Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|4317
Gene name
LocationContig_29:76831..77203
Strand-
Gene length (bp)372
Transcript length (bp)222
Coding sequence length (bp)222
Protein length (aa) 74

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05051 COX17 Cytochrome C oxidase copper chaperone (COX17) 3.9E-20 25 73

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q12287|COX17_YEAST Cytochrome c oxidase copper chaperone OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=COX17 PE=1 SV=3 25 73 7.0E-12
sp|Q9P7Z7|COX17_SCHPO Cytochrome c oxidase copper chaperone OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cox17 PE=3 SV=1 2 73 7.0E-09
sp|Q6J3Q7|COX17_CANLF Cytochrome c oxidase copper chaperone OS=Canis lupus familiaris GN=COX17 PE=3 SV=3 6 73 2.0E-06

GO

GO Term Description Terminal node
GO:0005507 copper ion binding Yes
GO:0005758 mitochondrial intermembrane space Yes
GO:0016531 copper chaperone activity Yes
GO:0031970 organelle envelope lumen No
GO:0110165 cellular anatomical entity No
GO:0031974 membrane-enclosed lumen No
GO:0003674 molecular_function No
GO:0005488 binding No
GO:0046872 metal ion binding No
GO:0140104 molecular carrier activity No
GO:0016530 metallochaperone activity No
GO:0070013 intracellular organelle lumen No
GO:0005575 cellular_component No
GO:0043233 organelle lumen No
GO:0043167 ion binding No
GO:0046914 transition metal ion binding No
GO:0043169 cation binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 18 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|4317
MEATSSTSSVSPAPTSASSTDPASKPKPCCVCKDEKAKRDECMLYSTAQDPAQDCRSLVDQYKSCMLGYGYKI*
Coding >OphauB2|4317
ATGGAAGCTACATCCTCAACCTCGTCCGTCTCTCCCGCTCCCACATCTGCCTCGAGCACAGACCCAGCCTCCAAG
CCAAAGCCTTGTTGCGTCTGCAAGGACGAAAAGGCCAAGCGCGATGAATGCATGCTCTATTCCACGGCCCAGGAC
CCGGCGCAGGACTGCAGGTCGCTAGTCGACCAGTATAAAAGCTGTATGCTTGGCTATGGATACAAGATTTAA
Transcript >OphauB2|4317
ATGGAAGCTACATCCTCAACCTCGTCCGTCTCTCCCGCTCCCACATCTGCCTCGAGCACAGACCCAGCCTCCAAG
CCAAAGCCTTGTTGCGTCTGCAAGGACGAAAAGGCCAAGCGCGATGAATGCATGCTCTATTCCACGGCCCAGGAC
CCGGCGCAGGACTGCAGGTCGCTAGTCGACCAGTATAAAAGCTGTATGCTTGGCTATGGATACAAGATTTAA
Gene >OphauB2|4317
ATGGAAGCTACATCCTCAACCTCGTCCGTCTGTACGTTCTTCTTTTTCTCCCTCTTGTCATCCATGGTCCATCTA
CCAGACTTTTCCTCCCCCCCGGAACCACTATTCCCAACCTGCTAACCACGGCCATAGCTCCCGCTCCCACATCTG
CCTCGAGCACAGACCCAGCCTCCAAGCCAAAGGTGCGCTCCTCGCTTCCTCATGCCCTTGCCTAGTCTAACAGAG
GTGTAGCCTTGTTGCGTCTGCAAGGACGAAAAGGCCAAGCGCGATGAATGCATGCTCTATTCCACGGCCCAGGAC
CCGGCGCAGGACTGCAGGTCGCTAGTCGACCAGTATAAAAGCTGTATGCTTGGCTATGGATACAAGATTTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail