Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|4321
Gene name
LocationContig_29:85380..90509
Strand-
Gene length (bp)5129
Transcript length (bp)5055
Coding sequence length (bp)5055
Protein length (aa) 1685

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00270 DEAD DEAD/DEAH box helicase 4.1E-21 817 989
PF09382 RQC RQC domain 1.8E-16 1218 1330
PF00271 Helicase_C Helicase conserved C-terminal domain 6.9E-13 1040 1135
PF16124 RecQ_Zn_bind RecQ zinc-binding 2.8E-14 1148 1213
PF04851 ResIII Type III restriction enzyme, res subunit 1.2E-07 813 985

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q09811|HUS2_SCHPO ATP-dependent DNA helicase hus2/rqh1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rqh1 PE=1 SV=1 724 1527 3.0E-158
sp|P35187|SGS1_YEAST ATP-dependent helicase SGS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SGS1 PE=1 SV=1 797 1329 5.0E-151
sp|P46063|RECQ1_HUMAN ATP-dependent DNA helicase Q1 OS=Homo sapiens GN=RECQL PE=1 SV=3 797 1313 8.0E-128
sp|Q5RF63|RECQ1_PONAB ATP-dependent DNA helicase Q1 OS=Pongo abelii GN=RECQL PE=2 SV=1 797 1313 1.0E-127
sp|Q6AYJ1|RECQ1_RAT ATP-dependent DNA helicase Q1 OS=Rattus norvegicus GN=Recql PE=1 SV=1 797 1312 2.0E-124
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q09811|HUS2_SCHPO ATP-dependent DNA helicase hus2/rqh1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rqh1 PE=1 SV=1 724 1527 3.0E-158
sp|P35187|SGS1_YEAST ATP-dependent helicase SGS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SGS1 PE=1 SV=1 797 1329 5.0E-151
sp|P46063|RECQ1_HUMAN ATP-dependent DNA helicase Q1 OS=Homo sapiens GN=RECQL PE=1 SV=3 797 1313 8.0E-128
sp|Q5RF63|RECQ1_PONAB ATP-dependent DNA helicase Q1 OS=Pongo abelii GN=RECQL PE=2 SV=1 797 1313 1.0E-127
sp|Q6AYJ1|RECQ1_RAT ATP-dependent DNA helicase Q1 OS=Rattus norvegicus GN=Recql PE=1 SV=1 797 1312 2.0E-124
sp|Q9Z129|RECQ1_MOUSE ATP-dependent DNA helicase Q1 OS=Mus musculus GN=Recql PE=1 SV=2 797 1312 2.0E-123
sp|Q9VGI8|BLM_DROME Bloom syndrome protein homolog OS=Drosophila melanogaster GN=Blm PE=1 SV=1 809 1306 2.0E-122
sp|Q8L840|RQL4A_ARATH ATP-dependent DNA helicase Q-like 4A OS=Arabidopsis thaliana GN=RECQL4A PE=2 SV=1 797 1293 1.0E-119
sp|P54132|BLM_HUMAN Bloom syndrome protein OS=Homo sapiens GN=BLM PE=1 SV=1 800 1317 2.0E-117
sp|Q9I920|BLM_CHICK Bloom syndrome protein homolog (Fragment) OS=Gallus gallus GN=BLM PE=2 SV=1 793 1317 8.0E-117
sp|O88700|BLM_MOUSE Bloom syndrome protein homolog OS=Mus musculus GN=Blm PE=1 SV=1 800 1316 1.0E-116
sp|Q9FT73|MED34_ARATH Mediator of RNA polymerase II transcription subunit 34 OS=Arabidopsis thaliana GN=MED34 PE=1 SV=1 809 1324 3.0E-116
sp|Q9FT70|RQL4B_ARATH ATP-dependent DNA helicase Q-like 4B OS=Arabidopsis thaliana GN=RECQL4B PE=2 SV=1 797 1355 9.0E-116
sp|Q9DEY9|BLM_XENLA Bloom syndrome protein homolog OS=Xenopus laevis GN=blm PE=2 SV=1 798 1317 1.0E-113
sp|Q9TXJ8|RECQ1_CAEEL Putative ATP-dependent DNA helicase Q1 OS=Caenorhabditis elegans GN=K02F3.12 PE=3 SV=3 797 1235 1.0E-111
sp|O18017|BLM_CAEEL Bloom syndrome protein homolog OS=Caenorhabditis elegans GN=him-6 PE=2 SV=2 786 1292 2.0E-111
sp|A8WK63|RECQ1_CAEBR Putative ATP-dependent DNA helicase Q1 OS=Caenorhabditis briggsae GN=CBG24191 PE=3 SV=1 797 1213 1.0E-109
sp|Q9FT74|RQL1_ARATH ATP-dependent DNA helicase Q-like 1 OS=Arabidopsis thaliana GN=RECQL1 PE=2 SV=1 809 1213 6.0E-107
sp|Q9FT72|RQL3_ARATH ATP-dependent DNA helicase Q-like 3 OS=Arabidopsis thaliana GN=RECQL3 PE=1 SV=1 803 1220 2.0E-96
sp|Q9CL21|RECQ_PASMU ATP-dependent DNA helicase RecQ OS=Pasteurella multocida (strain Pm70) GN=recQ PE=3 SV=1 804 1212 4.0E-92
sp|P71359|RECQ_HAEIN ATP-dependent DNA helicase RecQ OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=recQ PE=3 SV=1 799 1212 2.0E-91
sp|P15043|RECQ_ECOLI ATP-dependent DNA helicase RecQ OS=Escherichia coli (strain K12) GN=recQ PE=1 SV=5 802 1212 6.0E-91
sp|Q8VID5|RECQ5_MOUSE ATP-dependent DNA helicase Q5 OS=Mus musculus GN=Recql5 PE=1 SV=1 801 1214 5.0E-90
sp|P40724|RECQ_SALTY ATP-dependent DNA helicase RecQ OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=recQ PE=3 SV=3 802 1212 7.0E-90
sp|D4ACP5|RECQ5_RAT ATP-dependent DNA helicase Q5 OS=Rattus norvegicus GN=Recql5 PE=1 SV=1 801 1214 2.0E-89
sp|O94762|RECQ5_HUMAN ATP-dependent DNA helicase Q5 OS=Homo sapiens GN=RECQL5 PE=1 SV=2 801 1214 8.0E-89
sp|Q5UPX0|YR290_MIMIV Putative ATP-dependent RNA helicase R290 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R290 PE=3 SV=1 814 1284 4.0E-80
sp|Q19546|WRN_CAEEL Probable Werner syndrome ATP-dependent helicase homolog 1 OS=Caenorhabditis elegans GN=wrn-1 PE=3 SV=2 805 1212 2.0E-77
sp|O34748|RECQ_BACSU Probable ATP-dependent DNA helicase RecQ OS=Bacillus subtilis (strain 168) GN=recQ PE=3 SV=1 802 1212 9.0E-73
sp|O93530|WRN_XENLA Werner syndrome ATP-dependent helicase homolog OS=Xenopus laevis GN=wrn PE=2 SV=1 805 1214 2.0E-72
sp|Q14191|WRN_HUMAN Werner syndrome ATP-dependent helicase OS=Homo sapiens GN=WRN PE=1 SV=2 805 1225 2.0E-66
sp|O09053|WRN_MOUSE Werner syndrome ATP-dependent helicase homolog OS=Mus musculus GN=Wrn PE=1 SV=3 805 1213 5.0E-66
sp|P50729|RECS_BACSU Probable ATP-dependent DNA helicase RecS OS=Bacillus subtilis (strain 168) GN=recS PE=3 SV=1 801 1166 2.0E-65
sp|Q0WVW7|RQL5_ARATH ATP-dependent DNA helicase Q-like 5 OS=Arabidopsis thaliana GN=RECQL5 PE=2 SV=2 800 1165 7.0E-56
sp|P73421|RECQ_SYNY3 ATP-dependent DNA helicase RecQ OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=recQ PE=3 SV=1 814 1142 2.0E-54
sp|O94761|RECQ4_HUMAN ATP-dependent DNA helicase Q4 OS=Homo sapiens GN=RECQL4 PE=1 SV=1 704 1157 3.0E-51
sp|Q75NR7|RECQ4_MOUSE ATP-dependent DNA helicase Q4 OS=Mus musculus GN=Recql4 PE=2 SV=2 762 1144 2.0E-50
sp|Q9FT69|RQSIM_ARATH ATP-dependent DNA helicase Q-like SIM OS=Arabidopsis thaliana GN=RECQSIM PE=2 SV=1 797 1055 6.0E-37
sp|Q9FT69|RQSIM_ARATH ATP-dependent DNA helicase Q-like SIM OS=Arabidopsis thaliana GN=RECQSIM PE=2 SV=1 1041 1215 2.0E-28
sp|P0CT33|TLH1_SCHPO ATP-dependent DNA helicase tlh1 (Fragment) OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tlh1 PE=3 SV=1 818 1149 9.0E-25
sp|Q1RKN3|TLH2_SCHPO ATP-dependent DNA helicase tlh2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tlh2 PE=2 SV=1 818 1149 1.0E-24
sp|Q4PFD9|PRP5_USTMA Pre-mRNA-processing ATP-dependent RNA helicase PRP5 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=PRP5 PE=3 SV=1 818 1164 5.0E-12
sp|Q5VQL1|RH14_ORYSJ DEAD-box ATP-dependent RNA helicase 14 OS=Oryza sativa subsp. japonica GN=Os01g0172200 PE=2 SV=1 818 1216 8.0E-12
sp|Q2HAD8|PRP5_CHAGB Pre-mRNA-processing ATP-dependent RNA helicase PRP5 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=PRP5 PE=3 SV=1 818 1144 9.0E-12
sp|Q7SH33|PRP5_NEUCR Pre-mRNA-processing ATP-dependent RNA helicase prp-5 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=prp-5 PE=3 SV=1 783 1144 9.0E-12
sp|Q5R4I9|DDX5_PONAB Probable ATP-dependent RNA helicase DDX5 OS=Pongo abelii GN=DDX5 PE=2 SV=1 818 1158 1.0E-11
sp|Q9C718|RH20_ARATH DEAD-box ATP-dependent RNA helicase 20 OS=Arabidopsis thaliana GN=RH20 PE=2 SV=1 818 1179 1.0E-11
sp|P17844|DDX5_HUMAN Probable ATP-dependent RNA helicase DDX5 OS=Homo sapiens GN=DDX5 PE=1 SV=1 818 1158 1.0E-11
sp|Q61656|DDX5_MOUSE Probable ATP-dependent RNA helicase DDX5 OS=Mus musculus GN=Ddx5 PE=1 SV=2 818 1158 1.0E-11
sp|Q84UQ1|RH42_ORYSJ DEAD-box ATP-dependent RNA helicase 42 OS=Oryza sativa subsp. japonica GN=Os08g0159900 PE=2 SV=1 772 1157 2.0E-11
sp|Q4R6M5|DDX5_MACFA Probable ATP-dependent RNA helicase DDX5 OS=Macaca fascicularis GN=DDX5 PE=2 SV=1 818 1158 2.0E-11
sp|Q5QMN3|RH20_ORYSJ DEAD-box ATP-dependent RNA helicase 20 OS=Oryza sativa subsp. japonica GN=Os01g0197200 PE=3 SV=2 818 1157 4.0E-11
sp|Q92841|DDX17_HUMAN Probable ATP-dependent RNA helicase DDX17 OS=Homo sapiens GN=DDX17 PE=1 SV=2 818 1157 4.0E-11
sp|Q501J6|DDX17_MOUSE Probable ATP-dependent RNA helicase DDX17 OS=Mus musculus GN=Ddx17 PE=1 SV=1 818 1157 4.0E-11
sp|A5A6J2|DDX5_PANTR Probable ATP-dependent RNA helicase DDX5 OS=Pan troglodytes GN=DDX5 PE=2 SV=1 818 1158 6.0E-11
sp|Q0D1K3|PRP5_ASPTN Pre-mRNA-processing ATP-dependent RNA helicase prp5 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=prp5 PE=3 SV=1 783 1144 1.0E-10
sp|Q2U2J6|PRP5_ASPOR Pre-mRNA-processing ATP-dependent RNA helicase prp5 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=prp5 PE=3 SV=1 807 1144 1.0E-10
sp|P46942|DB10_NICSY ATP-dependent RNA helicase-like protein DB10 OS=Nicotiana sylvestris PE=2 SV=1 703 1149 2.0E-10
sp|Q755N4|DBP2_ASHGO ATP-dependent RNA helicase DBP2 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=DBP2 PE=3 SV=2 818 1158 3.0E-10
sp|Q4WT99|PRP5_ASPFU Pre-mRNA-processing ATP-dependent RNA helicase prp5 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=prp5 PE=3 SV=1 783 1144 3.0E-10
sp|A1D373|PRP5_NEOFI Pre-mRNA-processing ATP-dependent RNA helicase prp5 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=prp5 PE=3 SV=1 783 1144 3.0E-10
sp|A2QQA8|PRP5_ASPNC Pre-mRNA-processing ATP-dependent RNA helicase prp5 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=prp5 PE=3 SV=2 783 1144 6.0E-10
sp|Q9LYJ9|RH46_ARATH DEAD-box ATP-dependent RNA helicase 46 OS=Arabidopsis thaliana GN=RH46 PE=2 SV=2 772 1166 7.0E-10
sp|Q4PHU9|DBP2_USTMA ATP-dependent RNA helicase DBP2 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=DBP2 PE=3 SV=2 818 1158 9.0E-10
sp|Q5BDW4|PRP5_EMENI Pre-mRNA-processing ATP-dependent RNA helicase prp5 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=prp5 PE=3 SV=1 783 1145 9.0E-10
sp|Q55BR9|DDX49_DICDI Probable ATP-dependent RNA helicase ddx49 OS=Dictyostelium discoideum GN=ddx49 PE=3 SV=1 818 1154 9.0E-10
sp|Q5N7W4|RH30_ORYSJ DEAD-box ATP-dependent RNA helicase 30 OS=Oryza sativa subsp. japonica GN=Os01g0911100 PE=2 SV=2 818 1157 1.0E-09
sp|A1CQA9|PRP5_ASPCL Pre-mRNA-processing ATP-dependent RNA helicase prp5 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=prp5 PE=3 SV=1 818 1144 2.0E-09
sp|Q55D61|IF4A_DICDI Eukaryotic initiation factor 4A OS=Dictyostelium discoideum GN=tifA PE=3 SV=1 1044 1156 2.0E-09
sp|A6RGE3|DBP2_AJECN ATP-dependent RNA helicase DBP2 OS=Ajellomyces capsulatus (strain NAm1 / WU24) GN=DBP2 PE=3 SV=1 740 1176 2.0E-09
sp|Q2HEB0|PRP28_CHAGB Pre-mRNA-splicing ATP-dependent RNA helicase PRP28 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=PRP28 PE=3 SV=1 1045 1158 3.0E-09
sp|Q94A52|RH2_ARATH DEAD-box ATP-dependent RNA helicase 2 OS=Arabidopsis thaliana GN=RH2 PE=2 SV=2 818 1156 3.0E-09
sp|Q9FNM7|RH26_ARATH DEAD-box ATP-dependent RNA helicase 26 OS=Arabidopsis thaliana GN=RH26 PE=1 SV=2 826 1144 3.0E-09
sp|A3LQ01|DED1_PICST ATP-dependent RNA helicase DED1 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=DED1 PE=3 SV=3 798 1157 3.0E-09
sp|Q4IP34|PRP5_GIBZE Pre-mRNA-processing ATP-dependent RNA helicase PRP5 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=PRP5 PE=3 SV=2 818 1144 3.0E-09
sp|A5DZE6|DED1_LODEL ATP-dependent RNA helicase DED1 OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=DED1 PE=3 SV=1 798 1157 3.0E-09
sp|Q10055|FAL1_SCHPO ATP-dependent RNA helicase fal1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tif412 PE=1 SV=1 1044 1156 3.0E-09
sp|Q49Z29|CSHA_STAS1 DEAD-box ATP-dependent RNA helicase CshA OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=cshA PE=3 SV=1 818 1156 3.0E-09
sp|O13983|HRQ1_SCHPO ATP-dependent helicase hrq1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=hrq1 PE=1 SV=4 812 1139 3.0E-09
sp|Q5RC67|DDX23_PONAB Probable ATP-dependent RNA helicase DDX23 OS=Pongo abelii GN=DDX23 PE=2 SV=1 818 1156 4.0E-09
sp|Q1DP69|DBP2_COCIM ATP-dependent RNA helicase DBP2 OS=Coccidioides immitis (strain RS) GN=DBP2 PE=3 SV=2 737 1157 4.0E-09
sp|Q4L7W0|CSHA_STAHJ DEAD-box ATP-dependent RNA helicase CshA OS=Staphylococcus haemolyticus (strain JCSC1435) GN=cshA PE=3 SV=1 818 1162 4.0E-09
sp|Q9BUQ8|DDX23_HUMAN Probable ATP-dependent RNA helicase DDX23 OS=Homo sapiens GN=DDX23 PE=1 SV=3 818 1156 4.0E-09
sp|Q9VHS8|IF4A3_DROME Eukaryotic initiation factor 4A-III OS=Drosophila melanogaster GN=eIF4AIII PE=1 SV=1 1044 1156 4.0E-09
sp|P27639|IF4A_CAEEL Eukaryotic initiation factor 4A OS=Caenorhabditis elegans GN=inf-1 PE=2 SV=1 834 1156 4.0E-09
sp|Q9P7C7|PRP11_SCHPO Pre-mRNA-processing ATP-dependent RNA helicase prp11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=prp11 PE=3 SV=1 818 1144 4.0E-09
sp|P0CQ72|FAL1_CRYNJ ATP-dependent RNA helicase FAL1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=FAL1 PE=3 SV=1 1044 1156 6.0E-09
sp|P0CQ73|FAL1_CRYNB ATP-dependent RNA helicase FAL1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=FAL1 PE=3 SV=1 1044 1156 6.0E-09
sp|A5E058|PRP5_LODEL Pre-mRNA-processing ATP-dependent RNA helicase PRP5 OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=PRP5 PE=3 SV=1 818 1144 6.0E-09
sp|Q5B0J9|DBP2_EMENI ATP-dependent RNA helicase dbp2 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=dbp2 PE=3 SV=1 818 1158 6.0E-09
sp|A6RW79|PRP5_BOTFB Pre-mRNA-processing ATP-dependent RNA helicase prp5 OS=Botryotinia fuckeliana (strain B05.10) GN=prp5 PE=3 SV=1 818 1144 7.0E-09
sp|Q9NXZ2|DDX43_HUMAN Probable ATP-dependent RNA helicase DDX43 OS=Homo sapiens GN=DDX43 PE=2 SV=2 818 1157 7.0E-09
sp|Q6CIV2|DBP2_KLULA ATP-dependent RNA helicase DBP2 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=DBP2 PE=3 SV=1 818 1155 7.0E-09
sp|Q3EBD3|RH41_ARATH DEAD-box ATP-dependent RNA helicase 41 OS=Arabidopsis thaliana GN=RH41 PE=2 SV=1 818 1175 8.0E-09
sp|Q2GWJ5|FAL1_CHAGB ATP-dependent RNA helicase FAL1 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=FAL1 PE=3 SV=1 1044 1156 8.0E-09
sp|P0CQ76|DBP2_CRYNJ ATP-dependent RNA helicase DBP2-A OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=DBP2 PE=3 SV=1 818 1157 8.0E-09
sp|P0CQ77|DBP2_CRYNB ATP-dependent RNA helicase DBP2-A OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=DBP2 PE=3 SV=1 818 1157 8.0E-09
sp|Q8CRP6|CSHA_STAES DEAD-box ATP-dependent RNA helicase CshA OS=Staphylococcus epidermidis (strain ATCC 12228) GN=cshA PE=3 SV=1 818 1156 9.0E-09
sp|A6ZRX0|DBP2_YEAS7 ATP-dependent RNA helicase DBP2 OS=Saccharomyces cerevisiae (strain YJM789) GN=DBP2 PE=3 SV=1 818 1158 9.0E-09
sp|Q1DTB3|FAL1_COCIM ATP-dependent RNA helicase FAL1 OS=Coccidioides immitis (strain RS) GN=FAL1 PE=3 SV=2 1044 1156 9.0E-09
sp|Q55804|CRHR_SYNY3 RNA helicase CrhR OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=crhR PE=1 SV=1 818 1156 1.0E-08
sp|Q9P735|FAL1_NEUCR ATP-dependent RNA helicase fal-1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=fal-1 PE=3 SV=2 1044 1156 1.0E-08
sp|P24783|DBP2_YEAST ATP-dependent RNA helicase DBP2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DBP2 PE=1 SV=1 818 1158 1.0E-08
sp|Q4IAA0|FAL1_GIBZE ATP-dependent RNA helicase FAL1 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=FAL1 PE=3 SV=1 1044 1156 1.0E-08
sp|A4QU31|FAL1_MAGO7 ATP-dependent RNA helicase FAL1 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=FAL1 PE=3 SV=1 1044 1156 1.0E-08
sp|A4RN46|PRP5_MAGO7 Pre-mRNA-processing ATP-dependent RNA helicase PRP5 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=PRP5 PE=3 SV=1 818 1144 1.0E-08
sp|A6QSQ0|FAL1_AJECN ATP-dependent RNA helicase FAL1 OS=Ajellomyces capsulatus (strain NAm1 / WU24) GN=FAL1 PE=3 SV=1 1044 1156 1.0E-08
sp|Q4P184|FAL1_USTMA ATP-dependent RNA helicase FAL1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=FAL1 PE=3 SV=1 1044 1156 1.0E-08
sp|A6S4N4|FAL1_BOTFB ATP-dependent RNA helicase fal1 OS=Botryotinia fuckeliana (strain B05.10) GN=fal1 PE=3 SV=1 1044 1156 1.0E-08
sp|A7EM88|FAL1_SCLS1 ATP-dependent RNA helicase fal1 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=fal1 PE=3 SV=1 1044 1156 1.0E-08
sp|Q5AUL4|FAL1_EMENI ATP-dependent RNA helicase fal1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=fal1 PE=3 SV=1 1044 1156 1.0E-08
sp|A1C595|FAL1_ASPCL ATP-dependent RNA helicase fal1 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=fal1 PE=3 SV=1 1044 1156 1.0E-08
sp|A5AAE5|FAL1_ASPNC ATP-dependent RNA helicase fal1 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=fal1 PE=3 SV=2 1044 1156 2.0E-08
sp|Q0CAS8|FAL1_ASPTN ATP-dependent RNA helicase fal1 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=fal1 PE=3 SV=1 1044 1156 2.0E-08
sp|A1D071|FAL1_NEOFI ATP-dependent RNA helicase fal1 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=fal1 PE=3 SV=1 1044 1156 2.0E-08
sp|Q2UAK1|FAL1_ASPOR ATP-dependent RNA helicase fal1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=fal1 PE=3 SV=1 1044 1156 2.0E-08
sp|Q5HME0|CSHA_STAEQ DEAD-box ATP-dependent RNA helicase CshA OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=cshA PE=3 SV=1 818 1156 2.0E-08
sp|Q4WEB4|FAL1_ASPFU ATP-dependent RNA helicase fal1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=fal1 PE=3 SV=2 1044 1156 2.0E-08
sp|O02494|IF4A_CRYPV Eukaryotic initiation factor 4A OS=Cryptosporidium parvum GN=EIF4-A PE=2 SV=1 1042 1156 2.0E-08
sp|Q2U070|DBP2_ASPOR ATP-dependent RNA helicase dbp2 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=dbp2 PE=3 SV=1 818 1145 2.0E-08
sp|Q8H136|RH14_ARATH DEAD-box ATP-dependent RNA helicase 14 OS=Arabidopsis thaliana GN=RH14 PE=1 SV=2 818 1167 2.0E-08
sp|Q0E2Z7|RH41_ORYSJ DEAD-box ATP-dependent RNA helicase 41 OS=Oryza sativa subsp. japonica GN=Os02g0201900 PE=2 SV=2 818 1157 3.0E-08
sp|Q9FFQ1|RH31_ARATH DEAD-box ATP-dependent RNA helicase 31 OS=Arabidopsis thaliana GN=RH31 PE=2 SV=2 826 1144 3.0E-08
sp|Q8W4R3|RH30_ARATH DEAD-box ATP-dependent RNA helicase 30 OS=Arabidopsis thaliana GN=RH30 PE=2 SV=2 818 1157 3.0E-08
sp|Q8L7S8|RH3_ARATH DEAD-box ATP-dependent RNA helicase 3, chloroplastic OS=Arabidopsis thaliana GN=RH3 PE=1 SV=2 1022 1156 3.0E-08
sp|A1DGZ7|DBP2_NEOFI ATP-dependent RNA helicase dbp2 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=dbp2 PE=3 SV=1 818 1158 4.0E-08
sp|A2QC74|DBP2_ASPNC ATP-dependent RNA helicase dbp2 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=dbp2 PE=3 SV=1 818 1145 4.0E-08
sp|Q7ZVA6|IF4A3_DANRE Eukaryotic initiation factor 4A-III OS=Danio rerio GN=eif4a3 PE=2 SV=1 1044 1156 4.0E-08
sp|Q6FLF3|DBP2_CANGA ATP-dependent RNA helicase DBP2 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=DBP2 PE=3 SV=1 705 1145 4.0E-08
sp|Q1DHB2|PRP5_COCIM Pre-mRNA-processing ATP-dependent RNA helicase PRP5 OS=Coccidioides immitis (strain RS) GN=PRP5 PE=3 SV=1 783 1144 4.0E-08
sp|Q5A4E2|DED1_CANAL ATP-dependent RNA helicase DED1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=DED1 PE=3 SV=1 1030 1157 4.0E-08
sp|Q54E49|DDX6_DICDI Probable ATP-dependent RNA helicase ddx6 OS=Dictyostelium discoideum GN=ddx6 PE=3 SV=1 818 1136 4.0E-08
sp|Q5VNM3|RH2_ORYSJ DEAD-box ATP-dependent RNA helicase 2 OS=Oryza sativa subsp. japonica GN=Os01g0639100 PE=2 SV=1 1044 1156 5.0E-08
sp|Q98I01|UVRB_RHILO UvrABC system protein B OS=Rhizobium loti (strain MAFF303099) GN=uvrB PE=3 SV=1 942 1212 5.0E-08
sp|Q10I26|RH34_ORYSJ DEAD-box ATP-dependent RNA helicase 34 OS=Oryza sativa subsp. japonica GN=Os03g0566800 PE=2 SV=1 1044 1156 5.0E-08
sp|Q0UAT0|FAL1_PHANO ATP-dependent RNA helicase FAL1 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=FAL1 PE=3 SV=3 1044 1156 5.0E-08
sp|B7ZTW1|IF4A3_XENTR Eukaryotic initiation factor 4A-III OS=Xenopus tropicalis GN=eif4a3 PE=2 SV=1 1044 1156 5.0E-08
sp|Q91VC3|IF4A3_MOUSE Eukaryotic initiation factor 4A-III OS=Mus musculus GN=Eif4a3 PE=1 SV=3 1044 1156 6.0E-08
sp|Q5JKF2|RH40_ORYSJ DEAD-box ATP-dependent RNA helicase 40 OS=Oryza sativa subsp. japonica GN=Os01g0549400 PE=2 SV=2 796 1171 6.0E-08
sp|Q3B8Q2|IF4A3_RAT Eukaryotic initiation factor 4A-III OS=Rattus norvegicus GN=Eif4a3 PE=1 SV=1 1044 1156 6.0E-08
sp|A6M931|IF4A3_PIG Eukaryotic initiation factor 4A-III OS=Sus scrofa GN=EIF4A3 PE=2 SV=1 1044 1156 6.0E-08
sp|Q2NL22|IF4A3_BOVIN Eukaryotic initiation factor 4A-III OS=Bos taurus GN=EIF4A3 PE=2 SV=3 1044 1156 6.0E-08
sp|Q4R3Q1|IF4A3_MACFA Eukaryotic initiation factor 4A-III OS=Macaca fascicularis GN=EIF4A3 PE=2 SV=3 1044 1156 6.0E-08
sp|P38919|IF4A3_HUMAN Eukaryotic initiation factor 4A-III OS=Homo sapiens GN=EIF4A3 PE=1 SV=4 1044 1156 6.0E-08
sp|B5DG42|IF4A3_SALSA Eukaryotic initiation factor 4A-III OS=Salmo salar GN=eif4a3 PE=2 SV=1 1044 1156 6.0E-08
sp|A7ENE0|PRP5_SCLS1 Pre-mRNA-processing ATP-dependent RNA helicase prp5 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=prp5 PE=3 SV=1 818 1144 7.0E-08
sp|Q4X195|DBP2_ASPFU ATP-dependent RNA helicase dbp2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=dbp2 PE=3 SV=2 818 1158 7.0E-08
sp|B5FZY7|IF4A3_TAEGU Eukaryotic initiation factor 4A-III OS=Taeniopygia guttata GN=EIF4A3 PE=2 SV=1 1044 1156 7.0E-08
sp|O42226|I4A3B_XENLA Eukaryotic initiation factor 4A-III-B OS=Xenopus laevis GN=eif4a3-b PE=2 SV=1 1044 1156 7.0E-08
sp|Q5ZM36|IF4A3_CHICK Eukaryotic initiation factor 4A-III OS=Gallus gallus GN=EIF4A3 PE=2 SV=1 1044 1156 8.0E-08
sp|P19109|DDX17_DROME ATP-dependent RNA helicase p62 OS=Drosophila melanogaster GN=Rm62 PE=1 SV=3 818 1157 9.0E-08
sp|Q4WPE9|PRP28_ASPFU Pre-mRNA-splicing ATP-dependent RNA helicase prp28 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=prp28 PE=3 SV=1 1031 1156 9.0E-08
sp|Q0DM51|RH3_ORYSJ DEAD-box ATP-dependent RNA helicase 3, chloroplastic OS=Oryza sativa subsp. japonica GN=Os03g0827700 PE=2 SV=2 1030 1156 9.0E-08
sp|Q75B50|DED1_ASHGO ATP-dependent RNA helicase DED1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=DED1 PE=3 SV=2 798 1157 1.0E-07
sp|Q7SBC6|DBP2_NEUCR ATP-dependent RNA helicase dbp2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=drh-1 PE=3 SV=2 803 1158 1.0E-07
sp|A1CX72|PRP28_NEOFI Pre-mRNA-splicing ATP-dependent RNA helicase prp28 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=prp28 PE=3 SV=1 1031 1156 1.0E-07
sp|Q58083|H669_METJA Probable ATP-dependent RNA helicase MJ0669 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ0669 PE=1 SV=1 1044 1154 1.0E-07
sp|B6EGH8|UVRB_ALISL UvrABC system protein B OS=Aliivibrio salmonicida (strain LFI1238) GN=uvrB PE=3 SV=1 944 1187 1.0E-07
sp|A1C6C4|DBP2_ASPCL ATP-dependent RNA helicase dbp2 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=dbp2 PE=3 SV=1 741 1145 1.0E-07
sp|Q1DMX8|PRP28_COCIM Pre-mRNA-splicing ATP-dependent RNA helicase PRP28 OS=Coccidioides immitis (strain RS) GN=PRP28 PE=3 SV=2 1031 1156 1.0E-07
sp|Q0UWC8|PRP28_PHANO Pre-mRNA-splicing ATP-dependent RNA helicase PRP28 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=PRP28 PE=3 SV=1 1045 1156 1.0E-07
sp|Q2UH00|PRP28_ASPOR Pre-mRNA-splicing ATP-dependent RNA helicase prp28 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=prp28 PE=3 SV=1 1045 1178 1.0E-07
sp|Q7A0D2|CSHA_STAAW DEAD-box ATP-dependent RNA helicase CshA OS=Staphylococcus aureus (strain MW2) GN=cshA PE=3 SV=1 818 1162 1.0E-07
sp|Q6G7M9|CSHA_STAAS DEAD-box ATP-dependent RNA helicase CshA OS=Staphylococcus aureus (strain MSSA476) GN=cshA PE=3 SV=1 818 1162 1.0E-07
sp|Q7A4G0|CSHA_STAAN DEAD-box ATP-dependent RNA helicase CshA OS=Staphylococcus aureus (strain N315) GN=cshA PE=1 SV=1 818 1162 1.0E-07
sp|Q99SH6|CSHA_STAAM DEAD-box ATP-dependent RNA helicase CshA OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=cshA PE=3 SV=1 818 1162 1.0E-07
sp|Q5HEB9|CSHA_STAAC DEAD-box ATP-dependent RNA helicase CshA OS=Staphylococcus aureus (strain COL) GN=cshA PE=3 SV=1 818 1162 1.0E-07
sp|Q2FWH5|CSHA_STAA8 DEAD-box ATP-dependent RNA helicase CshA OS=Staphylococcus aureus (strain NCTC 8325) GN=cshA PE=1 SV=1 818 1162 1.0E-07
sp|Q2FF45|CSHA_STAA3 DEAD-box ATP-dependent RNA helicase CshA OS=Staphylococcus aureus (strain USA300) GN=cshA PE=3 SV=1 818 1162 1.0E-07
sp|Q59LU0|DBP2_CANAL ATP-dependent RNA helicase DBP2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=DBP2 PE=3 SV=2 818 1152 1.0E-07
sp|Q6GEZ3|CSHA_STAAR DEAD-box ATP-dependent RNA helicase CshA OS=Staphylococcus aureus (strain MRSA252) GN=cshA PE=3 SV=1 818 1162 2.0E-07
sp|Q5BCU6|PRP28_EMENI Pre-mRNA-splicing ATP-dependent RNA helicase prp28 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=prp28 PE=3 SV=2 1045 1156 2.0E-07
sp|Q2YUH3|CSHA_STAAB DEAD-box ATP-dependent RNA helicase CshA OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=cshA PE=3 SV=1 818 1162 2.0E-07
sp|Q6CX73|FAL1_KLULA ATP-dependent RNA helicase FAL1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=FAL1 PE=3 SV=1 1045 1149 2.0E-07
sp|Q6CKI1|PRP5_KLULA Pre-mRNA-processing ATP-dependent RNA helicase PRP5 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=PRP5 PE=3 SV=1 796 1134 2.0E-07
sp|Q0CLX0|PRP28_ASPTN Pre-mRNA-splicing ATP-dependent RNA helicase prp28 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=prp28 PE=3 SV=1 1045 1156 2.0E-07
sp|Q5U526|I4A3A_XENLA Eukaryotic initiation factor 4A-III-A OS=Xenopus laevis GN=eif4a3-a PE=2 SV=1 1044 1156 2.0E-07
sp|Q73EU1|CSHA_BACC1 DEAD-box ATP-dependent RNA helicase CshA OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=cshA PE=3 SV=1 818 1144 2.0E-07
sp|P9WH05|DEAD_MYCTU ATP-dependent RNA helicase DeaD OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=deaD PE=1 SV=1 1045 1156 2.0E-07
sp|P9WH04|DEAD_MYCTO ATP-dependent RNA helicase DeaD OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=deaD PE=3 SV=1 1045 1156 2.0E-07
sp|A1CHL3|PRP28_ASPCL Pre-mRNA-splicing ATP-dependent RNA helicase prp28 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=prp28 PE=3 SV=1 1031 1156 2.0E-07
sp|Q7FGZ2|RH1_ARATH DEAD-box ATP-dependent RNA helicase 1 OS=Arabidopsis thaliana GN=RH1 PE=2 SV=3 829 1157 2.0E-07
sp|Q9LUW6|RH9_ARATH DEAD-box ATP-dependent RNA helicase 9 OS=Arabidopsis thaliana GN=RH9 PE=2 SV=1 796 1156 2.0E-07
sp|Q814I2|DBPA_BACCR ATP-dependent RNA helicase DbpA OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=dbpA PE=2 SV=1 818 1156 2.0E-07
sp|Q9SQV1|RH40_ARATH DEAD-box ATP-dependent RNA helicase 40 OS=Arabidopsis thaliana GN=RH40 PE=2 SV=1 818 1171 3.0E-07
sp|Q6BU54|DED1_DEBHA ATP-dependent RNA helicase DED1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=DED1 PE=3 SV=1 771 1157 3.0E-07
sp|Q7SEL0|PRP28_NEUCR Pre-mRNA-splicing ATP-dependent RNA helicase prp-28 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=prp-28 PE=3 SV=1 1045 1156 3.0E-07
sp|Q6HPE6|CSHA_BACHK DEAD-box ATP-dependent RNA helicase CshA OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=cshA PE=3 SV=1 818 1144 3.0E-07
sp|Q81VG0|CSHA_BACAN DEAD-box ATP-dependent RNA helicase CshA OS=Bacillus anthracis GN=cshA PE=3 SV=1 818 1144 3.0E-07
sp|A0R8U6|CSHA_BACAH DEAD-box ATP-dependent RNA helicase CshA OS=Bacillus thuringiensis (strain Al Hakam) GN=cshA PE=3 SV=1 818 1144 3.0E-07
sp|Q0U8V9|DBP8_PHANO ATP-dependent RNA helicase DBP8 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=DBP8 PE=3 SV=1 818 1153 3.0E-07
sp|A2QIL2|PRP28_ASPNC Pre-mRNA-splicing ATP-dependent RNA helicase prp28 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=prp28 PE=3 SV=1 1045 1156 3.0E-07
sp|Q63GX5|CSHA_BACCZ DEAD-box ATP-dependent RNA helicase CshA OS=Bacillus cereus (strain ZK / E33L) GN=cshA PE=3 SV=1 818 1144 4.0E-07
sp|Q4TVV3|DDX46_DANRE Probable ATP-dependent RNA helicase DDX46 OS=Danio rerio GN=ddx46 PE=2 SV=1 818 1160 4.0E-07
sp|Q6LT47|UVRB_PHOPR UvrABC system protein B OS=Photobacterium profundum GN=uvrB PE=3 SV=1 944 1135 4.0E-07
sp|Q8SQK9|DHH1_ENCCU ATP-dependent RNA helicase DHH1 OS=Encephalitozoon cuniculi (strain GB-M1) GN=DHH1 PE=3 SV=2 1045 1142 5.0E-07
sp|A6RJA2|PRP28_BOTFB Pre-mRNA-splicing ATP-dependent RNA helicase prp28 OS=Botryotinia fuckeliana (strain B05.10) GN=prp28 PE=3 SV=1 1045 1149 5.0E-07
sp|A7EGG4|PRP28_SCLS1 Pre-mRNA-splicing ATP-dependent RNA helicase prp28 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=prp28 PE=3 SV=1 1045 1156 5.0E-07
sp|Q81IT9|CSHA_BACCR DEAD-box ATP-dependent RNA helicase CshA OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=cshA PE=2 SV=2 818 1144 5.0E-07
sp|Q12099|FAL1_YEAST ATP-dependent RNA helicase FAL1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FAL1 PE=1 SV=1 1018 1156 5.0E-07
sp|A6ZXY5|FAL1_YEAS7 ATP-dependent RNA helicase FAL1 OS=Saccharomyces cerevisiae (strain YJM789) GN=FAL1 PE=3 SV=1 1018 1156 5.0E-07
sp|Q86TM3|DDX53_HUMAN Probable ATP-dependent RNA helicase DDX53 OS=Homo sapiens GN=DDX53 PE=1 SV=3 818 1174 5.0E-07
sp|P44701|SRMB_HAEIN ATP-dependent RNA helicase SrmB OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=srmB PE=3 SV=1 798 1156 5.0E-07
sp|Q94C75|RH25_ARATH DEAD-box ATP-dependent RNA helicase 25 OS=Arabidopsis thaliana GN=RH25 PE=2 SV=2 826 1144 5.0E-07
sp|Q7RY59|RRP3_NEUCR ATP-dependent rRNA helicase rrp-3 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=rrp-3 PE=3 SV=1 1035 1152 5.0E-07
sp|A6R3L3|DED1_AJECN ATP-dependent RNA helicase DED1 OS=Ajellomyces capsulatus (strain NAm1 / WU24) GN=DED1 PE=3 SV=1 818 1157 5.0E-07
sp|P41380|IF4A3_NICPL Eukaryotic initiation factor 4A-3 OS=Nicotiana plumbaginifolia PE=2 SV=1 1044 1156 6.0E-07
sp|A5DQS0|DED1_PICGU ATP-dependent RNA helicase DED1 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=DED1 PE=3 SV=3 1030 1157 6.0E-07
sp|O34750|YFML_BACSU Probable ATP-dependent RNA helicase YfmL OS=Bacillus subtilis (strain 168) GN=yfmL PE=1 SV=1 800 1156 7.0E-07
sp|P0CQ88|PRP28_CRYNJ Pre-mRNA-splicing ATP-dependent RNA helicase PRP28 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=PRP28 PE=3 SV=1 1045 1156 8.0E-07
sp|P0CQ89|PRP28_CRYNB Pre-mRNA-splicing ATP-dependent RNA helicase PRP28 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=PRP28 PE=3 SV=1 1045 1156 8.0E-07
sp|Q9Y7C4|ROK1_CANAL ATP-dependent RNA helicase CHR1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CHR1 PE=3 SV=1 1072 1157 8.0E-07
sp|Q9CWX9|DDX47_MOUSE Probable ATP-dependent RNA helicase DDX47 OS=Mus musculus GN=Ddx47 PE=2 SV=2 818 1156 8.0E-07
sp|Q9H0S4|DDX47_HUMAN Probable ATP-dependent RNA helicase DDX47 OS=Homo sapiens GN=DDX47 PE=1 SV=1 818 1156 8.0E-07
sp|Q553B1|DDX46_DICDI ATP-dependent RNA helicase ddx46 OS=Dictyostelium discoideum GN=helB1 PE=2 SV=1 796 1136 9.0E-07
sp|A7E436|DBP8_SCLS1 ATP-dependent RNA helicase dbp8 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=dbp8 PE=3 SV=1 821 1153 1.0E-06
sp|A7EML8|RRP3_SCLS1 ATP-dependent rRNA helicase rrp3 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=rrp3 PE=3 SV=1 1035 1156 1.0E-06
sp|Q3MSQ8|DDX4_PELLE Probable ATP-dependent RNA helicase DDX4 OS=Pelophylax lessonae GN=ddx4 PE=2 SV=1 818 1157 1.0E-06
sp|P93008|RH21_ARATH DEAD-box ATP-dependent RNA helicase 21 OS=Arabidopsis thaliana GN=RH21 PE=2 SV=1 1035 1156 1.0E-06
sp|Q5E6B5|UVRB_VIBF1 UvrABC system protein B OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=uvrB PE=3 SV=1 944 1135 1.0E-06
sp|Q4P9P3|DRS1_USTMA ATP-dependent RNA helicase DRS1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=DRS1 PE=3 SV=1 1065 1172 1.0E-06
sp|Q4I7F9|PRP28_GIBZE Pre-mRNA-splicing ATP-dependent RNA helicase PRP28 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=PRP28 PE=3 SV=1 1031 1156 1.0E-06
sp|Q8TFK8|DED1_CANGA ATP-dependent RNA helicase DED1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=DED1 PE=3 SV=1 771 1156 1.0E-06
sp|Q6C347|FAL1_YARLI ATP-dependent RNA helicase FAL1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=FAL1 PE=3 SV=1 1044 1156 2.0E-06
sp|Q6C024|PRP28_YARLI Pre-mRNA-splicing ATP-dependent RNA helicase PRP28 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=PRP28 PE=3 SV=1 1045 1168 2.0E-06
sp|A7TEF4|FAL1_VANPO ATP-dependent RNA helicase FAL1 OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=FAL1 PE=3 SV=1 1018 1156 2.0E-06
sp|Q9DF35|DD21A_XENLA Nucleolar RNA helicase 2-A OS=Xenopus laevis GN=ddx21-a PE=2 SV=2 818 1145 2.0E-06
sp|Q6BP45|ROK1_DEBHA ATP-dependent RNA helicase ROK1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=ROK1 PE=3 SV=2 1072 1157 2.0E-06
sp|A4RK80|PRP28_MAGO7 Pre-mRNA-splicing ATP-dependent RNA helicase PRP28 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=PRP28 PE=3 SV=1 1035 1156 2.0E-06
sp|Q6CLR3|DED1_KLULA ATP-dependent RNA helicase DED1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=DED1 PE=3 SV=1 1029 1158 2.0E-06
sp|Q2FY15|CSHB_STAA8 DEAD-box ATP-dependent RNA helicase CshB OS=Staphylococcus aureus (strain NCTC 8325) GN=cshB PE=3 SV=1 837 1145 2.0E-06
sp|Q5ADL0|PRP5_CANAL Pre-mRNA-processing ATP-dependent RNA helicase PRP5 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PRP5 PE=3 SV=1 783 1144 3.0E-06
sp|Q605S7|UVRB_METCA UvrABC system protein B OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=uvrB PE=3 SV=1 942 1135 3.0E-06
sp|Q9P6U9|DED1_NEUCR ATP-dependent RNA helicase ded1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=drh-9 PE=3 SV=1 818 1157 3.0E-06
sp|Q4I662|DBP8_GIBZE ATP-dependent RNA helicase DBP8 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=DBP8 PE=3 SV=1 821 1152 3.0E-06
sp|A3GHW9|ROK1_PICST ATP-dependent RNA helicase ROK1 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=ROK1 PE=3 SV=1 1045 1157 3.0E-06
sp|Q29S22|DDX47_BOVIN Probable ATP-dependent RNA helicase DDX47 OS=Bos taurus GN=DDX47 PE=2 SV=1 818 1156 3.0E-06
sp|Q5R6D8|DDX46_PONAB Probable ATP-dependent RNA helicase DDX46 OS=Pongo abelii GN=DDX46 PE=2 SV=1 818 1144 4.0E-06
sp|Q8Y7M8|DBPA_LISMO ATP-dependent RNA helicase DbpA OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=dbpA PE=2 SV=1 1001 1198 4.0E-06
sp|O13792|SUB2_SCHPO ATP-dependent RNA helicase uap56 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=uap56 PE=1 SV=3 813 1156 4.0E-06
sp|Q84TG1|RH57_ARATH DEAD-box ATP-dependent RNA helicase 57 OS=Arabidopsis thaliana GN=RH57 PE=2 SV=1 1045 1156 4.0E-06
sp|A6RW56|RRP3_BOTFB ATP-dependent rRNA helicase rrp3 OS=Botryotinia fuckeliana (strain B05.10) GN=rrp3 PE=3 SV=1 1035 1156 4.0E-06
sp|Q0E3X4|RH35A_ORYSJ DEAD-box ATP-dependent RNA helicase 35A OS=Oryza sativa subsp. japonica GN=Os02g0150100 PE=2 SV=2 1045 1147 4.0E-06
sp|Q6D3C4|UVRB_PECAS UvrABC system protein B OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=uvrB PE=3 SV=1 944 1168 4.0E-06
sp|Q9LUW5|RH53_ARATH DEAD-box ATP-dependent RNA helicase 53 OS=Arabidopsis thaliana GN=RH53 PE=2 SV=1 796 1156 4.0E-06
sp|Q0DB53|RH52A_ORYSJ DEAD-box ATP-dependent RNA helicase 52A OS=Oryza sativa subsp. japonica GN=Os06g0602400 PE=2 SV=2 818 1157 5.0E-06
sp|C6DDU0|UVRB_PECCP UvrABC system protein B OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=uvrB PE=3 SV=1 944 1168 5.0E-06
sp|P0A4D8|CSHA_STRR6 DEAD-box ATP-dependent RNA helicase CshA OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=cshA PE=3 SV=1 1044 1144 5.0E-06
sp|P0A4D7|CSHA_STRPN DEAD-box ATP-dependent RNA helicase CshA OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=cshA PE=3 SV=1 1044 1144 5.0E-06
sp|Q6CH90|SUB2_YARLI ATP-dependent RNA helicase SUB2 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=SUB2 PE=3 SV=2 937 1156 5.0E-06
sp|Q5GXX4|UVRB_XANOR UvrABC system protein B OS=Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85) GN=uvrB PE=3 SV=1 1045 1171 6.0E-06
sp|Q4P733|DED1_USTMA ATP-dependent RNA helicase DED1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=DED1 PE=3 SV=1 1030 1157 6.0E-06
sp|Q6FJG1|FAL1_CANGA ATP-dependent RNA helicase FAL1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=FAL1 PE=3 SV=1 1045 1156 6.0E-06
sp|Q9C8J1|RH34_ARATH DEAD-box ATP-dependent RNA helicase 34 OS=Arabidopsis thaliana GN=RH34 PE=2 SV=2 1044 1156 6.0E-06
sp|B2SUN1|UVRB_XANOP UvrABC system protein B OS=Xanthomonas oryzae pv. oryzae (strain PXO99A) GN=uvrB PE=3 SV=1 1045 1171 6.0E-06
sp|A3LQ55|PRP5_PICST Pre-mRNA-processing ATP-dependent RNA helicase PRP5 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=PRP5 PE=3 SV=2 783 1157 7.0E-06
sp|Q9DF36|DD21B_XENLA Nucleolar RNA helicase 2-B OS=Xenopus laevis GN=ddx21-b PE=2 SV=2 818 1145 7.0E-06
sp|Q8PFZ3|RHLB_XANAC ATP-dependent RNA helicase RhlB OS=Xanthomonas axonopodis pv. citri (strain 306) GN=rhlB PE=3 SV=1 1035 1144 8.0E-06
sp|Q5GUR8|RHLB_XANOR ATP-dependent RNA helicase RhlB OS=Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85) GN=rhlB PE=3 SV=2 1035 1144 9.0E-06
sp|Q91VN6|DDX41_MOUSE Probable ATP-dependent RNA helicase DDX41 OS=Mus musculus GN=Ddx41 PE=1 SV=2 1045 1148 9.0E-06
sp|Q6GVM6|DDX3Y_PANTR ATP-dependent RNA helicase DDX3Y OS=Pan troglodytes GN=DDX3Y PE=2 SV=1 1045 1157 1.0E-05
sp|Q9UJV9|DDX41_HUMAN Probable ATP-dependent RNA helicase DDX41 OS=Homo sapiens GN=DDX41 PE=1 SV=2 1045 1148 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0003677 DNA binding Yes
GO:0006281 DNA repair Yes
GO:0003676 nucleic acid binding Yes
GO:0006260 DNA replication Yes
GO:0005524 ATP binding Yes
GO:0043138 3'-5' DNA helicase activity Yes
GO:0016787 hydrolase activity Yes
GO:0033554 cellular response to stress No
GO:0003678 DNA helicase activity No
GO:0043167 ion binding No
GO:0140640 catalytic activity, acting on a nucleic acid No
GO:0032553 ribonucleotide binding No
GO:0004386 helicase activity No
GO:0006807 nitrogen compound metabolic process No
GO:0097367 carbohydrate derivative binding No
GO:0051716 cellular response to stimulus No
GO:1901360 organic cyclic compound metabolic process No
GO:0000166 nucleotide binding No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0017076 purine nucleotide binding No
GO:0003674 molecular_function No
GO:0005488 binding No
GO:0140097 catalytic activity, acting on DNA No
GO:0008150 biological_process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0006950 response to stress No
GO:0043170 macromolecule metabolic process No
GO:0050896 response to stimulus No
GO:0043168 anion binding No
GO:0046483 heterocycle metabolic process No
GO:0006974 cellular response to DNA damage stimulus No
GO:0030554 adenyl nucleotide binding No
GO:0008094 ATP-dependent activity, acting on DNA No
GO:0140657 ATP-dependent activity No
GO:0044238 primary metabolic process No
GO:0009987 cellular process No
GO:0008152 metabolic process No
GO:0036094 small molecule binding No
GO:0032559 adenyl ribonucleotide binding No
GO:0003824 catalytic activity No
GO:0044237 cellular metabolic process No
GO:0006259 DNA metabolic process No
GO:0071704 organic substance metabolic process No
GO:0044260 cellular macromolecule metabolic process No
GO:1901363 heterocyclic compound binding No
GO:0032555 purine ribonucleotide binding No
GO:1901265 nucleoside phosphate binding No
GO:0097159 organic cyclic compound binding No
GO:0090304 nucleic acid metabolic process No
GO:0006139 nucleobase-containing compound metabolic process No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup4132
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3754
Ophiocordyceps australis map64 (Brazil) OphauB2|4321 (this protein)
Ophiocordyceps camponoti-floridani Ophcf2|00359
Ophiocordyceps camponoti-rufipedis Ophun1|7218
Ophiocordyceps kimflemingae Ophio5|2902
Ophiocordyceps subramaniannii Hirsu2|8381

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|4321
MTRNNLKPQLSWLLSNSLSVKPPADALPSVGDHTSSTSLQSNARSHSQSQTLSVLSEGPGSAELCGNEHEATLKK
SDNMGRLTSTTKPKKALLVSQQPQQLLTPSTLGEARKKPRSASRAPDLHSVDFSASASCVPKVSSKQAPLSNSTN
DFDDFDAAELECMDLTEHTVPSDDLLTFGDEVCLWDQDKADWSPVLPRSSKKRKSDGISNGEGDVSFPDIYQLIG
TDPPAPTPSGRSAVSRAGRSSPIKPRREYRDVDPPGSVASPRSEVDRFGINDDVRDMSSPSKRAASRRDHLRVGK
KSGAVGQQSQTPGSGKKRRLANARLWSNSPGQRSSKGAMRTLSISPGQRASKAAMRAEASAPMACVPDSEDEFVT
PPSRSAAIRMSEEPSRLMGANPAASRPHENDGATPCPQMSPSRDYLSTTDQDLIPEACPPSSSQTPRVLAHLSAN
PQALGRMLALIETQLQNNGHEFVRALNERWPKEKRDGVKADKERLMKQQKAIKDLDEVMGSYRSICRQREEVAAR
VAQSYNDSLDTDQDELLLDQLTDRIQQLEQGLVHVLDEAELDEKTLVEQPRASGLEAKVSTPVNRGSQPNKDMFT
SERGAASAMCRTAQSVHEPQLSETSMPKLQLWNEPISRTAVGELASRTAEDSFQSPFPRDQQRNNGRRETLRCVS
ANTLGGDTGVVESDYMSNDDGGVNMLPPRQGASHGGEGGRSTAARAGKNDVDAFSDFSDDADMLAFAQDYETRQS
VVAPRPVLSETSGNAAPPPKPVTASKRQAAPVVPAFSIPKELMKHGWSPDVQKMLKDRFRMKGFRHNQLQAINAT
LAGKDAFVLMPTGGGKSLCYQLPAVVKSGKTKGVTVVVSPLLSLMQDQVDHLKALGIQAVAFNGECSSEYKRQVM
SAFGERSPEHYIELLYVTPEMMNKNAAFNNALQTLHRRGKFARLVIDEAHCVSQWGHDFRPDYKSLGQVRLRFPD
VPVMALTATATQNVIVDIKHNLGMVNCEVFSQSFNRPNLYYEVRTKTTNVGATDMIADLILSKYAGVTGIVYTIS
RKQTEVVAESLREHGITARHYHAGIDPKEKVEVQTSWQKGKVKVVVATIAFGMGIDKADVRFVMHHGIPKSLEGY
YQETGRAGRDGKPSDCILFYGKADIRVLKKLIADGDGSAEQRERQMVMLNRVTAFCDNKADCRRTEVLRYFGEDF
VPSQCHQSCDNCQSGHVFEQQDFSDYARAAIEVVQRQRQLTAIQCADILLGKKYPKQEAERSNEYFGMAKSLKKH
ELVRVIDRLSAEKAFGEDNVVNRWGMATQYLKIGPTAGQFLHKQRRLMLTVQVADEGKGANKTKPQAKKKKADKQ
TTLAMQSTYVSSPVGQRGDSGARARVGEEAEQGGLTANGYANDGFVVSDKELDESDDDDAHFEPLPSHRAARRPA
REEARGRPRALPDKQLEDLPSVVQDLVDSFVKNAQKWDERVRNKRDLRRPLFTERELQQMAMHWTTSVDKMKRIR
GIDVDRVEEYGPKLLPMLQRTFDFYQQIVLPDVRAALQEEDDMDDDDDDDEGEEGGDASVVLISSDVDMDDAEYE
DEEQDSRYFETQTRPDVEAFHNRLMAFEHAASQPQQQRGGTRAQRGGFARGGKKAFKRWNKRASAGAGAAAAAAR
RRSSGGGKRGGGGGGGKRDGKSVSKAGGIGLMPM*
Coding >OphauB2|4321
ATGACGCGAAACAACCTCAAGCCTCAACTGTCGTGGTTGCTGAGCAACTCCTTGTCCGTCAAGCCGCCCGCTGAC
GCGCTCCCCAGCGTCGGCGACCACACCTCGAGTACATCTTTGCAATCCAACGCGCGCTCTCACTCTCAGTCACAG
ACTCTGTCCGTCTTGTCTGAGGGTCCTGGGTCGGCCGAGCTGTGCGGTAACGAGCACGAGGCAACGCTGAAGAAG
AGTGACAATATGGGCCGCCTCACGTCGACGACGAAGCCCAAGAAGGCGCTGCTCGTGTCGCAGCAGCCGCAGCAG
CTTCTCACGCCTTCTACCTTGGGCGAAGCGCGCAAGAAGCCGCGTTCGGCGTCTCGAGCTCCTGATTTGCATAGC
GTTGACTTTTCAGCTTCCGCGTCTTGTGTACCAAAAGTTTCTTCAAAGCAAGCACCCTTATCCAACTCTACTAAT
GATTTTGACGACTTTGACGCTGCCGAATTGGAATGCATGGACCTTACAGAACACACGGTTCCTTCCGACGACTTG
CTCACATTTGGTGACGAGGTTTGTCTCTGGGATCAGGACAAGGCGGATTGGTCACCAGTTCTTCCCAGATCTTCC
AAGAAGAGAAAGAGTGATGGGATTAGCAATGGCGAGGGCGACGTTTCATTTCCCGACATTTATCAGCTCATTGGC
ACAGATCCACCCGCACCGACCCCGAGCGGCCGGTCAGCAGTGTCCCGGGCTGGTCGTTCGAGTCCCATCAAGCCG
CGGCGCGAATATAGAGACGTGGACCCTCCTGGCTCGGTGGCCAGTCCGAGAAGTGAAGTTGATCGATTCGGTATC
AATGACGACGTGAGGGACATGTCTTCGCCCTCGAAGCGAGCTGCCAGCCGTCGAGATCATTTAAGGGTTGGTAAA
AAGTCGGGAGCAGTTGGCCAGCAATCGCAGACGCCAGGCAGTGGCAAAAAACGCAGGCTGGCCAATGCTCGGCTA
TGGTCCAATTCACCTGGTCAAAGATCGAGCAAAGGTGCCATGCGCACCTTGTCCATTTCACCTGGACAAAGAGCA
AGCAAGGCCGCCATGCGAGCTGAAGCAAGCGCCCCAATGGCTTGTGTCCCTGATTCCGAAGACGAATTTGTCACT
CCACCGAGCCGCAGTGCCGCCATACGCATGTCGGAAGAGCCTTCTAGGTTGATGGGCGCCAACCCAGCCGCAAGT
CGTCCGCATGAGAATGATGGGGCCACGCCGTGTCCTCAAATGTCTCCCTCACGAGACTATTTAAGCACGACCGAT
CAAGATTTGATACCCGAAGCGTGTCCGCCCTCGTCGAGCCAGACGCCAAGAGTCTTGGCTCATTTATCTGCCAAT
CCACAGGCACTCGGCAGAATGCTTGCGCTCATTGAGACGCAATTGCAAAATAATGGCCACGAGTTTGTGCGTGCT
CTCAACGAACGGTGGCCCAAGGAAAAACGTGACGGAGTCAAGGCAGATAAGGAGCGGTTGATGAAGCAGCAAAAA
GCCATCAAGGATCTTGACGAAGTTATGGGCTCGTATAGATCTATTTGCAGACAACGAGAGGAAGTGGCAGCGCGT
GTTGCCCAGTCGTACAATGATTCGCTCGACACTGACCAAGACGAGCTTTTACTCGACCAACTTACTGACCGTATA
CAGCAACTAGAACAAGGGCTTGTGCATGTTCTCGACGAAGCTGAACTGGATGAAAAGACTCTTGTTGAGCAGCCG
CGTGCTTCGGGCTTGGAAGCCAAGGTTTCGACGCCTGTTAACCGTGGCAGTCAGCCCAACAAGGACATGTTTACG
AGCGAACGAGGAGCAGCTTCTGCTATGTGTCGAACGGCTCAATCTGTCCATGAACCGCAGCTGTCTGAGACTTCG
ATGCCAAAGTTGCAGCTGTGGAACGAGCCAATATCGAGGACAGCGGTTGGCGAGCTAGCCTCTCGCACTGCTGAG
GATTCATTCCAGTCGCCCTTTCCTAGGGACCAGCAGAGGAACAATGGCCGACGAGAAACTTTGAGATGCGTCTCT
GCCAATACCCTTGGCGGCGACACGGGCGTGGTAGAGTCGGACTACATGTCAAACGATGATGGCGGCGTCAACATG
TTGCCACCGCGCCAAGGAGCATCACACGGCGGCGAAGGCGGACGGTCAACAGCAGCTAGAGCTGGAAAGAATGAC
GTTGACGCCTTTAGCGACTTTAGCGACGATGCCGATATGCTAGCTTTTGCTCAAGACTACGAGACGCGCCAGTCG
GTTGTTGCGCCTCGACCAGTACTATCCGAAACGTCGGGGAATGCAGCTCCTCCTCCAAAGCCTGTCACGGCCTCC
AAGAGACAGGCAGCCCCAGTGGTGCCGGCATTTAGTATTCCCAAGGAGCTCATGAAGCATGGCTGGTCGCCAGAC
GTGCAAAAGATGCTCAAGGATCGGTTCAGGATGAAGGGCTTCCGTCACAACCAGCTGCAGGCCATCAACGCGACG
CTGGCGGGCAAAGACGCCTTTGTGCTGATGCCAACAGGAGGCGGCAAGTCGCTGTGCTACCAGCTGCCGGCCGTG
GTCAAGAGTGGAAAGACCAAGGGCGTCACGGTGGTTGTGTCTCCGCTGCTCAGTCTGATGCAAGACCAGGTGGAC
CACTTGAAGGCGCTGGGCATCCAGGCCGTGGCCTTTAACGGCGAATGCTCAAGCGAGTACAAGCGGCAGGTGATG
AGCGCCTTTGGCGAGCGCAGTCCGGAGCATTACATTGAGCTGCTGTACGTGACGCCCGAGATGATGAACAAGAAT
GCCGCCTTCAACAATGCGCTGCAGACGCTCCATCGCCGGGGCAAGTTTGCGCGCCTGGTGATTGACGAGGCGCAT
TGCGTCAGCCAATGGGGGCATGACTTTCGACCCGACTACAAGTCGCTGGGCCAAGTGCGTCTGCGGTTTCCCGAC
GTGCCCGTAATGGCCCTGACGGCGACGGCGACGCAAAACGTCATTGTCGACATCAAGCACAATCTGGGCATGGTG
AATTGCGAGGTGTTTTCGCAGAGCTTCAACCGGCCCAACCTCTACTACGAGGTGCGGACCAAGACGACGAATGTG
GGAGCGACGGACATGATTGCCGATCTCATCCTTTCCAAGTATGCGGGCGTAACGGGCATCGTGTATACGATTTCG
CGCAAGCAGACAGAAGTGGTGGCGGAGTCGCTGCGTGAGCACGGCATCACGGCCCGCCACTACCACGCAGGCATT
GATCCCAAGGAAAAGGTGGAGGTGCAGACGTCGTGGCAAAAGGGCAAGGTCAAGGTGGTTGTGGCGACGATTGCC
TTTGGCATGGGCATTGACAAGGCCGACGTTAGGTTTGTCATGCACCATGGCATTCCCAAGAGCCTCGAGGGCTAT
TACCAGGAGACTGGGCGAGCAGGCAGAGACGGCAAACCGTCGGACTGCATATTGTTTTACGGAAAGGCGGACATA
AGGGTCCTCAAGAAACTGATTGCAGATGGCGACGGCAGCGCCGAGCAGCGGGAGCGGCAAATGGTGATGCTGAAC
CGAGTGACGGCCTTTTGTGACAACAAGGCCGACTGTCGGCGGACCGAGGTACTGCGCTACTTTGGCGAGGACTTT
GTGCCCAGCCAGTGCCACCAGTCGTGCGACAATTGCCAATCTGGCCATGTCTTTGAGCAGCAAGACTTTTCCGAC
TATGCCAGGGCGGCCATTGAGGTGGTGCAGAGGCAGAGGCAGCTGACGGCCATTCAGTGTGCCGATATTCTGCTG
GGCAAAAAGTATCCCAAGCAAGAAGCTGAGCGGTCGAATGAGTATTTTGGCATGGCCAAGAGTCTCAAGAAGCAC
GAGCTGGTGCGCGTCATTGATCGATTATCGGCGGAAAAGGCGTTTGGCGAGGATAACGTTGTAAACAGATGGGGC
ATGGCGACTCAGTATCTCAAGATTGGGCCTACGGCCGGCCAGTTTTTGCACAAGCAGCGGCGGCTGATGTTGACG
GTTCAGGTGGCGGATGAGGGCAAGGGCGCCAACAAGACAAAGCCGCAGGCCAAGAAGAAGAAGGCTGACAAGCAA
ACGACTCTGGCAATGCAGTCGACGTATGTGTCGTCACCAGTGGGCCAGCGAGGCGACTCGGGGGCCAGGGCACGT
GTTGGCGAAGAGGCTGAGCAAGGCGGTCTAACGGCCAATGGCTACGCAAATGACGGATTTGTCGTTTCGGACAAG
GAGCTGGACGAGTCTGACGACGACGACGCGCACTTTGAGCCTCTGCCCAGTCACCGTGCTGCAAGACGCCCAGCC
AGAGAAGAAGCCCGAGGGCGGCCGCGAGCGCTGCCAGATAAGCAGCTGGAGGATCTGCCCTCAGTGGTGCAAGAC
TTGGTGGACAGTTTTGTCAAGAATGCGCAAAAGTGGGACGAACGGGTACGCAACAAGAGAGACTTGAGGCGGCCA
CTCTTTACGGAGCGCGAGCTGCAGCAAATGGCGATGCACTGGACGACTAGCGTGGACAAGATGAAGCGCATACGG
GGCATCGACGTGGACAGGGTGGAGGAGTATGGGCCCAAGCTGCTGCCCATGCTCCAGCGGACCTTTGACTTTTAC
CAGCAAATTGTTTTGCCAGATGTGCGTGCGGCGCTGCAAGAAGAGGATGATATGGATGACGACGACGACGACGAC
GAGGGAGAGGAGGGGGGCGACGCGTCGGTGGTGTTGATTAGTTCAGACGTGGACATGGATGACGCCGAGTATGAA
GACGAGGAACAAGACTCGCGATACTTTGAGACGCAGACGAGGCCAGACGTGGAGGCGTTTCACAATAGGCTAATG
GCATTTGAGCATGCAGCGTCACAGCCCCAGCAGCAGCGAGGCGGAACAAGAGCACAGCGGGGGGGCTTTGCTCGC
GGGGGGAAAAAGGCGTTTAAGCGGTGGAATAAACGGGCGAGTGCGGGAGCGGGAGCAGCAGCGGCGGCGGCGCGG
CGGCGGAGTAGTGGAGGGGGTAAACGGGGAGGAGGCGGGGGGGGAGGGAAGCGGGATGGAAAGAGTGTGAGCAAG
GCGGGGGGGATTGGGCTGATGCCAATGTAG
Transcript >OphauB2|4321
ATGACGCGAAACAACCTCAAGCCTCAACTGTCGTGGTTGCTGAGCAACTCCTTGTCCGTCAAGCCGCCCGCTGAC
GCGCTCCCCAGCGTCGGCGACCACACCTCGAGTACATCTTTGCAATCCAACGCGCGCTCTCACTCTCAGTCACAG
ACTCTGTCCGTCTTGTCTGAGGGTCCTGGGTCGGCCGAGCTGTGCGGTAACGAGCACGAGGCAACGCTGAAGAAG
AGTGACAATATGGGCCGCCTCACGTCGACGACGAAGCCCAAGAAGGCGCTGCTCGTGTCGCAGCAGCCGCAGCAG
CTTCTCACGCCTTCTACCTTGGGCGAAGCGCGCAAGAAGCCGCGTTCGGCGTCTCGAGCTCCTGATTTGCATAGC
GTTGACTTTTCAGCTTCCGCGTCTTGTGTACCAAAAGTTTCTTCAAAGCAAGCACCCTTATCCAACTCTACTAAT
GATTTTGACGACTTTGACGCTGCCGAATTGGAATGCATGGACCTTACAGAACACACGGTTCCTTCCGACGACTTG
CTCACATTTGGTGACGAGGTTTGTCTCTGGGATCAGGACAAGGCGGATTGGTCACCAGTTCTTCCCAGATCTTCC
AAGAAGAGAAAGAGTGATGGGATTAGCAATGGCGAGGGCGACGTTTCATTTCCCGACATTTATCAGCTCATTGGC
ACAGATCCACCCGCACCGACCCCGAGCGGCCGGTCAGCAGTGTCCCGGGCTGGTCGTTCGAGTCCCATCAAGCCG
CGGCGCGAATATAGAGACGTGGACCCTCCTGGCTCGGTGGCCAGTCCGAGAAGTGAAGTTGATCGATTCGGTATC
AATGACGACGTGAGGGACATGTCTTCGCCCTCGAAGCGAGCTGCCAGCCGTCGAGATCATTTAAGGGTTGGTAAA
AAGTCGGGAGCAGTTGGCCAGCAATCGCAGACGCCAGGCAGTGGCAAAAAACGCAGGCTGGCCAATGCTCGGCTA
TGGTCCAATTCACCTGGTCAAAGATCGAGCAAAGGTGCCATGCGCACCTTGTCCATTTCACCTGGACAAAGAGCA
AGCAAGGCCGCCATGCGAGCTGAAGCAAGCGCCCCAATGGCTTGTGTCCCTGATTCCGAAGACGAATTTGTCACT
CCACCGAGCCGCAGTGCCGCCATACGCATGTCGGAAGAGCCTTCTAGGTTGATGGGCGCCAACCCAGCCGCAAGT
CGTCCGCATGAGAATGATGGGGCCACGCCGTGTCCTCAAATGTCTCCCTCACGAGACTATTTAAGCACGACCGAT
CAAGATTTGATACCCGAAGCGTGTCCGCCCTCGTCGAGCCAGACGCCAAGAGTCTTGGCTCATTTATCTGCCAAT
CCACAGGCACTCGGCAGAATGCTTGCGCTCATTGAGACGCAATTGCAAAATAATGGCCACGAGTTTGTGCGTGCT
CTCAACGAACGGTGGCCCAAGGAAAAACGTGACGGAGTCAAGGCAGATAAGGAGCGGTTGATGAAGCAGCAAAAA
GCCATCAAGGATCTTGACGAAGTTATGGGCTCGTATAGATCTATTTGCAGACAACGAGAGGAAGTGGCAGCGCGT
GTTGCCCAGTCGTACAATGATTCGCTCGACACTGACCAAGACGAGCTTTTACTCGACCAACTTACTGACCGTATA
CAGCAACTAGAACAAGGGCTTGTGCATGTTCTCGACGAAGCTGAACTGGATGAAAAGACTCTTGTTGAGCAGCCG
CGTGCTTCGGGCTTGGAAGCCAAGGTTTCGACGCCTGTTAACCGTGGCAGTCAGCCCAACAAGGACATGTTTACG
AGCGAACGAGGAGCAGCTTCTGCTATGTGTCGAACGGCTCAATCTGTCCATGAACCGCAGCTGTCTGAGACTTCG
ATGCCAAAGTTGCAGCTGTGGAACGAGCCAATATCGAGGACAGCGGTTGGCGAGCTAGCCTCTCGCACTGCTGAG
GATTCATTCCAGTCGCCCTTTCCTAGGGACCAGCAGAGGAACAATGGCCGACGAGAAACTTTGAGATGCGTCTCT
GCCAATACCCTTGGCGGCGACACGGGCGTGGTAGAGTCGGACTACATGTCAAACGATGATGGCGGCGTCAACATG
TTGCCACCGCGCCAAGGAGCATCACACGGCGGCGAAGGCGGACGGTCAACAGCAGCTAGAGCTGGAAAGAATGAC
GTTGACGCCTTTAGCGACTTTAGCGACGATGCCGATATGCTAGCTTTTGCTCAAGACTACGAGACGCGCCAGTCG
GTTGTTGCGCCTCGACCAGTACTATCCGAAACGTCGGGGAATGCAGCTCCTCCTCCAAAGCCTGTCACGGCCTCC
AAGAGACAGGCAGCCCCAGTGGTGCCGGCATTTAGTATTCCCAAGGAGCTCATGAAGCATGGCTGGTCGCCAGAC
GTGCAAAAGATGCTCAAGGATCGGTTCAGGATGAAGGGCTTCCGTCACAACCAGCTGCAGGCCATCAACGCGACG
CTGGCGGGCAAAGACGCCTTTGTGCTGATGCCAACAGGAGGCGGCAAGTCGCTGTGCTACCAGCTGCCGGCCGTG
GTCAAGAGTGGAAAGACCAAGGGCGTCACGGTGGTTGTGTCTCCGCTGCTCAGTCTGATGCAAGACCAGGTGGAC
CACTTGAAGGCGCTGGGCATCCAGGCCGTGGCCTTTAACGGCGAATGCTCAAGCGAGTACAAGCGGCAGGTGATG
AGCGCCTTTGGCGAGCGCAGTCCGGAGCATTACATTGAGCTGCTGTACGTGACGCCCGAGATGATGAACAAGAAT
GCCGCCTTCAACAATGCGCTGCAGACGCTCCATCGCCGGGGCAAGTTTGCGCGCCTGGTGATTGACGAGGCGCAT
TGCGTCAGCCAATGGGGGCATGACTTTCGACCCGACTACAAGTCGCTGGGCCAAGTGCGTCTGCGGTTTCCCGAC
GTGCCCGTAATGGCCCTGACGGCGACGGCGACGCAAAACGTCATTGTCGACATCAAGCACAATCTGGGCATGGTG
AATTGCGAGGTGTTTTCGCAGAGCTTCAACCGGCCCAACCTCTACTACGAGGTGCGGACCAAGACGACGAATGTG
GGAGCGACGGACATGATTGCCGATCTCATCCTTTCCAAGTATGCGGGCGTAACGGGCATCGTGTATACGATTTCG
CGCAAGCAGACAGAAGTGGTGGCGGAGTCGCTGCGTGAGCACGGCATCACGGCCCGCCACTACCACGCAGGCATT
GATCCCAAGGAAAAGGTGGAGGTGCAGACGTCGTGGCAAAAGGGCAAGGTCAAGGTGGTTGTGGCGACGATTGCC
TTTGGCATGGGCATTGACAAGGCCGACGTTAGGTTTGTCATGCACCATGGCATTCCCAAGAGCCTCGAGGGCTAT
TACCAGGAGACTGGGCGAGCAGGCAGAGACGGCAAACCGTCGGACTGCATATTGTTTTACGGAAAGGCGGACATA
AGGGTCCTCAAGAAACTGATTGCAGATGGCGACGGCAGCGCCGAGCAGCGGGAGCGGCAAATGGTGATGCTGAAC
CGAGTGACGGCCTTTTGTGACAACAAGGCCGACTGTCGGCGGACCGAGGTACTGCGCTACTTTGGCGAGGACTTT
GTGCCCAGCCAGTGCCACCAGTCGTGCGACAATTGCCAATCTGGCCATGTCTTTGAGCAGCAAGACTTTTCCGAC
TATGCCAGGGCGGCCATTGAGGTGGTGCAGAGGCAGAGGCAGCTGACGGCCATTCAGTGTGCCGATATTCTGCTG
GGCAAAAAGTATCCCAAGCAAGAAGCTGAGCGGTCGAATGAGTATTTTGGCATGGCCAAGAGTCTCAAGAAGCAC
GAGCTGGTGCGCGTCATTGATCGATTATCGGCGGAAAAGGCGTTTGGCGAGGATAACGTTGTAAACAGATGGGGC
ATGGCGACTCAGTATCTCAAGATTGGGCCTACGGCCGGCCAGTTTTTGCACAAGCAGCGGCGGCTGATGTTGACG
GTTCAGGTGGCGGATGAGGGCAAGGGCGCCAACAAGACAAAGCCGCAGGCCAAGAAGAAGAAGGCTGACAAGCAA
ACGACTCTGGCAATGCAGTCGACGTATGTGTCGTCACCAGTGGGCCAGCGAGGCGACTCGGGGGCCAGGGCACGT
GTTGGCGAAGAGGCTGAGCAAGGCGGTCTAACGGCCAATGGCTACGCAAATGACGGATTTGTCGTTTCGGACAAG
GAGCTGGACGAGTCTGACGACGACGACGCGCACTTTGAGCCTCTGCCCAGTCACCGTGCTGCAAGACGCCCAGCC
AGAGAAGAAGCCCGAGGGCGGCCGCGAGCGCTGCCAGATAAGCAGCTGGAGGATCTGCCCTCAGTGGTGCAAGAC
TTGGTGGACAGTTTTGTCAAGAATGCGCAAAAGTGGGACGAACGGGTACGCAACAAGAGAGACTTGAGGCGGCCA
CTCTTTACGGAGCGCGAGCTGCAGCAAATGGCGATGCACTGGACGACTAGCGTGGACAAGATGAAGCGCATACGG
GGCATCGACGTGGACAGGGTGGAGGAGTATGGGCCCAAGCTGCTGCCCATGCTCCAGCGGACCTTTGACTTTTAC
CAGCAAATTGTTTTGCCAGATGTGCGTGCGGCGCTGCAAGAAGAGGATGATATGGATGACGACGACGACGACGAC
GAGGGAGAGGAGGGGGGCGACGCGTCGGTGGTGTTGATTAGTTCAGACGTGGACATGGATGACGCCGAGTATGAA
GACGAGGAACAAGACTCGCGATACTTTGAGACGCAGACGAGGCCAGACGTGGAGGCGTTTCACAATAGGCTAATG
GCATTTGAGCATGCAGCGTCACAGCCCCAGCAGCAGCGAGGCGGAACAAGAGCACAGCGGGGGGGCTTTGCTCGC
GGGGGGAAAAAGGCGTTTAAGCGGTGGAATAAACGGGCGAGTGCGGGAGCGGGAGCAGCAGCGGCGGCGGCGCGG
CGGCGGAGTAGTGGAGGGGGTAAACGGGGAGGAGGCGGGGGGGGAGGGAAGCGGGATGGAAAGAGTGTGAGCAAG
GCGGGGGGGATTGGGCTGATGCCAATGTAG
Gene >OphauB2|4321
ATGACGCGAAACAACCTCAAGCCTCAACTGTCGTGGTTGCTGAGCAACTCCTTGTCCGTCAAGCCGCCCGCTGAC
GCGCTCCCCAGCGTCGGCGACCACACCTCGAGTACATCTTTGCAATCCAACGCGCGCTCTCACTCTCAGTCACAG
ACTCTGTCCGTCTTGTCTGAGGGTCCTGGGTCGGCCGAGCTGTGCGGTAACGAGCACGAGGCAACGCTGAAGAAG
AGTGACAATATGGGCCGCCTCACGTCGACGACGAAGCCCAAGAAGGCGCTGCTCGTGTCGCAGCAGCCGCAGCAG
CTTCTCACGCCTTCTACCTTGGGCGAAGCGCGCAAGAAGCCGCGTTCGGCGTCTCGAGCTCCTGATTTGCATAGC
GTTGGTGCGTATGAGCAAGCTTGCACTTGGTCTCGTTGTCTTGGGGATGGCTTGGGCTTTTTAGGCTAACCCCTA
TAGACTTTTCAGCTTCCGCGTCTTGTGTACCAAAAGTTTCTTCAAAGCAAGCACCCTTATCCAACTCTACTAATG
ATTTTGACGACTTTGACGCTGCCGAATTGGAATGCATGGACCTTACAGAACACACGGTTCCTTCCGACGACTTGC
TCACATTTGGTGACGAGGTTTGTCTCTGGGATCAGGACAAGGCGGATTGGTCACCAGTTCTTCCCAGATCTTCCA
AGAAGAGAAAGAGTGATGGGATTAGCAATGGCGAGGGCGACGTTTCATTTCCCGACATTTATCAGCTCATTGGCA
CAGATCCACCCGCACCGACCCCGAGCGGCCGGTCAGCAGTGTCCCGGGCTGGTCGTTCGAGTCCCATCAAGCCGC
GGCGCGAATATAGAGACGTGGACCCTCCTGGCTCGGTGGCCAGTCCGAGAAGTGAAGTTGATCGATTCGGTATCA
ATGACGACGTGAGGGACATGTCTTCGCCCTCGAAGCGAGCTGCCAGCCGTCGAGATCATTTAAGGGTTGGTAAAA
AGTCGGGAGCAGTTGGCCAGCAATCGCAGACGCCAGGCAGTGGCAAAAAACGCAGGCTGGCCAATGCTCGGCTAT
GGTCCAATTCACCTGGTCAAAGATCGAGCAAAGGTGCCATGCGCACCTTGTCCATTTCACCTGGACAAAGAGCAA
GCAAGGCCGCCATGCGAGCTGAAGCAAGCGCCCCAATGGCTTGTGTCCCTGATTCCGAAGACGAATTTGTCACTC
CACCGAGCCGCAGTGCCGCCATACGCATGTCGGAAGAGCCTTCTAGGTTGATGGGCGCCAACCCAGCCGCAAGTC
GTCCGCATGAGAATGATGGGGCCACGCCGTGTCCTCAAATGTCTCCCTCACGAGACTATTTAAGCACGACCGATC
AAGATTTGATACCCGAAGCGTGTCCGCCCTCGTCGAGCCAGACGCCAAGAGTCTTGGCTCATTTATCTGCCAATC
CACAGGCACTCGGCAGAATGCTTGCGCTCATTGAGACGCAATTGCAAAATAATGGCCACGAGTTTGTGCGTGCTC
TCAACGAACGGTGGCCCAAGGAAAAACGTGACGGAGTCAAGGCAGATAAGGAGCGGTTGATGAAGCAGCAAAAAG
CCATCAAGGATCTTGACGAAGTTATGGGCTCGTATAGATCTATTTGCAGACAACGAGAGGAAGTGGCAGCGCGTG
TTGCCCAGTCGTACAATGATTCGCTCGACACTGACCAAGACGAGCTTTTACTCGACCAACTTACTGACCGTATAC
AGCAACTAGAACAAGGGCTTGTGCATGTTCTCGACGAAGCTGAACTGGATGAAAAGACTCTTGTTGAGCAGCCGC
GTGCTTCGGGCTTGGAAGCCAAGGTTTCGACGCCTGTTAACCGTGGCAGTCAGCCCAACAAGGACATGTTTACGA
GCGAACGAGGAGCAGCTTCTGCTATGTGTCGAACGGCTCAATCTGTCCATGAACCGCAGCTGTCTGAGACTTCGA
TGCCAAAGTTGCAGCTGTGGAACGAGCCAATATCGAGGACAGCGGTTGGCGAGCTAGCCTCTCGCACTGCTGAGG
ATTCATTCCAGTCGCCCTTTCCTAGGGACCAGCAGAGGAACAATGGCCGACGAGAAACTTTGAGATGCGTCTCTG
CCAATACCCTTGGCGGCGACACGGGCGTGGTAGAGTCGGACTACATGTCAAACGATGATGGCGGCGTCAACATGT
TGCCACCGCGCCAAGGAGCATCACACGGCGGCGAAGGCGGACGGTCAACAGCAGCTAGAGCTGGAAAGAATGACG
TTGACGCCTTTAGCGACTTTAGCGACGATGCCGATATGCTAGCTTTTGCTCAAGACTACGAGACGCGCCAGTCGG
TTGTTGCGCCTCGACCAGTACTATCCGAAACGTCGGGGAATGCAGCTCCTCCTCCAAAGCCTGTCACGGCCTCCA
AGAGACAGGCAGCCCCAGTGGTGCCGGCATTTAGTATTCCCAAGGAGCTCATGAAGCATGGCTGGTCGCCAGACG
TGCAAAAGATGCTCAAGGATCGGTTCAGGATGAAGGGCTTCCGTCACAACCAGCTGCAGGCCATCAACGCGACGC
TGGCGGGCAAAGACGCCTTTGTGCTGATGCCAACAGGAGGCGGCAAGTCGCTGTGCTACCAGCTGCCGGCCGTGG
TCAAGAGTGGAAAGACCAAGGGCGTCACGGTGGTTGTGTCTCCGCTGCTCAGTCTGATGCAAGACCAGGTGGACC
ACTTGAAGGCGCTGGGCATCCAGGCCGTGGCCTTTAACGGCGAATGCTCAAGCGAGTACAAGCGGCAGGTGATGA
GCGCCTTTGGCGAGCGCAGTCCGGAGCATTACATTGAGCTGCTGTACGTGACGCCCGAGATGATGAACAAGAATG
CCGCCTTCAACAATGCGCTGCAGACGCTCCATCGCCGGGGCAAGTTTGCGCGCCTGGTGATTGACGAGGCGCATT
GCGTCAGCCAATGGGGGCATGACTTTCGACCCGACTACAAGTCGCTGGGCCAAGTGCGTCTGCGGTTTCCCGACG
TGCCCGTAATGGCCCTGACGGCGACGGCGACGCAAAACGTCATTGTCGACATCAAGCACAATCTGGGCATGGTGA
ATTGCGAGGTGTTTTCGCAGAGCTTCAACCGGCCCAACCTCTACTACGAGGTGCGGACCAAGACGACGAATGTGG
GAGCGACGGACATGATTGCCGATCTCATCCTTTCCAAGTATGCGGGCGTAACGGGCATCGTGTATACGATTTCGC
GCAAGCAGACAGAAGTGGTGGCGGAGTCGCTGCGTGAGCACGGCATCACGGCCCGCCACTACCACGCAGGCATTG
ATCCCAAGGAAAAGGTGGAGGTGCAGACGTCGTGGCAAAAGGGCAAGGTCAAGGTGGTTGTGGCGACGATTGCCT
TTGGCATGGGCATTGACAAGGCCGACGTTAGGTTTGTCATGCACCATGGCATTCCCAAGAGCCTCGAGGGCTATT
ACCAGGAGACTGGGCGAGCAGGCAGAGACGGCAAACCGTCGGACTGCATATTGTTTTACGGAAAGGCGGACATAA
GGGTCCTCAAGAAACTGATTGCAGATGGCGACGGCAGCGCCGAGCAGCGGGAGCGGCAAATGGTGATGCTGAACC
GAGTGACGGCCTTTTGTGACAACAAGGCCGACTGTCGGCGGACCGAGGTACTGCGCTACTTTGGCGAGGACTTTG
TGCCCAGCCAGTGCCACCAGTCGTGCGACAATTGCCAATCTGGCCATGTCTTTGAGCAGCAAGACTTTTCCGACT
ATGCCAGGGCGGCCATTGAGGTGGTGCAGAGGCAGAGGCAGCTGACGGCCATTCAGTGTGCCGATATTCTGCTGG
GCAAAAAGTATCCCAAGCAAGAAGCTGAGCGGTCGAATGAGTATTTTGGCATGGCCAAGAGTCTCAAGAAGCACG
AGCTGGTGCGCGTCATTGATCGATTATCGGCGGAAAAGGCGTTTGGCGAGGATAACGTTGTAAACAGATGGGGCA
TGGCGACTCAGTATCTCAAGATTGGGCCTACGGCCGGCCAGTTTTTGCACAAGCAGCGGCGGCTGATGTTGACGG
TTCAGGTGGCGGATGAGGGCAAGGGCGCCAACAAGACAAAGCCGCAGGCCAAGAAGAAGAAGGCTGACAAGCAAA
CGACTCTGGCAATGCAGTCGACGTATGTGTCGTCACCAGTGGGCCAGCGAGGCGACTCGGGGGCCAGGGCACGTG
TTGGCGAAGAGGCTGAGCAAGGCGGTCTAACGGCCAATGGCTACGCAAATGACGGATTTGTCGTTTCGGACAAGG
AGCTGGACGAGTCTGACGACGACGACGCGCACTTTGAGCCTCTGCCCAGTCACCGTGCTGCAAGACGCCCAGCCA
GAGAAGAAGCCCGAGGGCGGCCGCGAGCGCTGCCAGATAAGCAGCTGGAGGATCTGCCCTCAGTGGTGCAAGACT
TGGTGGACAGTTTTGTCAAGAATGCGCAAAAGTGGGACGAACGGGTACGCAACAAGAGAGACTTGAGGCGGCCAC
TCTTTACGGAGCGCGAGCTGCAGCAAATGGCGATGCACTGGACGACTAGCGTGGACAAGATGAAGCGCATACGGG
GCATCGACGTGGACAGGGTGGAGGAGTATGGGCCCAAGCTGCTGCCCATGCTCCAGCGGACCTTTGACTTTTACC
AGCAAATTGTTTTGCCAGATGTGCGTGCGGCGCTGCAAGAAGAGGATGATATGGATGACGACGACGACGACGACG
AGGGAGAGGAGGGGGGCGACGCGTCGGTGGTGTTGATTAGTTCAGACGTGGACATGGATGACGCCGAGTATGAAG
ACGAGGAACAAGACTCGCGATACTTTGAGACGCAGACGAGGCCAGACGTGGAGGCGTTTCACAATAGGCTAATGG
CATTTGAGCATGCAGCGTCACAGCCCCAGCAGCAGCGAGGCGGAACAAGAGCACAGCGGGGGGGCTTTGCTCGCG
GGGGGAAAAAGGCGTTTAAGCGGTGGAATAAACGGGCGAGTGCGGGAGCGGGAGCAGCAGCGGCGGCGGCGCGGC
GGCGGAGTAGTGGAGGGGGTAAACGGGGAGGAGGCGGGGGGGGAGGGAAGCGGGATGGAAAGAGTGTGAGCAAGG
CGGGGGGGATTGGGCTGATGCCAATGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail