017076 purine nucleotide binding No
GO:0003674 molecular_function No
GO:0005488 binding No
GO:0140097 catalytic activity, acting on DNA No
GO:0008150 biological_process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0006950 response to stress No
GO:0043170 macromolecule metabolic process No
GO:0050896 response to stimulus No
GO:0043168 anion binding No
GO:0046483 heterocycle metabolic process No
GO:0006974 cellular response to DNA damage stimulus No
GO:0030554 adenyl nucleotide binding No
GO:0008094 ATP-dependent activity, acting on DNA No
GO:0140657 ATP-dependent activity No
GO:0044238 primary metabolic process No
GO:0009987 cellular process No
GO:0008152 metabolic process No
GO:0036094 small molecule binding No
GO:0032559 adenyl ribonucleotide binding No
GO:0003824 catalytic activity No
GO:0044237 cellular metabolic process No
GO:0006259 DNA metabolic process No
GO:0071704 organic substance metabolic process No
GO:0044260 cellular macromolecule metabolic process No
GO:1901363 heterocyclic compound binding No
GO:0032555 purine ribonucleotide binding No
GO:1901265 nucleoside phosphate binding No
GO:0097159 organic cyclic compound binding No
GO:0090304 nucleic acid metabolic process No
GO:0006139 nucleobase-containing compound metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 27 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|4321
MTRNNLKPQLSWLLSNSLSVKPPADALPSVGDHTSSTSLQSNARSHSQSQTLSVLSEGPGSAELCGNEHEATLKK
SDNMGRLTSTTKPKKALLVSQQPQQLLTPSTLGEARKKPRSASRAPDLHSVDFSASASCVPKVSSKQAPLSNSTN
DFDDFDAAELECMDLTEHTVPSDDLLTFGDEVCLWDQDKADWSPVLPRSSKKRKSDGISNGEGDVSFPDIYQLIG
TDPPAPTPSGRSAVSRAGRSSPIKPRREYRDVDPPGSVASPRSEVDRFGINDDVRDMSSPSKRAASRRDHLRVGK
KSGAVGQQSQTPGSGKKRRLANARLWSNSPGQRSSKGAMRTLSISPGQRASKAAMRAEASAPMACVPDSEDEFVT
PPSRSAAIRMSEEPSRLMGANPAASRPHENDGATPCPQMSPSRDYLSTTDQDLIPEACPPSSSQTPRVLAHLSAN
PQALGRMLALIETQLQNNGHEFVRALNERWPKEKRDGVKADKERLMKQQKAIKDLDEVMGSYRSICRQREEVAAR
VAQSYNDSLDTDQDELLLDQLTDRIQQLEQGLVHVLDEAELDEKTLVEQPRASGLEAKVSTPVNRGSQPNKDMFT
SERGAASAMCRTAQSVHEPQLSETSMPKLQLWNEPISRTAVGELASRTAEDSFQSPFPRDQQRNNGRRETLRCVS
ANTLGGDTGVVESDYMSNDDGGVNMLPPRQGASHGGEGGRSTAARAGKNDVDAFSDFSDDADMLAFAQDYETRQS
VVAPRPVLSETSGNAAPPPKPVTASKRQAAPVVPAFSIPKELMKHGWSPDVQKMLKDRFRMKGFRHNQLQAINAT
LAGKDAFVLMPTGGGKSLCYQLPAVVKSGKTKGVTVVVSPLLSLMQDQVDHLKALGIQAVAFNGECSSEYKRQVM
SAFGERSPEHYIELLYVTPEMMNKNAAFNNALQTLHRRGKFARLVIDEAHCVSQWGHDFRPDYKSLGQVRLRFPD
VPVMALTATATQNVIVDIKHNLGMVNCEVFSQSFNRPNLYYEVRTKTTNVGATDMIADLILSKYAGVTGIVYTIS
RKQTEVVAESLREHGITARHYHAGIDPKEKVEVQTSWQKGKVKVVVATIAFGMGIDKADVRFVMHHGIPKSLEGY
YQETGRAGRDGKPSDCILFYGKADIRVLKKLIADGDGSAEQRERQMVMLNRVTAFCDNKADCRRTEVLRYFGEDF
VPSQCHQSCDNCQSGHVFEQQDFSDYARAAIEVVQRQRQLTAIQCADILLGKKYPKQEAERSNEYFGMAKSLKKH
ELVRVIDRLSAEKAFGEDNVVNRWGMATQYLKIGPTAGQFLHKQRRLMLTVQVADEGKGANKTKPQAKKKKADKQ
TTLAMQSTYVSSPVGQRGDSGARARVGEEAEQGGLTANGYANDGFVVSDKELDESDDDDAHFEPLPSHRAARRPA
REEARGRPRALPDKQLEDLPSVVQDLVDSFVKNAQKWDERVRNKRDLRRPLFTERELQQMAMHWTTSVDKMKRIR
GIDVDRVEEYGPKLLPMLQRTFDFYQQIVLPDVRAALQEEDDMDDDDDDDEGEEGGDASVVLISSDVDMDDAEYE
DEEQDSRYFETQTRPDVEAFHNRLMAFEHAASQPQQQRGGTRAQRGGFARGGKKAFKRWNKRASAGAGAAAAAAR
RRSSGGGKRGGGGGGGKRDGKSVSKAGGIGLMPM*
Coding >OphauB2|4321
ATGACGCGAAACAACCTCAAGCCTCAACTGTCGTGGTTGCTGAGCAACTCCTTGTCCGTCAAGCCGCCCGCTGAC
GCGCTCCCCAGCGTCGGCGACCACACCTCGAGTACATCTTTGCAATCCAACGCGCGCTCTCACTCTCAGTCACAG
ACTCTGTCCGTCTTGTCTGAGGGTCCTGGGTCGGCCGAGCTGTGCGGTAACGAGCACGAGGCAACGCTGAAGAAG
AGTGACAATATGGGCCGCCTCACGTCGACGACGAAGCCCAAGAAGGCGCTGCTCGTGTCGCAGCAGCCGCAGCAG
CTTCTCACGCCTTCTACCTTGGGCGAAGCGCGCAAGAAGCCGCGTTCGGCGTCTCGAGCTCCTGATTTGCATAGC
GTTGACTTTTCAGCTTCCGCGTCTTGTGTACCAAAAGTTTCTTCAAAGCAAGCACCCTTATCCAACTCTACTAAT
GATTTTGACGACTTTGACGCTGCCGAATTGGAATGCATGGACCTTACAGAACACACGGTTCCTTCCGACGACTTG
CTCACATTTGGTGACGAGGTTTGTCTCTGGGATCAGGACAAGGCGGATTGGTCACCAGTTCTTCCCAGATCTTCC
AAGAAGAGAAAGAGTGATGGGATTAGCAATGGCGAGGGCGACGTTTCATTTCCCGACATTTATCAGCTCATTGGC
ACAGATCCACCCGCACCGACCCCGAGCGGCCGGTCAGCAGTGTCCCGGGCTGGTCGTTCGAGTCCCATCAAGCCG
CGGCGCGAATATAGAGACGTGGACCCTCCTGGCTCGGTGGCCAGTCCGAGAAGTGAAGTTGATCGATTCGGTATC
AATGACGACGTGAGGGACATGTCTTCGCCCTCGAAGCGAGCTGCCAGCCGTCGAGATCATTTAAGGGTTGGTAAA
AAGTCGGGAGCAGTTGGCCAGCAATCGCAGACGCCAGGCAGTGGCAAAAAACGCAGGCTGGCCAATGCTCGGCTA
TGGTCCAATTCACCTGGTCAAAGATCGAGCAAAGGTGCCATGCGCACCTTGTCCATTTCACCTGGACAAAGAGCA
AGCAAGGCCGCCATGCGAGCTGAAGCAAGCGCCCCAATGGCTTGTGTCCCTGATTCCGAAGACGAATTTGTCACT
CCACCGAGCCGCAGTGCCGCCATACGCATGTCGGAAGAGCCTTCTAGGTTGATGGGCGCCAACCCAGCCGCAAGT
CGTCCGCATGAGAATGATGGGGCCACGCCGTGTCCTCAAATGTCTCCCTCACGAGACTATTTAAGCACGACCGAT
CAAGATTTGATACCCGAAGCGTGTCCGCCCTCGTCGAGCCAGACGCCAAGAGTCTTGGCTCATTTATCTGCCAAT
CCACAGGCACTCGGCAGAATGCTTGCGCTCATTGAGACGCAATTGCAAAATAATGGCCACGAGTTTGTGCGTGCT
CTCAACGAACGGTGGCCCAAGGAAAAACGTGACGGAGTCAAGGCAGATAAGGAGCGGTTGATGAAGCAGCAAAAA
GCCATCAAGGATCTTGACGAAGTTATGGGCTCGTATAGATCTATTTGCAGACAACGAGAGGAAGTGGCAGCGCGT
GTTGCCCAGTCGTACAATGATTCGCTCGACACTGACCAAGACGAGCTTTTACTCGACCAACTTACTGACCGTATA
CAGCAACTAGAACAAGGGCTTGTGCATGTTCTCGACGAAGCTGAACTGGATGAAAAGACTCTTGTTGAGCAGCCG
CGTGCTTCGGGCTTGGAAGCCAAGGTTTCGACGCCTGTTAACCGTGGCAGTCAGCCCAACAAGGACATGTTTACG
AGCGAACGAGGAGCAGCTTCTGCTATGTGTCGAACGGCTCAATCTGTCCATGAACCGCAGCTGTCTGAGACTTCG
ATGCCAAAGTTGCAGCTGTGGAACGAGCCAATATCGAGGACAGCGGTTGGCGAGCTAGCCTCTCGCACTGCTGAG
GATTCATTCCAGTCGCCCTTTCCTAGGGACCAGCAGAGGAACAATGGCCGACGAGAAACTTTGAGATGCGTCTCT
GCCAATACCCTTGGCGGCGACACGGGCGTGGTAGAGTCGGACTACATGTCAAACGATGATGGCGGCGTCAACATG
TTGCCACCGCGCCAAGGAGCATCACACGGCGGCGAAGGCGGACGGTCAACAGCAGCTAGAGCTGGAAAGAATGAC
GTTGACGCCTTTAGCGACTTTAGCGACGATGCCGATATGCTAGCTTTTGCTCAAGACTACGAGACGCGCCAGTCG
GTTGTTGCGCCTCGACCAGTACTATCCGAAACGTCGGGGAATGCAGCTCCTCCTCCAAAGCCTGTCACGGCCTCC
AAGAGACAGGCAGCCCCAGTGGTGCCGGCATTTAGTATTCCCAAGGAGCTCATGAAGCATGGCTGGTCGCCAGAC
GTGCAAAAGATGCTCAAGGATCGGTTCAGGATGAAGGGCTTCCGTCACAACCAGCTGCAGGCCATCAACGCGACG
CTGGCGGGCAAAGACGCCTTTGTGCTGATGCCAACAGGAGGCGGCAAGTCGCTGTGCTACCAGCTGCCGGCCGTG
GTCAAGAGTGGAAAGACCAAGGGCGTCACGGTGGTTGTGTCTCCGCTGCTCAGTCTGATGCAAGACCAGGTGGAC
CACTTGAAGGCGCTGGGCATCCAGGCCGTGGCCTTTAACGGCGAATGCTCAAGCGAGTACAAGCGGCAGGTGATG
AGCGCCTTTGGCGAGCGCAGTCCGGAGCATTACATTGAGCTGCTGTACGTGACGCCCGAGATGATGAACAAGAAT
GCCGCCTTCAACAATGCGCTGCAGACGCTCCATCGCCGGGGCAAGTTTGCGCGCCTGGTGATTGACGAGGCGCAT
TGCGTCAGCCAATGGGGGCATGACTTTCGACCCGACTACAAGTCGCTGGGCCAAGTGCGTCTGCGGTTTCCCGAC
GTGCCCGTAATGGCCCTGACGGCGACGGCGACGCAAAACGTCATTGTCGACATCAAGCACAATCTGGGCATGGTG
AATTGCGAGGTGTTTTCGCAGAGCTTCAACCGGCCCAACCTCTACTACGAGGTGCGGACCAAGACGACGAATGTG
GGAGCGACGGACATGATTGCCGATCTCATCCTTTCCAAGTATGCGGGCGTAACGGGCATCGTGTATACGATTTCG
CGCAAGCAGACAGAAGTGGTGGCGGAGTCGCTGCGTGAGCACGGCATCACGGCCCGCCACTACCACGCAGGCATT
GATCCCAAGGAAAAGGTGGAGGTGCAGACGTCGTGGCAAAAGGGCAAGGTCAAGGTGGTTGTGGCGACGATTGCC
TTTGGCATGGGCATTGACAAGGCCGACGTTAGGTTTGTCATGCACCATGGCATTCCCAAGAGCCTCGAGGGCTAT
TACCAGGAGACTGGGCGAGCAGGCAGAGACGGCAAACCGTCGGACTGCATATTGTTTTACGGAAAGGCGGACATA
AGGGTCCTCAAGAAACTGATTGCAGATGGCGACGGCAGCGCCGAGCAGCGGGAGCGGCAAATGGTGATGCTGAAC
CGAGTGACGGCCTTTTGTGACAACAAGGCCGACTGTCGGCGGACCGAGGTACTGCGCTACTTTGGCGAGGACTTT
GTGCCCAGCCAGTGCCACCAGTCGTGCGACAATTGCCAATCTGGCCATGTCTTTGAGCAGCAAGACTTTTCCGAC
TATGCCAGGGCGGCCATTGAGGTGGTGCAGAGGCAGAGGCAGCTGACGGCCATTCAGTGTGCCGATATTCTGCTG
GGCAAAAAGTATCCCAAGCAAGAAGCTGAGCGGTCGAATGAGTATTTTGGCATGGCCAAGAGTCTCAAGAAGCAC
GAGCTGGTGCGCGTCATTGATCGATTATCGGCGGAAAAGGCGTTTGGCGAGGATAACGTTGTAAACAGATGGGGC
ATGGCGACTCAGTATCTCAAGATTGGGCCTACGGCCGGCCAGTTTTTGCACAAGCAGCGGCGGCTGATGTTGACG
GTTCAGGTGGCGGATGAGGGCAAGGGCGCCAACAAGACAAAGCCGCAGGCCAAGAAGAAGAAGGCTGACAAGCAA
ACGACTCTGGCAATGCAGTCGACGTATGTGTCGTCACCAGTGGGCCAGCGAGGCGACTCGGGGGCCAGGGCACGT
GTTGGCGAAGAGGCTGAGCAAGGCGGTCTAACGGCCAATGGCTACGCAAATGACGGATTTGTCGTTTCGGACAAG
GAGCTGGACGAGTCTGACGACGACGACGCGCACTTTGAGCCTCTGCCCAGTCACCGTGCTGCAAGACGCCCAGCC
AGAGAAGAAGCCCGAGGGCGGCCGCGAGCGCTGCCAGATAAGCAGCTGGAGGATCTGCCCTCAGTGGTGCAAGAC
TTGGTGGACAGTTTTGTCAAGAATGCGCAAAAGTGGGACGAACGGGTACGCAACAAGAGAGACTTGAGGCGGCCA
CTCTTTACGGAGCGCGAGCTGCAGCAAATGGCGATGCACTGGACGACTAGCGTGGACAAGATGAAGCGCATACGG
GGCATCGACGTGGACAGGGTGGAGGAGTATGGGCCCAAGCTGCTGCCCATGCTCCAGCGGACCTTTGACTTTTAC
CAGCAAATTGTTTTGCCAGATGTGCGTGCGGCGCTGCAAGAAGAGGATGATATGGATGACGACGACGACGACGAC
GAGGGAGAGGAGGGGGGCGACGCGTCGGTGGTGTTGATTAGTTCAGACGTGGACATGGATGACGCCGAGTATGAA
GACGAGGAACAAGACTCGCGATACTTTGAGACGCAGACGAGGCCAGACGTGGAGGCGTTTCACAATAGGCTAATG
GCATTTGAGCATGCAGCGTCACAGCCCCAGCAGCAGCGAGGCGGAACAAGAGCACAGCGGGGGGGCTTTGCTCGC
GGGGGGAAAAAGGCGTTTAAGCGGTGGAATAAACGGGCGAGTGCGGGAGCGGGAGCAGCAGCGGCGGCGGCGCGG
CGGCGGAGTAGTGGAGGGGGTAAACGGGGAGGAGGCGGGGGGGGAGGGAAGCGGGATGGAAAGAGTGTGAGCAAG
GCGGGGGGGATTGGGCTGATGCCAATGTAG
Transcript >OphauB2|4321
ATGACGCGAAACAACCTCAAGCCTCAACTGTCGTGGTTGCTGAGCAACTCCTTGTCCGTCAAGCCGCCCGCTGAC
GCGCTCCCCAGCGTCGGCGACCACACCTCGAGTACATCTTTGCAATCCAACGCGCGCTCTCACTCTCAGTCACAG
ACTCTGTCCGTCTTGTCTGAGGGTCCTGGGTCGGCCGAGCTGTGCGGTAACGAGCACGAGGCAACGCTGAAGAAG
AGTGACAATATGGGCCGCCTCACGTCGACGACGAAGCCCAAGAAGGCGCTGCTCGTGTCGCAGCAGCCGCAGCAG
CTTCTCACGCCTTCTACCTTGGGCGAAGCGCGCAAGAAGCCGCGTTCGGCGTCTCGAGCTCCTGATTTGCATAGC
GTTGACTTTTCAGCTTCCGCGTCTTGTGTACCAAAAGTTTCTTCAAAGCAAGCACCCTTATCCAACTCTACTAAT
GATTTTGACGACTTTGACGCTGCCGAATTGGAATGCATGGACCTTACAGAACACACGGTTCCTTCCGACGACTTG
CTCACATTTGGTGACGAGGTTTGTCTCTGGGATCAGGACAAGGCGGATTGGTCACCAGTTCTTCCCAGATCTTCC
AAGAAGAGAAAGAGTGATGGGATTAGCAATGGCGAGGGCGACGTTTCATTTCCCGACATTTATCAGCTCATTGGC
ACAGATCCACCCGCACCGACCCCGAGCGGCCGGTCAGCAGTGTCCCGGGCTGGTCGTTCGAGTCCCATCAAGCCG
CGGCGCGAATATAGAGACGTGGACCCTCCTGGCTCGGTGGCCAGTCCGAGAAGTGAAGTTGATCGATTCGGTATC
AATGACGACGTGAGGGACATGTCTTCGCCCTCGAAGCGAGCTGCCAGCCGTCGAGATCATTTAAGGGTTGGTAAA
AAGTCGGGAGCAGTTGGCCAGCAATCGCAGACGCCAGGCAGTGGCAAAAAACGCAGGCTGGCCAATGCTCGGCTA
TGGTCCAATTCACCTGGTCAAAGATCGAGCAAAGGTGCCATGCGCACCTTGTCCATTTCACCTGGACAAAGAGCA
AGCAAGGCCGCCATGCGAGCTGAAGCAAGCGCCCCAATGGCTTGTGTCCCTGATTCCGAAGACGAATTTGTCACT
CCACCGAGCCGCAGTGCCGCCATACGCATGTCGGAAGAGCCTTCTAGGTTGATGGGCGCCAACCCAGCCGCAAGT
CGTCCGCATGAGAATGATGGGGCCACGCCGTGTCCTCAAATGTCTCCCTCACGAGACTATTTAAGCACGACCGAT
CAAGATTTGATACCCGAAGCGTGTCCGCCCTCGTCGAGCCAGACGCCAAGAGTCTTGGCTCATTTATCTGCCAAT
CCACAGGCACTCGGCAGAATGCTTGCGCTCATTGAGACGCAATTGCAAAATAATGGCCACGAGTTTGTGCGTGCT
CTCAACGAACGGTGGCCCAAGGAAAAACGTGACGGAGTCAAGGCAGATAAGGAGCGGTTGATGAAGCAGCAAAAA
GCCATCAAGGATCTTGACGAAGTTATGGGCTCGTATAGATCTATTTGCAGACAACGAGAGGAAGTGGCAGCGCGT
GTTGCCCAGTCGTACAATGATTCGCTCGACACTGACCAAGACGAGCTTTTACTCGACCAACTTACTGACCGTATA
CAGCAACTAGAACAAGGGCTTGTGCATGTTCTCGACGAAGCTGAACTGGATGAAAAGACTCTTGTTGAGCAGCCG
CGTGCTTCGGGCTTGGAAGCCAAGGTTTCGACGCCTGTTAACCGTGGCAGTCAGCCCAACAAGGACATGTTTACG
AGCGAACGAGGAGCAGCTTCTGCTATGTGTCGAACGGCTCAATCTGTCCATGAACCGCAGCTGTCTGAGACTTCG
ATGCCAAAGTTGCAGCTGTGGAACGAGCCAATATCGAGGACAGCGGTTGGCGAGCTAGCCTCTCGCACTGCTGAG
GATTCATTCCAGTCGCCCTTTCCTAGGGACCAGCAGAGGAACAATGGCCGACGAGAAACTTTGAGATGCGTCTCT
GCCAATACCCTTGGCGGCGACACGGGCGTGGTAGAGTCGGACTACATGTCAAACGATGATGGCGGCGTCAACATG
TTGCCACCGCGCCAAGGAGCATCACACGGCGGCGAAGGCGGACGGTCAACAGCAGCTAGAGCTGGAAAGAATGAC
GTTGACGCCTTTAGCGACTTTAGCGACGATGCCGATATGCTAGCTTTTGCTCAAGACTACGAGACGCGCCAGTCG
GTTGTTGCGCCTCGACCAGTACTATCCGAAACGTCGGGGAATGCAGCTCCTCCTCCAAAGCCTGTCACGGCCTCC
AAGAGACAGGCAGCCCCAGTGGTGCCGGCATTTAGTATTCCCAAGGAGCTCATGAAGCATGGCTGGTCGCCAGAC
GTGCAAAAGATGCTCAAGGATCGGTTCAGGATGAAGGGCTTCCGTCACAACCAGCTGCAGGCCATCAACGCGACG
CTGGCGGGCAAAGACGCCTTTGTGCTGATGCCAACAGGAGGCGGCAAGTCGCTGTGCTACCAGCTGCCGGCCGTG
GTCAAGAGTGGAAAGACCAAGGGCGTCACGGTGGTTGTGTCTCCGCTGCTCAGTCTGATGCAAGACCAGGTGGAC
CACTTGAAGGCGCTGGGCATCCAGGCCGTGGCCTTTAACGGCGAATGCTCAAGCGAGTACAAGCGGCAGGTGATG
AGCGCCTTTGGCGAGCGCAGTCCGGAGCATTACATTGAGCTGCTGTACGTGACGCCCGAGATGATGAACAAGAAT
GCCGCCTTCAACAATGCGCTGCAGACGCTCCATCGCCGGGGCAAGTTTGCGCGCCTGGTGATTGACGAGGCGCAT
TGCGTCAGCCAATGGGGGCATGACTTTCGACCCGACTACAAGTCGCTGGGCCAAGTGCGTCTGCGGTTTCCCGAC
GTGCCCGTAATGGCCCTGACGGCGACGGCGACGCAAAACGTCATTGTCGACATCAAGCACAATCTGGGCATGGTG
AATTGCGAGGTGTTTTCGCAGAGCTTCAACCGGCCCAACCTCTACTACGAGGTGCGGACCAAGACGACGAATGTG
GGAGCGACGGACATGATTGCCGATCTCATCCTTTCCAAGTATGCGGGCGTAACGGGCATCGTGTATACGATTTCG
CGCAAGCAGACAGAAGTGGTGGCGGAGTCGCTGCGTGAGCACGGCATCACGGCCCGCCACTACCACGCAGGCATT
GATCCCAAGGAAAAGGTGGAGGTGCAGACGTCGTGGCAAAAGGGCAAGGTCAAGGTGGTTGTGGCGACGATTGCC
TTTGGCATGGGCATTGACAAGGCCGACGTTAGGTTTGTCATGCACCATGGCATTCCCAAGAGCCTCGAGGGCTAT
TACCAGGAGACTGGGCGAGCAGGCAGAGACGGCAAACCGTCGGACTGCATATTGTTTTACGGAAAGGCGGACATA
AGGGTCCTCAAGAAACTGATTGCAGATGGCGACGGCAGCGCCGAGCAGCGGGAGCGGCAAATGGTGATGCTGAAC
CGAGTGACGGCCTTTTGTGACAACAAGGCCGACTGTCGGCGGACCGAGGTACTGCGCTACTTTGGCGAGGACTTT
GTGCCCAGCCAGTGCCACCAGTCGTGCGACAATTGCCAATCTGGCCATGTCTTTGAGCAGCAAGACTTTTCCGAC
TATGCCAGGGCGGCCATTGAGGTGGTGCAGAGGCAGAGGCAGCTGACGGCCATTCAGTGTGCCGATATTCTGCTG
GGCAAAAAGTATCCCAAGCAAGAAGCTGAGCGGTCGAATGAGTATTTTGGCATGGCCAAGAGTCTCAAGAAGCAC
GAGCTGGTGCGCGTCATTGATCGATTATCGGCGGAAAAGGCGTTTGGCGAGGATAACGTTGTAAACAGATGGGGC
ATGGCGACTCAGTATCTCAAGATTGGGCCTACGGCCGGCCAGTTTTTGCACAAGCAGCGGCGGCTGATGTTGACG
GTTCAGGTGGCGGATGAGGGCAAGGGCGCCAACAAGACAAAGCCGCAGGCCAAGAAGAAGAAGGCTGACAAGCAA
ACGACTCTGGCAATGCAGTCGACGTATGTGTCGTCACCAGTGGGCCAGCGAGGCGACTCGGGGGCCAGGGCACGT
GTTGGCGAAGAGGCTGAGCAAGGCGGTCTAACGGCCAATGGCTACGCAAATGACGGATTTGTCGTTTCGGACAAG
GAGCTGGACGAGTCTGACGACGACGACGCGCACTTTGAGCCTCTGCCCAGTCACCGTGCTGCAAGACGCCCAGCC
AGAGAAGAAGCCCGAGGGCGGCCGCGAGCGCTGCCAGATAAGCAGCTGGAGGATCTGCCCTCAGTGGTGCAAGAC
TTGGTGGACAGTTTTGTCAAGAATGCGCAAAAGTGGGACGAACGGGTACGCAACAAGAGAGACTTGAGGCGGCCA
CTCTTTACGGAGCGCGAGCTGCAGCAAATGGCGATGCACTGGACGACTAGCGTGGACAAGATGAAGCGCATACGG
GGCATCGACGTGGACAGGGTGGAGGAGTATGGGCCCAAGCTGCTGCCCATGCTCCAGCGGACCTTTGACTTTTAC
CAGCAAATTGTTTTGCCAGATGTGCGTGCGGCGCTGCAAGAAGAGGATGATATGGATGACGACGACGACGACGAC
GAGGGAGAGGAGGGGGGCGACGCGTCGGTGGTGTTGATTAGTTCAGACGTGGACATGGATGACGCCGAGTATGAA
GACGAGGAACAAGACTCGCGATACTTTGAGACGCAGACGAGGCCAGACGTGGAGGCGTTTCACAATAGGCTAATG
GCATTTGAGCATGCAGCGTCACAGCCCCAGCAGCAGCGAGGCGGAACAAGAGCACAGCGGGGGGGCTTTGCTCGC
GGGGGGAAAAAGGCGTTTAAGCGGTGGAATAAACGGGCGAGTGCGGGAGCGGGAGCAGCAGCGGCGGCGGCGCGG
CGGCGGAGTAGTGGAGGGGGTAAACGGGGAGGAGGCGGGGGGGGAGGGAAGCGGGATGGAAAGAGTGTGAGCAAG
GCGGGGGGGATTGGGCTGATGCCAATGTAG
Gene >OphauB2|4321
ATGACGCGAAACAACCTCAAGCCTCAACTGTCGTGGTTGCTGAGCAACTCCTTGTCCGTCAAGCCGCCCGCTGAC
GCGCTCCCCAGCGTCGGCGACCACACCTCGAGTACATCTTTGCAATCCAACGCGCGCTCTCACTCTCAGTCACAG
ACTCTGTCCGTCTTGTCTGAGGGTCCTGGGTCGGCCGAGCTGTGCGGTAACGAGCACGAGGCAACGCTGAAGAAG
AGTGACAATATGGGCCGCCTCACGTCGACGACGAAGCCCAAGAAGGCGCTGCTCGTGTCGCAGCAGCCGCAGCAG
CTTCTCACGCCTTCTACCTTGGGCGAAGCGCGCAAGAAGCCGCGTTCGGCGTCTCGAGCTCCTGATTTGCATAGC
GTTGGTGCGTATGAGCAAGCTTGCACTTGGTCTCGTTGTCTTGGGGATGGCTTGGGCTTTTTAGGCTAACCCCTA
TAGACTTTTCAGCTTCCGCGTCTTGTGTACCAAAAGTTTCTTCAAAGCAAGCACCCTTATCCAACTCTACTAATG
ATTTTGACGACTTTGACGCTGCCGAATTGGAATGCATGGACCTTACAGAACACACGGTTCCTTCCGACGACTTGC
TCACATTTGGTGACGAGGTTTGTCTCTGGGATCAGGACAAGGCGGATTGGTCACCAGTTCTTCCCAGATCTTCCA
AGAAGAGAAAGAGTGATGGGATTAGCAATGGCGAGGGCGACGTTTCATTTCCCGACATTTATCAGCTCATTGGCA
CAGATCCACCCGCACCGACCCCGAGCGGCCGGTCAGCAGTGTCCCGGGCTGGTCGTTCGAGTCCCATCAAGCCGC
GGCGCGAATATAGAGACGTGGACCCTCCTGGCTCGGTGGCCAGTCCGAGAAGTGAAGTTGATCGATTCGGTATCA
ATGACGACGTGAGGGACATGTCTTCGCCCTCGAAGCGAGCTGCCAGCCGTCGAGATCATTTAAGGGTTGGTAAAA
AGTCGGGAGCAGTTGGCCAGCAATCGCAGACGCCAGGCAGTGGCAAAAAACGCAGGCTGGCCAATGCTCGGCTAT
GGTCCAATTCACCTGGTCAAAGATCGAGCAAAGGTGCCATGCGCACCTTGTCCATTTCACCTGGACAAAGAGCAA
GCAAGGCCGCCATGCGAGCTGAAGCAAGCGCCCCAATGGCTTGTGTCCCTGATTCCGAAGACGAATTTGTCACTC
CACCGAGCCGCAGTGCCGCCATACGCATGTCGGAAGAGCCTTCTAGGTTGATGGGCGCCAACCCAGCCGCAAGTC
GTCCGCATGAGAATGATGGGGCCACGCCGTGTCCTCAAATGTCTCCCTCACGAGACTATTTAAGCACGACCGATC
AAGATTTGATACCCGAAGCGTGTCCGCCCTCGTCGAGCCAGACGCCAAGAGTCTTGGCTCATTTATCTGCCAATC
CACAGGCACTCGGCAGAATGCTTGCGCTCATTGAGACGCAATTGCAAAATAATGGCCACGAGTTTGTGCGTGCTC
TCAACGAACGGTGGCCCAAGGAAAAACGTGACGGAGTCAAGGCAGATAAGGAGCGGTTGATGAAGCAGCAAAAAG
CCATCAAGGATCTTGACGAAGTTATGGGCTCGTATAGATCTATTTGCAGACAACGAGAGGAAGTGGCAGCGCGTG
TTGCCCAGTCGTACAATGATTCGCTCGACACTGACCAAGACGAGCTTTTACTCGACCAACTTACTGACCGTATAC
AGCAACTAGAACAAGGGCTTGTGCATGTTCTCGACGAAGCTGAACTGGATGAAAAGACTCTTGTTGAGCAGCCGC
GTGCTTCGGGCTTGGAAGCCAAGGTTTCGACGCCTGTTAACCGTGGCAGTCAGCCCAACAAGGACATGTTTACGA
GCGAACGAGGAGCAGCTTCTGCTATGTGTCGAACGGCTCAATCTGTCCATGAACCGCAGCTGTCTGAGACTTCGA
TGCCAAAGTTGCAGCTGTGGAACGAGCCAATATCGAGGACAGCGGTTGGCGAGCTAGCCTCTCGCACTGCTGAGG
ATTCATTCCAGTCGCCCTTTCCTAGGGACCAGCAGAGGAACAATGGCCGACGAGAAACTTTGAGATGCGTCTCTG
CCAATACCCTTGGCGGCGACACGGGCGTGGTAGAGTCGGACTACATGTCAAACGATGATGGCGGCGTCAACATGT
TGCCACCGCGCCAAGGAGCATCACACGGCGGCGAAGGCGGACGGTCAACAGCAGCTAGAGCTGGAAAGAATGACG
TTGACGCCTTTAGCGACTTTAGCGACGATGCCGATATGCTAGCTTTTGCTCAAGACTACGAGACGCGCCAGTCGG
TTGTTGCGCCTCGACCAGTACTATCCGAAACGTCGGGGAATGCAGCTCCTCCTCCAAAGCCTGTCACGGCCTCCA
AGAGACAGGCAGCCCCAGTGGTGCCGGCATTTAGTATTCCCAAGGAGCTCATGAAGCATGGCTGGTCGCCAGACG
TGCAAAAGATGCTCAAGGATCGGTTCAGGATGAAGGGCTTCCGTCACAACCAGCTGCAGGCCATCAACGCGACGC
TGGCGGGCAAAGACGCCTTTGTGCTGATGCCAACAGGAGGCGGCAAGTCGCTGTGCTACCAGCTGCCGGCCGTGG
TCAAGAGTGGAAAGACCAAGGGCGTCACGGTGGTTGTGTCTCCGCTGCTCAGTCTGATGCAAGACCAGGTGGACC
ACTTGAAGGCGCTGGGCATCCAGGCCGTGGCCTTTAACGGCGAATGCTCAAGCGAGTACAAGCGGCAGGTGATGA
GCGCCTTTGGCGAGCGCAGTCCGGAGCATTACATTGAGCTGCTGTACGTGACGCCCGAGATGATGAACAAGAATG
CCGCCTTCAACAATGCGCTGCAGACGCTCCATCGCCGGGGCAAGTTTGCGCGCCTGGTGATTGACGAGGCGCATT
GCGTCAGCCAATGGGGGCATGACTTTCGACCCGACTACAAGTCGCTGGGCCAAGTGCGTCTGCGGTTTCCCGACG
TGCCCGTAATGGCCCTGACGGCGACGGCGACGCAAAACGTCATTGTCGACATCAAGCACAATCTGGGCATGGTGA
ATTGCGAGGTGTTTTCGCAGAGCTTCAACCGGCCCAACCTCTACTACGAGGTGCGGACCAAGACGACGAATGTGG
GAGCGACGGACATGATTGCCGATCTCATCCTTTCCAAGTATGCGGGCGTAACGGGCATCGTGTATACGATTTCGC
GCAAGCAGACAGAAGTGGTGGCGGAGTCGCTGCGTGAGCACGGCATCACGGCCCGCCACTACCACGCAGGCATTG
ATCCCAAGGAAAAGGTGGAGGTGCAGACGTCGTGGCAAAAGGGCAAGGTCAAGGTGGTTGTGGCGACGATTGCCT
TTGGCATGGGCATTGACAAGGCCGACGTTAGGTTTGTCATGCACCATGGCATTCCCAAGAGCCTCGAGGGCTATT
ACCAGGAGACTGGGCGAGCAGGCAGAGACGGCAAACCGTCGGACTGCATATTGTTTTACGGAAAGGCGGACATAA
GGGTCCTCAAGAAACTGATTGCAGATGGCGACGGCAGCGCCGAGCAGCGGGAGCGGCAAATGGTGATGCTGAACC
GAGTGACGGCCTTTTGTGACAACAAGGCCGACTGTCGGCGGACCGAGGTACTGCGCTACTTTGGCGAGGACTTTG
TGCCCAGCCAGTGCCACCAGTCGTGCGACAATTGCCAATCTGGCCATGTCTTTGAGCAGCAAGACTTTTCCGACT
ATGCCAGGGCGGCCATTGAGGTGGTGCAGAGGCAGAGGCAGCTGACGGCCATTCAGTGTGCCGATATTCTGCTGG
GCAAAAAGTATCCCAAGCAAGAAGCTGAGCGGTCGAATGAGTATTTTGGCATGGCCAAGAGTCTCAAGAAGCACG
AGCTGGTGCGCGTCATTGATCGATTATCGGCGGAAAAGGCGTTTGGCGAGGATAACGTTGTAAACAGATGGGGCA
TGGCGACTCAGTATCTCAAGATTGGGCCTACGGCCGGCCAGTTTTTGCACAAGCAGCGGCGGCTGATGTTGACGG
TTCAGGTGGCGGATGAGGGCAAGGGCGCCAACAAGACAAAGCCGCAGGCCAAGAAGAAGAAGGCTGACAAGCAAA
CGACTCTGGCAATGCAGTCGACGTATGTGTCGTCACCAGTGGGCCAGCGAGGCGACTCGGGGGCCAGGGCACGTG
TTGGCGAAGAGGCTGAGCAAGGCGGTCTAACGGCCAATGGCTACGCAAATGACGGATTTGTCGTTTCGGACAAGG
AGCTGGACGAGTCTGACGACGACGACGCGCACTTTGAGCCTCTGCCCAGTCACCGTGCTGCAAGACGCCCAGCCA
GAGAAGAAGCCCGAGGGCGGCCGCGAGCGCTGCCAGATAAGCAGCTGGAGGATCTGCCCTCAGTGGTGCAAGACT
TGGTGGACAGTTTTGTCAAGAATGCGCAAAAGTGGGACGAACGGGTACGCAACAAGAGAGACTTGAGGCGGCCAC
TCTTTACGGAGCGCGAGCTGCAGCAAATGGCGATGCACTGGACGACTAGCGTGGACAAGATGAAGCGCATACGGG
GCATCGACGTGGACAGGGTGGAGGAGTATGGGCCCAAGCTGCTGCCCATGCTCCAGCGGACCTTTGACTTTTACC
AGCAAATTGTTTTGCCAGATGTGCGTGCGGCGCTGCAAGAAGAGGATGATATGGATGACGACGACGACGACGACG
AGGGAGAGGAGGGGGGCGACGCGTCGGTGGTGTTGATTAGTTCAGACGTGGACATGGATGACGCCGAGTATGAAG
ACGAGGAACAAGACTCGCGATACTTTGAGACGCAGACGAGGCCAGACGTGGAGGCGTTTCACAATAGGCTAATGG
CATTTGAGCATGCAGCGTCACAGCCCCAGCAGCAGCGAGGCGGAACAAGAGCACAGCGGGGGGGCTTTGCTCGCG
GGGGGAAAAAGGCGTTTAAGCGGTGGAATAAACGGGCGAGTGCGGGAGCGGGAGCAGCAGCGGCGGCGGCGCGGC
GGCGGAGTAGTGGAGGGGGTAAACGGGGAGGAGGCGGGGGGGGAGGGAAGCGGGATGGAAAGAGTGTGAGCAAGG
CGGGGGGGATTGGGCTGATGCCAATGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail