Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|4315
Gene name
LocationContig_29:73749..75533
Strand+
Gene length (bp)1784
Transcript length (bp)1605
Coding sequence length (bp)1605
Protein length (aa) 535

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00118 Cpn60_TCP1 TCP-1/cpn60 chaperonin family 1.3E-150 37 530

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P50999|TCPD_SCHPO T-complex protein 1 subunit delta OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cct4 PE=2 SV=2 17 534 0.0E+00
sp|Q6CL82|TCPD_KLULA T-complex protein 1 subunit delta OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=CCT4 PE=3 SV=1 6 534 0.0E+00
sp|Q6BXF6|TCPD_DEBHA T-complex protein 1 subunit delta OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=CCT4 PE=3 SV=1 10 534 0.0E+00
sp|Q75A36|TCPD_ASHGO T-complex protein 1 subunit delta OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=CCT4 PE=3 SV=1 11 534 0.0E+00
sp|Q6FQT2|TCPD_CANGA T-complex protein 1 subunit delta OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=CCT4 PE=3 SV=1 11 534 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P50999|TCPD_SCHPO T-complex protein 1 subunit delta OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cct4 PE=2 SV=2 17 534 0.0E+00
sp|Q6CL82|TCPD_KLULA T-complex protein 1 subunit delta OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=CCT4 PE=3 SV=1 6 534 0.0E+00
sp|Q6BXF6|TCPD_DEBHA T-complex protein 1 subunit delta OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=CCT4 PE=3 SV=1 10 534 0.0E+00
sp|Q75A36|TCPD_ASHGO T-complex protein 1 subunit delta OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=CCT4 PE=3 SV=1 11 534 0.0E+00
sp|Q6FQT2|TCPD_CANGA T-complex protein 1 subunit delta OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=CCT4 PE=3 SV=1 11 534 0.0E+00
sp|P39078|TCPD_YEAST T-complex protein 1 subunit delta OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CCT4 PE=1 SV=2 14 534 0.0E+00
sp|Q7TPB1|TCPD_RAT T-complex protein 1 subunit delta OS=Rattus norvegicus GN=Cct4 PE=1 SV=3 2 534 0.0E+00
sp|P80315|TCPD_MOUSE T-complex protein 1 subunit delta OS=Mus musculus GN=Cct4 PE=1 SV=3 2 534 0.0E+00
sp|P50991|TCPD_HUMAN T-complex protein 1 subunit delta OS=Homo sapiens GN=CCT4 PE=1 SV=4 17 534 0.0E+00
sp|Q5R637|TCPD_PONAB T-complex protein 1 subunit delta OS=Pongo abelii GN=CCT4 PE=2 SV=3 17 534 0.0E+00
sp|Q2T9X2|TCPD_BOVIN T-complex protein 1 subunit delta OS=Bos taurus GN=CCT4 PE=1 SV=3 15 534 0.0E+00
sp|Q6C100|TCPD_YARLI T-complex protein 1 subunit delta OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=CCT4 PE=3 SV=1 1 534 0.0E+00
sp|P53451|TCPD_TAKRU T-complex protein 1 subunit delta OS=Takifugu rubripes GN=cct4 PE=2 SV=1 7 534 0.0E+00
sp|Q9NB32|TCPD_OCHTR T-complex protein 1 subunit delta OS=Ochlerotatus triseriatus PE=2 SV=1 13 530 0.0E+00
sp|Q54CL2|TCPD_DICDI T-complex protein 1 subunit delta OS=Dictyostelium discoideum GN=cct4 PE=3 SV=1 1 534 0.0E+00
sp|Q9LV21|TCPD_ARATH T-complex protein 1 subunit delta OS=Arabidopsis thaliana GN=CCT4 PE=1 SV=1 1 534 0.0E+00
sp|P47208|TCPD_CAEEL T-complex protein 1 subunit delta OS=Caenorhabditis elegans GN=cct-4 PE=2 SV=1 9 532 0.0E+00
sp|Q9YDK6|THSA_AERPE Thermosome subunit alpha OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=thsA PE=3 SV=2 29 530 7.0E-119
sp|O28821|THSB_ARCFU Thermosome subunit beta OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=thsB PE=3 SV=1 12 530 2.0E-118
sp|P46219|THSA_SULSH Thermosome subunit alpha OS=Sulfolobus shibatae GN=thsA PE=1 SV=1 1 530 3.0E-117
sp|Q9V2S9|THSA_SULSO Thermosome subunit alpha OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=thsA PE=3 SV=2 1 530 9.0E-116
sp|O28045|THSA_ARCFU Thermosome subunit alpha OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=thsA PE=3 SV=1 30 530 9.0E-115
sp|Q9V2Q7|THS_PYRAB Thermosome subunit OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=ths PE=3 SV=1 30 530 2.0E-114
sp|Q9V2T5|THSA_SULAC Thermosome subunit alpha OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=thsA PE=3 SV=2 1 530 5.0E-114
sp|O57762|THS_PYRHO Thermosome subunit OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=ths PE=3 SV=1 30 530 1.0E-113
sp|Q9YA66|THSB_AERPE Thermosome subunit beta OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=thsB PE=3 SV=2 29 530 1.0E-113
sp|Q9V2T3|THSB_DESMO Thermosome subunit beta (Fragment) OS=Desulfurococcus mobilis GN=thsB PE=3 SV=1 13 526 1.0E-113
sp|P48424|THSA_THEAC Thermosome subunit alpha OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=thsA PE=1 SV=1 20 530 5.0E-113
sp|P50016|THS_METKA Thermosome subunit OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) GN=ths PE=3 SV=1 30 534 7.0E-113
sp|P28488|THSB_SULSH Thermosome subunit beta OS=Sulfolobus shibatae GN=thsB PE=1 SV=1 29 530 2.0E-112
sp|Q52500|THSB_THEKO Thermosome subunit beta OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=thsB PE=3 SV=1 4 530 5.0E-112
sp|O24730|THSB_THEK1 Thermosome subunit beta OS=Thermococcus sp. (strain JCM 11816 / KS-1) GN=thsB PE=3 SV=2 4 530 2.0E-111
sp|Q53546|THS_DESSY Thermosome subunit OS=Desulfurococcus sp. (strain SY) GN=ths PE=3 SV=1 4 530 4.0E-111
sp|Q9V2T8|THSB_SULSO Thermosome subunit beta OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=thsB PE=3 SV=2 29 530 4.0E-111
sp|P61111|THSA_THEKO Thermosome subunit alpha OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=thsA PE=1 SV=1 4 530 4.0E-110
sp|P61112|THSA_THEK1 Thermosome subunit alpha OS=Thermococcus sp. (strain JCM 11816 / KS-1) GN=thsA PE=1 SV=1 4 530 4.0E-110
sp|Q9V2T4|THSB_SULAC Thermosome subunit beta OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=thsB PE=3 SV=2 30 530 1.0E-108
sp|Q58405|THS_METJA Thermosome subunit OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=ths PE=3 SV=1 30 530 3.0E-108
sp|O24734|THSA_SULTO Thermosome subunit alpha OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=thsA PE=1 SV=1 2 530 9.0E-108
sp|O24731|THSA_THEK8 Thermosome subunit alpha OS=Thermococcus sp. (strain KS-8) GN=thsA PE=3 SV=1 4 530 1.0E-107
sp|O93624|THS_METTL Thermosome subunit OS=Methanothermococcus thermolithotrophicus GN=ths PE=1 SV=1 30 530 2.0E-107
sp|O26320|THSA_METTH Thermosome subunit alpha OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=thsA PE=3 SV=2 30 534 6.0E-107
sp|O24732|THSB_THEK8 Thermosome subunit beta OS=Thermococcus sp. (strain KS-8) GN=thsB PE=3 SV=1 4 530 5.0E-106
sp|O30561|THS1_HALVD Thermosome subunit 1 OS=Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2) GN=cct1 PE=1 SV=1 27 530 1.0E-104
sp|O24735|THSB_SULTO Thermosome subunit beta OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=thsB PE=1 SV=1 30 530 2.0E-104
sp|O26885|THSB_METTH Thermosome subunit beta OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=thsB PE=3 SV=1 30 530 4.0E-104
sp|Q4R6V2|TCPE_MACFA T-complex protein 1 subunit epsilon OS=Macaca fascicularis GN=CCT5 PE=2 SV=1 29 530 9.0E-104
sp|P48643|TCPE_HUMAN T-complex protein 1 subunit epsilon OS=Homo sapiens GN=CCT5 PE=1 SV=1 29 530 9.0E-104
sp|Q5RF02|TCPE_PONAB T-complex protein 1 subunit epsilon OS=Pongo abelii GN=CCT5 PE=2 SV=1 29 530 4.0E-103
sp|Q9HN70|THSA_HALSA Thermosome subunit alpha OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=thsA PE=3 SV=2 27 530 1.0E-102
sp|Q8SSH3|TCPD_ENCCU T-complex protein 1 subunit delta OS=Encephalitozoon cuniculi (strain GB-M1) GN=CCT4 PE=1 SV=1 21 534 2.0E-102
sp|P80316|TCPE_MOUSE T-complex protein 1 subunit epsilon OS=Mus musculus GN=Cct5 PE=1 SV=1 29 530 3.0E-102
sp|P47209|TCPE_CAEEL T-complex protein 1 subunit epsilon OS=Caenorhabditis elegans GN=cct-5 PE=2 SV=1 29 530 3.0E-101
sp|Q68FQ0|TCPE_RAT T-complex protein 1 subunit epsilon OS=Rattus norvegicus GN=Cct5 PE=1 SV=1 29 530 2.0E-100
sp|P48425|THSB_THEAC Thermosome subunit beta OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=thsB PE=1 SV=1 30 533 6.0E-100
sp|Q9UTM4|TCPE_SCHPO T-complex protein 1 subunit epsilon OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cct5 PE=3 SV=1 18 530 1.0E-99
sp|Q9V2T7|THSG_SULSO Thermosome subunit gamma OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=thsC PE=3 SV=1 29 530 2.0E-98
sp|P54411|TCPE2_AVESA T-complex protein 1 subunit epsilon OS=Avena sativa PE=2 SV=1 17 530 2.0E-97
sp|O04450|TCPE_ARATH T-complex protein 1 subunit epsilon OS=Arabidopsis thaliana GN=CCT5 PE=1 SV=1 27 530 1.0E-95
sp|Q54TD3|TCPE_DICDI T-complex protein 1 subunit epsilon OS=Dictyostelium discoideum GN=cct5 PE=3 SV=1 18 530 4.0E-93
sp|P40413|TCPE_YEAST T-complex protein 1 subunit epsilon OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CCT5 PE=1 SV=3 1 533 4.0E-93
sp|Q9HH21|THSG_SULSH Thermosome subunit gamma OS=Sulfolobus shibatae GN=thsC PE=3 SV=1 29 530 2.0E-92
sp|P40412|TCPE1_AVESA T-complex protein 1 subunit epsilon OS=Avena sativa PE=2 SV=1 41 530 2.0E-92
sp|Q54ER7|TCPH_DICDI T-complex protein 1 subunit eta OS=Dictyostelium discoideum GN=cct7 PE=3 SV=1 29 529 1.0E-86
sp|O74341|TCPG_SCHPO T-complex protein 1 subunit gamma OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cct3 PE=1 SV=1 29 530 2.0E-86
sp|P47207|TCPB_CAEEL T-complex protein 1 subunit beta OS=Caenorhabditis elegans GN=cct-2 PE=1 SV=2 20 530 2.0E-85
sp|O30560|THS2_HALVD Thermosome subunit 2 OS=Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2) GN=cct2 PE=1 SV=1 22 530 4.0E-84
sp|P50143|TCPG_XENLA T-complex protein 1 subunit gamma OS=Xenopus laevis GN=cct3 PE=2 SV=2 12 530 1.0E-82
sp|Q5NVF9|TCPG_PONAB T-complex protein 1 subunit gamma OS=Pongo abelii GN=CCT3 PE=2 SV=1 12 530 4.0E-82
sp|Q6P502|TCPG_RAT T-complex protein 1 subunit gamma OS=Rattus norvegicus GN=Cct3 PE=1 SV=1 12 530 9.0E-82
sp|O15891|TCPA_TETPY T-complex protein 1 subunit alpha OS=Tetrahymena pyriformis PE=3 SV=1 19 530 1.0E-81
sp|P80318|TCPG_MOUSE T-complex protein 1 subunit gamma OS=Mus musculus GN=Cct3 PE=1 SV=1 12 530 2.0E-81
sp|Q4R963|TCPG_MACFA T-complex protein 1 subunit gamma OS=Macaca fascicularis GN=CCT3 PE=2 SV=1 12 530 2.0E-81
sp|P49368|TCPG_HUMAN T-complex protein 1 subunit gamma OS=Homo sapiens GN=CCT3 PE=1 SV=4 12 530 5.0E-81
sp|Q3T0K2|TCPG_BOVIN T-complex protein 1 subunit gamma OS=Bos taurus GN=CCT3 PE=1 SV=1 12 530 2.0E-80
sp|Q5ZJK8|TCPH_CHICK T-complex protein 1 subunit eta OS=Gallus gallus GN=CCT7 PE=1 SV=1 29 529 3.0E-80
sp|P28769|TCPA_ARATH T-complex protein 1 subunit alpha OS=Arabidopsis thaliana GN=CCT1 PE=1 SV=1 11 530 6.0E-80
sp|Q9HHA2|THS3_HALVD Thermosome subunit 3 OS=Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2) GN=cct3 PE=1 SV=2 27 530 3.0E-79
sp|P41988|TCPA_CAEEL T-complex protein 1 subunit alpha OS=Caenorhabditis elegans GN=cct-1 PE=3 SV=2 6 530 5.0E-79
sp|Q99832|TCPH_HUMAN T-complex protein 1 subunit eta OS=Homo sapiens GN=CCT7 PE=1 SV=2 29 529 6.0E-79
sp|P80313|TCPH_MOUSE T-complex protein 1 subunit eta OS=Mus musculus GN=Cct7 PE=1 SV=1 29 529 8.0E-79
sp|Q5R5C8|TCPH_PONAB T-complex protein 1 subunit eta OS=Pongo abelii GN=CCT7 PE=2 SV=1 29 529 1.0E-78
sp|Q2NKZ1|TCPH_BOVIN T-complex protein 1 subunit eta OS=Bos taurus GN=CCT7 PE=1 SV=1 29 529 3.0E-78
sp|Q54ES9|TCPB_DICDI T-complex protein 1 subunit beta OS=Dictyostelium discoideum GN=cct2 PE=1 SV=1 12 530 8.0E-78
sp|Q940P8|TCPB_ARATH T-complex protein 1 subunit beta OS=Arabidopsis thaliana GN=CCT2 PE=1 SV=1 17 530 4.0E-77
sp|Q32L40|TCPA_BOVIN T-complex protein 1 subunit alpha OS=Bos taurus GN=TCP1 PE=1 SV=1 15 530 2.0E-76
sp|P18279|TCPA_CRIGR T-complex protein 1 subunit alpha OS=Cricetulus griseus GN=TCP1 PE=2 SV=1 15 530 3.0E-76
sp|O00782|TCPG_OXYGR T-complex protein 1 subunit gamma OS=Oxytricha granulifera PE=3 SV=1 12 530 1.0E-75
sp|P17987|TCPA_HUMAN T-complex protein 1 subunit alpha OS=Homo sapiens GN=TCP1 PE=1 SV=1 15 530 2.0E-75
sp|Q9XT06|TCPA_MONDO T-complex protein 1 subunit alpha OS=Monodelphis domestica GN=TCP1 PE=2 SV=1 15 530 3.0E-75
sp|Q4R5G2|TCPA_MACFA T-complex protein 1 subunit alpha OS=Macaca fascicularis GN=TCP1 PE=2 SV=1 15 530 4.0E-75
sp|P28480|TCPA_RAT T-complex protein 1 subunit alpha OS=Rattus norvegicus GN=Tcp1 PE=1 SV=1 15 530 7.0E-75
sp|P39077|TCPG_YEAST T-complex protein 1 subunit gamma OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CCT3 PE=1 SV=2 1 530 9.0E-75
sp|P54409|TCPH_TETPY T-complex protein 1 subunit eta OS=Tetrahymena pyriformis PE=3 SV=1 29 529 1.0E-74
sp|O94501|TCPA_SCHPO T-complex protein 1 subunit alpha OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cct1 PE=3 SV=1 26 528 1.0E-74
sp|P11983|TCPA_MOUSE T-complex protein 1 subunit alpha OS=Mus musculus GN=Tcp1 PE=1 SV=3 15 530 1.0E-74
sp|Q84WV1|TCPG_ARATH T-complex protein 1 subunit gamma OS=Arabidopsis thaliana GN=CCT3 PE=1 SV=1 20 530 2.0E-74
sp|Q9SF16|TCPH_ARATH T-complex protein 1 subunit eta OS=Arabidopsis thaliana GN=CCT7 PE=1 SV=1 29 529 1.0E-73
sp|P39076|TCPB_YEAST T-complex protein 1 subunit beta OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CCT2 PE=1 SV=1 20 534 1.0E-73
sp|Q9HNI0|THSB_HALSA Thermosome subunit beta OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=thsB PE=3 SV=2 43 530 4.0E-73
sp|Q9LKI7|TCPG_THAWE T-complex protein 1 subunit gamma OS=Thalassiosira weissflogii PE=2 SV=1 30 530 4.0E-73
sp|Q94757|TCPA_SCHMA T-complex protein 1 subunit alpha OS=Schistosoma mansoni GN=TCP-1A PE=2 SV=1 25 530 1.0E-72
sp|Q55BM4|TCPA_DICDI T-complex protein 1 subunit alpha OS=Dictyostelium discoideum GN=tcp1 PE=2 SV=1 26 529 2.0E-72
sp|Q9W790|TCPA_PALPA T-complex protein 1 subunit alpha OS=Paleosuchus palpebrosus GN=TCP1 PE=2 SV=1 26 530 2.0E-72
sp|P87153|TCPH_SCHPO Probable T-complex protein 1 subunit eta OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cct7 PE=1 SV=1 29 529 5.0E-72
sp|P54408|TCPG_TETPY T-complex protein 1 subunit gamma OS=Tetrahymena pyriformis PE=3 SV=1 29 530 2.0E-71
sp|Q10147|TCPB_SCHPO Probable T-complex protein 1 subunit beta OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cct2 PE=3 SV=1 20 530 2.0E-71
sp|P80314|TCPB_MOUSE T-complex protein 1 subunit beta OS=Mus musculus GN=Cct2 PE=1 SV=4 19 530 3.0E-71
sp|P12613|TCPA_DROME T-complex protein 1 subunit alpha OS=Drosophila melanogaster GN=T-cp1 PE=2 SV=2 25 530 3.0E-71
sp|Q5XIM9|TCPB_RAT T-complex protein 1 subunit beta OS=Rattus norvegicus GN=Cct2 PE=1 SV=3 19 530 8.0E-71
sp|P48605|TCPG_DROME T-complex protein 1 subunit gamma OS=Drosophila melanogaster GN=Cctgamma PE=2 SV=2 12 530 8.0E-71
sp|Q3ZBH0|TCPB_BOVIN T-complex protein 1 subunit beta OS=Bos taurus GN=CCT2 PE=1 SV=3 19 530 2.0E-70
sp|Q4R6F8|TCPB_MACFA T-complex protein 1 subunit beta OS=Macaca fascicularis GN=CCT2 PE=2 SV=3 19 530 3.0E-70
sp|P78371|TCPB_HUMAN T-complex protein 1 subunit beta OS=Homo sapiens GN=CCT2 PE=1 SV=4 19 530 3.0E-70
sp|Q8SRP9|TCPE_ENCCU T-complex protein 1 subunit epsilon OS=Encephalitozoon cuniculi (strain GB-M1) GN=CCT5 PE=1 SV=1 29 530 7.0E-70
sp|P42943|TCPH_YEAST T-complex protein 1 subunit eta OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CCT7 PE=1 SV=1 29 529 5.0E-69
sp|Q54TH8|TCPG_DICDI T-complex protein 1 subunit gamma OS=Dictyostelium discoideum GN=cct3 PE=1 SV=1 31 531 6.0E-68
sp|O77323|TCPH_PLAF7 T-complex protein 1 subunit eta OS=Plasmodium falciparum (isolate 3D7) GN=MAL3P3.6 PE=3 SV=1 30 529 3.0E-67
sp|Q8SSC9|TCPA_ENCCU T-complex protein 1 subunit alpha OS=Encephalitozoon cuniculi (strain GB-M1) GN=TCP1 PE=1 SV=1 30 530 5.0E-65
sp|P12612|TCPA_YEAST T-complex protein 1 subunit alpha OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TCP1 PE=1 SV=2 26 528 7.0E-65
sp|Q552J0|TCPQ_DICDI T-complex protein 1 subunit theta OS=Dictyostelium discoideum GN=cct8 PE=3 SV=1 30 534 8.0E-65
sp|P78921|TCPQ_SCHPO Probable T-complex protein 1 subunit theta OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cct8 PE=2 SV=3 17 533 4.0E-63
sp|O77622|TCPZ_RABIT T-complex protein 1 subunit zeta OS=Oryctolagus cuniculus GN=CCT6 PE=1 SV=3 22 492 1.0E-61
sp|Q5RCD2|TCPZ_PONAB T-complex protein 1 subunit zeta OS=Pongo abelii GN=CCT6 PE=2 SV=3 22 492 7.0E-60
sp|Q6EE31|TCPQ_CHICK T-complex protein 1 subunit theta OS=Gallus gallus GN=CCT8 PE=1 SV=3 30 534 4.0E-59
sp|Q3MHL7|TCPZ_BOVIN T-complex protein 1 subunit zeta OS=Bos taurus GN=CCT6A PE=1 SV=3 22 492 7.0E-59
sp|P40227|TCPZ_HUMAN T-complex protein 1 subunit zeta OS=Homo sapiens GN=CCT6A PE=1 SV=3 22 492 1.0E-58
sp|Q5ZJ54|TCPZ_CHICK T-complex protein 1 subunit zeta OS=Gallus gallus GN=CCT6 PE=1 SV=3 22 492 1.0E-58
sp|P80317|TCPZ_MOUSE T-complex protein 1 subunit zeta OS=Mus musculus GN=Cct6a PE=1 SV=3 22 492 2.0E-58
sp|Q8SQP2|TCPB_ENCCU T-complex protein 1 subunit beta OS=Encephalitozoon cuniculi (strain GB-M1) GN=CCT2 PE=1 SV=1 37 530 5.0E-58
sp|A8X6I9|TCPQ_CAEBR T-complex protein 1 subunit theta OS=Caenorhabditis briggsae GN=cct-8 PE=3 SV=1 30 534 2.0E-57
sp|Q94K05|TCPQ_ARATH T-complex protein 1 subunit theta OS=Arabidopsis thaliana GN=CCT8 PE=1 SV=1 30 534 5.0E-57
sp|Q8SR76|TCPG_ENCCU T-complex protein 1 subunit gamma OS=Encephalitozoon cuniculi (strain GB-M1) GN=CCT3 PE=1 SV=1 21 530 9.0E-57
sp|Q92526|TCPW_HUMAN T-complex protein 1 subunit zeta-2 OS=Homo sapiens GN=CCT6B PE=1 SV=5 30 492 1.0E-56
sp|Q8SR53|TCPH_ENCCU T-complex protein 1 subunit eta OS=Encephalitozoon cuniculi (strain GB-M1) GN=CCT7 PE=1 SV=1 29 528 4.0E-56
sp|Q3T084|TCPW_BOVIN T-complex protein 1 subunit zeta-2 OS=Bos taurus GN=CCT6B PE=2 SV=3 22 492 4.0E-55
sp|O94515|TCPZ_SCHPO T-complex protein 1 subunit zeta OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cct6 PE=3 SV=1 30 492 5.0E-54
sp|Q61390|TCPW_MOUSE T-complex protein 1 subunit zeta-2 OS=Mus musculus GN=Cct6b PE=1 SV=4 1 492 1.0E-53
sp|P47079|TCPQ_YEAST T-complex protein 1 subunit theta OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CCT8 PE=1 SV=1 30 534 1.0E-53
sp|P47828|TCPQ_CANAX T-complex protein 1 subunit theta OS=Candida albicans GN=CCT8 PE=3 SV=2 30 534 4.0E-53
sp|Q9N358|TCPQ_CAEEL T-complex protein 1 subunit theta OS=Caenorhabditis elegans GN=cct-8 PE=1 SV=3 30 534 2.0E-52
sp|Q3ZCI9|TCPQ_BOVIN T-complex protein 1 subunit theta OS=Bos taurus GN=CCT8 PE=1 SV=3 30 534 2.0E-52
sp|P42932|TCPQ_MOUSE T-complex protein 1 subunit theta OS=Mus musculus GN=Cct8 PE=1 SV=3 30 534 1.0E-51
sp|P39079|TCPZ_YEAST T-complex protein 1 subunit zeta OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CCT6 PE=1 SV=1 30 498 4.0E-50
sp|Q8L7N0|TCPZB_ARATH T-complex protein 1 subunit zeta 2 OS=Arabidopsis thaliana GN=CCT6B PE=1 SV=1 31 492 9.0E-50
sp|Q4R5J0|TCPQ_MACFA T-complex protein 1 subunit theta OS=Macaca fascicularis GN=CCT8 PE=2 SV=1 30 534 8.0E-49
sp|Q5RAP1|TCPQ_PONAB T-complex protein 1 subunit theta OS=Pongo abelii GN=CCT8 PE=2 SV=3 30 534 9.0E-49
sp|P50990|TCPQ_HUMAN T-complex protein 1 subunit theta OS=Homo sapiens GN=CCT8 PE=1 SV=4 30 534 9.0E-49
sp|Q9M888|TCPZA_ARATH T-complex protein 1 subunit zeta 1 OS=Arabidopsis thaliana GN=CCT6A PE=1 SV=1 31 481 9.0E-49
sp|P46550|TCPZ_CAEEL T-complex protein 1 subunit zeta OS=Caenorhabditis elegans GN=cct-6 PE=1 SV=1 30 493 2.0E-48
sp|Q76NU3|TCPZ_DICDI T-complex protein 1 subunit zeta OS=Dictyostelium discoideum GN=cct6 PE=1 SV=1 30 492 2.0E-48
sp|P54410|TCPH_TETTH T-complex protein 1 subunit eta (Fragment) OS=Tetrahymena thermophila PE=3 SV=1 65 421 3.0E-43
sp|Q96SF2|TCPQM_HUMAN T-complex protein 1 subunit theta-like 2 OS=Homo sapiens GN=CCT8L2 PE=2 SV=2 29 534 4.0E-35
sp|A6NM43|TCPQL_HUMAN Putative T-complex protein 1 subunit theta-like 1 OS=Homo sapiens GN=CCT8L1P PE=5 SV=1 29 534 8.0E-35
sp|Q29236|TCPZ_PIG T-complex protein 1 subunit zeta (Fragment) OS=Sus scrofa GN=CCT6 PE=2 SV=1 25 126 2.0E-22
sp|P50157|TCPA_AMBME T-complex protein 1 subunit alpha (Fragment) OS=Ambystoma mexicanum PE=2 SV=1 390 530 1.0E-17
sp|Q29068|TCPG_PIG T-complex protein 1 subunit gamma (Fragment) OS=Sus scrofa GN=CCT3 PE=2 SV=1 33 113 5.0E-17
sp|Q4JTF2|CH602_CORJK 60 kDa chaperonin 2 OS=Corynebacterium jeikeium (strain K411) GN=groL2 PE=3 SV=1 36 525 1.0E-16
sp|B9DMM2|CH60_STACT 60 kDa chaperonin OS=Staphylococcus carnosus (strain TM300) GN=groL PE=3 SV=1 27 525 1.0E-13
sp|P0C0N6|CH60_STAEP 60 kDa chaperonin OS=Staphylococcus epidermidis GN=groL PE=3 SV=2 37 525 2.0E-13
sp|Q8SS33|TCPQ_ENCCU T-complex protein 1 subunit theta OS=Encephalitozoon cuniculi (strain GB-M1) GN=CCT8 PE=1 SV=1 35 470 1.0E-12
sp|Q8R5X7|CH60_FUSNN 60 kDa chaperonin OS=Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / CIP 101130 / JCM 8532 / LMG 13131) GN=groL PE=3 SV=1 32 155 3.0E-12
sp|B7GFR6|CH60_ANOFW 60 kDa chaperonin OS=Anoxybacillus flavithermus (strain DSM 21510 / WK1) GN=groL PE=3 SV=1 37 171 4.0E-12
sp|Q8GJ00|CH60_FUSNP 60 kDa chaperonin OS=Fusobacterium nucleatum subsp. polymorphum GN=groL PE=3 SV=1 32 155 1.0E-11
sp|Q07201|CH60_GEOSE 60 kDa chaperonin OS=Geobacillus stearothermophilus GN=groL PE=2 SV=1 37 171 1.0E-11
sp|Q8VV84|CH60_GEOTM 60 kDa chaperonin OS=Geobacillus thermoglucosidasius GN=groL PE=3 SV=1 37 171 1.0E-11
sp|C5D4F4|CH60_GEOSW 60 kDa chaperonin OS=Geobacillus sp. (strain WCH70) GN=groL PE=3 SV=1 37 171 2.0E-11
sp|Q93GT6|CH60_TETHA 60 kDa chaperonin OS=Tetragenococcus halophilus GN=groL PE=3 SV=2 27 172 2.0E-11
sp|Q9JI70|MKKS_MOUSE McKusick-Kaufman/Bardet-Biedl syndromes putative chaperonin OS=Mus musculus GN=Mkks PE=2 SV=2 41 478 2.0E-11
sp|B1HT15|CH60_LYSSC 60 kDa chaperonin OS=Lysinibacillus sphaericus (strain C3-41) GN=groL PE=3 SV=1 37 171 2.0E-11
sp|Q5L3E6|CH60_GEOKA 60 kDa chaperonin OS=Geobacillus kaustophilus (strain HTA426) GN=groL PE=3 SV=1 37 171 2.0E-11
sp|Q03VC3|CH60_LEUMM 60 kDa chaperonin OS=Leuconostoc mesenteroides subsp. mesenteroides (strain ATCC 8293 / NCDO 523) GN=groL PE=3 SV=1 37 171 2.0E-11
sp|A4IJV3|CH60_GEOTN 60 kDa chaperonin OS=Geobacillus thermodenitrificans (strain NG80-2) GN=groL PE=3 SV=1 37 171 3.0E-11
sp|Q9KLC6|CH602_VIBCH 60 kDa chaperonin 2 OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=groL2 PE=3 SV=1 37 166 3.0E-11
sp|A5F0I2|CH601_VIBC3 60 kDa chaperonin 1 OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=groL1 PE=3 SV=1 37 166 3.0E-11
sp|P26209|CH60_BACP3 60 kDa chaperonin OS=Bacillus sp. (strain PS3) GN=groL PE=3 SV=1 37 171 3.0E-11
sp|Q87JG6|CH602_VIBPA 60 kDa chaperonin 2 OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=groL2 PE=3 SV=1 37 166 3.0E-11
sp|Q65MZ8|CH60_BACLD 60 kDa chaperonin OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=groL PE=3 SV=1 27 163 5.0E-11
sp|Q8CX00|CH60_STRA5 60 kDa chaperonin OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=groL PE=3 SV=1 27 172 7.0E-11
sp|Q3JYQ0|CH60_STRA1 60 kDa chaperonin OS=Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700) GN=groL PE=3 SV=1 27 172 7.0E-11
sp|A6LJ30|CH60_THEM4 60 kDa chaperonin OS=Thermosipho melanesiensis (strain DSM 12029 / CIP 104789 / BI429) GN=groL PE=3 SV=1 36 189 7.0E-11
sp|Q8CX22|CH60_STRA3 60 kDa chaperonin OS=Streptococcus agalactiae serotype III (strain NEM316) GN=groL PE=3 SV=1 27 172 7.0E-11
sp|O50305|CH60_BACHD 60 kDa chaperonin OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=groL PE=2 SV=2 27 163 8.0E-11
sp|Q03SQ9|CH60_LACBA 60 kDa chaperonin OS=Lactobacillus brevis (strain ATCC 367 / JCM 1170) GN=groL PE=3 SV=1 27 167 9.0E-11
sp|Q08854|CH60_STAAU 60 kDa chaperonin OS=Staphylococcus aureus GN=groL PE=1 SV=3 37 525 9.0E-11
sp|B1YEP6|CH60_EXIS2 60 kDa chaperonin OS=Exiguobacterium sibiricum (strain DSM 17290 / JCM 13490 / 255-15) GN=groL PE=3 SV=1 36 171 1.0E-10
sp|A8FAG3|CH60_BACP2 60 kDa chaperonin OS=Bacillus pumilus (strain SAFR-032) GN=groL PE=3 SV=1 36 163 1.0E-10
sp|B2GAI0|CH60_LACF3 60 kDa chaperonin OS=Lactobacillus fermentum (strain NBRC 3956 / LMG 18251) GN=groL PE=3 SV=1 27 171 2.0E-10
sp|Q1CVE5|CH60_HELPH 60 kDa chaperonin OS=Helicobacter pylori (strain HPAG1) GN=groL PE=3 SV=1 35 525 2.0E-10
sp|B6JPA7|CH60_HELP2 60 kDa chaperonin OS=Helicobacter pylori (strain P12) GN=groL PE=3 SV=1 35 525 2.0E-10
sp|Q9ZN50|CH60_HELPJ 60 kDa chaperonin OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=groL PE=3 SV=1 35 525 2.0E-10
sp|P28598|CH60_BACSU 60 kDa chaperonin OS=Bacillus subtilis (strain 168) GN=groL PE=1 SV=3 36 148 2.0E-10
sp|B9DW28|CH60_STRU0 60 kDa chaperonin OS=Streptococcus uberis (strain ATCC BAA-854 / 0140J) GN=groL PE=3 SV=1 27 172 2.0E-10
sp|B5Z6D1|CH60_HELPG 60 kDa chaperonin OS=Helicobacter pylori (strain G27) GN=groL PE=3 SV=1 35 525 3.0E-10
sp|Q93GT8|CH60_COLMA 60 kDa chaperonin OS=Colwellia maris GN=groL PE=3 SV=2 11 151 3.0E-10
sp|Q8CY27|CH601_COREF 60 kDa chaperonin 1 OS=Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395) GN=groL1 PE=3 SV=1 36 525 3.0E-10
sp|B2G5X7|CH60_LACRJ 60 kDa chaperonin OS=Lactobacillus reuteri (strain JCM 1112) GN=groL PE=3 SV=1 27 152 3.0E-10
sp|A5VIE9|CH60_LACRD 60 kDa chaperonin OS=Lactobacillus reuteri (strain DSM 20016) GN=groL PE=3 SV=1 27 152 3.0E-10
sp|P42383|CH60_HELPY 60 kDa chaperonin OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=groL PE=3 SV=2 35 525 3.0E-10
sp|B7IFA6|CH60_THEAB 60 kDa chaperonin OS=Thermosipho africanus (strain TCF52B) GN=groL PE=3 SV=1 36 192 3.0E-10
sp|B2UW12|CH60_HELPS 60 kDa chaperonin OS=Helicobacter pylori (strain Shi470) GN=groL PE=3 SV=1 35 525 4.0E-10
sp|Q9AME7|CH60_STRAG 60 kDa chaperonin OS=Streptococcus agalactiae GN=groL PE=3 SV=1 27 172 4.0E-10
sp|A0LKS4|CH602_SYNFM 60 kDa chaperonin 2 OS=Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB) GN=groL2 PE=3 SV=1 37 147 4.0E-10
sp|Q48R03|CH60_STRPM 60 kDa chaperonin OS=Streptococcus pyogenes serotype M28 (strain MGAS6180) GN=groL PE=3 SV=1 27 172 4.0E-10
sp|Q1J4D1|CH60_STRPF 60 kDa chaperonin OS=Streptococcus pyogenes serotype M4 (strain MGAS10750) GN=groL PE=3 SV=1 27 172 4.0E-10
sp|Q1JJL5|CH60_STRPC 60 kDa chaperonin OS=Streptococcus pyogenes serotype M12 (strain MGAS9429) GN=groL PE=3 SV=1 27 172 4.0E-10
sp|Q1J9G4|CH60_STRPB 60 kDa chaperonin OS=Streptococcus pyogenes serotype M12 (strain MGAS2096) GN=groL PE=3 SV=1 27 172 4.0E-10
sp|A2RGR1|CH60_STRPG 60 kDa chaperonin OS=Streptococcus pyogenes serotype M5 (strain Manfredo) GN=groL PE=3 SV=1 27 172 4.0E-10
sp|Q5X9L8|CH60_STRP6 60 kDa chaperonin OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=groL PE=1 SV=3 27 172 4.0E-10
sp|P69883|CH60_STRP1 60 kDa chaperonin OS=Streptococcus pyogenes serotype M1 GN=groL PE=3 SV=2 27 172 4.0E-10
sp|Q8NZ56|CH60_STRP8 60 kDa chaperonin OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=groL PE=3 SV=3 27 172 4.0E-10
sp|P0DA23|CH60_STRPQ 60 kDa chaperonin OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=groL PE=3 SV=1 27 172 4.0E-10
sp|P0DA22|CH60_STRP3 60 kDa chaperonin OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=groL PE=3 SV=1 27 172 4.0E-10
sp|Q1JEL5|CH60_STRPD 60 kDa chaperonin OS=Streptococcus pyogenes serotype M2 (strain MGAS10270) GN=groL PE=3 SV=1 27 172 4.0E-10
sp|B5XIW7|CH60_STRPZ 60 kDa chaperonin OS=Streptococcus pyogenes serotype M49 (strain NZ131) GN=groL PE=3 SV=1 27 172 4.0E-10
sp|Q7M7I2|CH602_VIBVY 60 kDa chaperonin 2 OS=Vibrio vulnificus (strain YJ016) GN=groL2 PE=3 SV=1 37 166 5.0E-10
sp|Q8CWJ0|CH602_VIBVU 60 kDa chaperonin 2 OS=Vibrio vulnificus (strain CMCP6) GN=groL2 PE=3 SV=1 37 166 5.0E-10
sp|Q8CWW6|CH60_STRMU 60 kDa chaperonin OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=groL PE=3 SV=1 27 172 6.0E-10
sp|Q031S8|CH60_LACLS 60 kDa chaperonin OS=Lactococcus lactis subsp. cremoris (strain SK11) GN=groL PE=3 SV=1 37 172 6.0E-10
sp|Q9AEP7|CH60_LACLM 60 kDa chaperonin OS=Lactococcus lactis subsp. cremoris (strain MG1363) GN=groL PE=3 SV=1 37 172 6.0E-10
sp|P37282|CH60_LACLA 60 kDa chaperonin OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=groL PE=3 SV=2 37 172 6.0E-10
sp|A7NIK8|CH601_ROSCS 60 kDa chaperonin 1 OS=Roseiflexus castenholzii (strain DSM 13941 / HLO8) GN=groL1 PE=3 SV=1 37 163 6.0E-10
sp|A5V0S2|CH602_ROSS1 60 kDa chaperonin 2 OS=Roseiflexus sp. (strain RS-1) GN=groL2 PE=3 SV=1 37 163 6.0E-10
sp|B0K3P6|CH60_THEPX 60 kDa chaperonin OS=Thermoanaerobacter sp. (strain X514) GN=groL PE=3 SV=1 36 148 8.0E-10
sp|B0KBR3|CH60_THEP3 60 kDa chaperonin OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) GN=groL PE=3 SV=1 36 148 8.0E-10
sp|A7Z207|CH60_BACMF 60 kDa chaperonin OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=groL PE=3 SV=1 36 148 8.0E-10
sp|A7GKG0|CH60_BACCN 60 kDa chaperonin OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=groL PE=3 SV=1 27 171 8.0E-10
sp|Q81VE1|CH60_BACAN 60 kDa chaperonin OS=Bacillus anthracis GN=groL PE=3 SV=1 27 171 9.0E-10
sp|C3L507|CH60_BACAC 60 kDa chaperonin OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=groL PE=3 SV=1 27 171 9.0E-10
sp|C3PAV1|CH60_BACAA 60 kDa chaperonin OS=Bacillus anthracis (strain A0248) GN=groL PE=3 SV=1 27 171 9.0E-10
sp|C5BP08|CH60_TERTT 60 kDa chaperonin OS=Teredinibacter turnerae (strain ATCC 39867 / T7901) GN=groL PE=3 SV=1 27 166 9.0E-10
sp|Q03H05|CH60_PEDPA 60 kDa chaperonin OS=Pediococcus pentosaceus (strain ATCC 25745 / 183-1w) GN=groL PE=3 SV=1 37 152 9.0E-10
sp|Q6HPC7|CH60_BACHK 60 kDa chaperonin OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=groL PE=3 SV=1 27 171 1.0E-09
sp|Q63GV7|CH60_BACCZ 60 kDa chaperonin OS=Bacillus cereus (strain ZK / E33L) GN=groL PE=3 SV=1 27 171 1.0E-09
sp|B9J1H2|CH60_BACCQ 60 kDa chaperonin OS=Bacillus cereus (strain Q1) GN=groL PE=3 SV=1 27 171 1.0E-09
sp|B7HS05|CH60_BACC7 60 kDa chaperonin OS=Bacillus cereus (strain AH187) GN=groL PE=3 SV=1 27 171 1.0E-09
sp|C1EUB1|CH60_BACC3 60 kDa chaperonin OS=Bacillus cereus (strain 03BB102) GN=groL PE=3 SV=1 27 171 1.0E-09
sp|Q73ER9|CH60_BACC1 60 kDa chaperonin OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=groL PE=3 SV=2 27 171 1.0E-09
sp|B7JM60|CH60_BACC0 60 kDa chaperonin OS=Bacillus cereus (strain AH820) GN=groL PE=3 SV=1 27 171 1.0E-09
sp|A0R8W4|CH60_BACAH 60 kDa chaperonin OS=Bacillus thuringiensis (strain Al Hakam) GN=groL PE=3 SV=1 27 171 1.0E-09
sp|A0AKH5|CH60_LISW6 60 kDa chaperonin OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=groL PE=3 SV=1 37 148 1.0E-09
sp|Q9AGE6|CH60_LISMO 60 kDa chaperonin OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=groL PE=3 SV=1 37 148 1.0E-09
sp|B8DH59|CH60_LISMH 60 kDa chaperonin OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=groL PE=3 SV=1 37 148 1.0E-09
sp|Q71XU6|CH60_LISMF 60 kDa chaperonin OS=Listeria monocytogenes serotype 4b (strain F2365) GN=groL PE=3 SV=1 37 148 1.0E-09
sp|C1KX21|CH60_LISMC 60 kDa chaperonin OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=groL PE=3 SV=1 37 148 1.0E-09
sp|A0KCS0|CH603_BURCH 60 kDa chaperonin 3 OS=Burkholderia cenocepacia (strain HI2424) GN=groL3 PE=3 SV=1 11 149 1.0E-09
sp|Q1BV70|CH602_BURCA 60 kDa chaperonin 2 OS=Burkholderia cenocepacia (strain AU 1054) GN=groL2 PE=3 SV=1 11 149 1.0E-09
sp|Q929V0|CH60_LISIN 60 kDa chaperonin OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=groL PE=3 SV=1 37 148 1.0E-09
sp|Q5WJN4|CH60_BACSK 60 kDa chaperonin OS=Bacillus clausii (strain KSM-K16) GN=groL PE=3 SV=1 27 171 1.0E-09
sp|Q4MPR6|CH60_BACCE 60 kDa chaperonin OS=Bacillus cereus GN=groL PE=1 SV=3 27 171 1.0E-09
sp|A9NHL6|CH60_ACHLI 60 kDa chaperonin OS=Acholeplasma laidlawii (strain PG-8A) GN=groL PE=3 SV=1 37 148 1.0E-09
sp|Q9F712|CH601_BURPS 60 kDa chaperonin 1 OS=Burkholderia pseudomallei (strain K96243) GN=groL1 PE=3 SV=2 11 198 1.0E-09
sp|A3NCQ8|CH601_BURP6 60 kDa chaperonin 1 OS=Burkholderia pseudomallei (strain 668) GN=groL1 PE=3 SV=1 11 198 1.0E-09
sp|Q3JPF6|CH601_BURP1 60 kDa chaperonin 1 OS=Burkholderia pseudomallei (strain 1710b) GN=groL1 PE=3 SV=1 11 198 1.0E-09
sp|A3NYH0|CH601_BURP0 60 kDa chaperonin 1 OS=Burkholderia pseudomallei (strain 1106a) GN=groL1 PE=3 SV=1 11 198 1.0E-09
sp|A1V1Z9|CH60_BURMS 60 kDa chaperonin OS=Burkholderia mallei (strain SAVP1) GN=groL PE=3 SV=1 11 198 1.0E-09
sp|Q62I82|CH60_BURMA 60 kDa chaperonin OS=Burkholderia mallei (strain ATCC 23344) GN=groL PE=3 SV=1 11 198 1.0E-09
sp|A2S9S5|CH60_BURM9 60 kDa chaperonin OS=Burkholderia mallei (strain NCTC 10229) GN=groL PE=3 SV=1 11 198 1.0E-09
sp|A3MMB4|CH60_BURM7 60 kDa chaperonin OS=Burkholderia mallei (strain NCTC 10247) GN=groL PE=3 SV=1 11 198 1.0E-09
sp|B7IUT0|CH60_BACC2 60 kDa chaperonin OS=Bacillus cereus (strain G9842) GN=groL PE=3 SV=1 27 171 1.0E-09
sp|Q814B0|CH60_BACCR 60 kDa chaperonin OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=groL PE=3 SV=1 27 171 1.0E-09
sp|Q39J12|CH602_BURL3 60 kDa chaperonin 2 OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=groL2 PE=3 SV=1 11 168 1.0E-09
sp|C0M7S3|CH60_STRE4 60 kDa chaperonin OS=Streptococcus equi subsp. equi (strain 4047) GN=groL PE=3 SV=1 27 172 1.0E-09
sp|Q0BHT1|CH601_BURCM 60 kDa chaperonin 1 OS=Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) GN=groL1 PE=3 SV=1 11 168 1.0E-09
sp|B7H4Q7|CH60_BACC4 60 kDa chaperonin OS=Bacillus cereus (strain B4264) GN=groL PE=3 SV=1 27 171 1.0E-09
sp|P49464|CH60_ODOSI 60 kDa chaperonin, chloroplastic OS=Odontella sinensis GN=groL PE=3 SV=1 39 525 1.0E-09
sp|B4U081|CH60_STREM 60 kDa chaperonin OS=Streptococcus equi subsp. zooepidemicus (strain MGCS10565) GN=groL PE=3 SV=1 27 172 1.0E-09
sp|A6UNR2|CH60_METVS 60 kDa chaperonin OS=Methanococcus vannielii (strain SB / ATCC 35089 / DSM 1224) GN=groL PE=3 SV=1 37 163 1.0E-09
sp|Q5QVT4|CH60_IDILO 60 kDa chaperonin OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=groL PE=3 SV=1 37 190 1.0E-09
sp|Q13ZW7|CH602_BURXL 60 kDa chaperonin 2 OS=Burkholderia xenovorans (strain LB400) GN=groL2 PE=3 SV=1 11 148 1.0E-09
sp|A6H125|CH60_FLAPJ 60 kDa chaperonin OS=Flavobacterium psychrophilum (strain JIP02/86 / ATCC 49511) GN=groL PE=3 SV=1 36 525 2.0E-09
sp|Q6MRI1|CH60_BDEBA 60 kDa chaperonin OS=Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIB 9529 / HD100) GN=groL PE=3 SV=1 37 148 2.0E-09
sp|Q60024|CH60_THEBR 60 kDa chaperonin OS=Thermoanaerobacter brockii GN=groL PE=1 SV=2 36 148 2.0E-09
sp|Q49YY5|CH60_STAS1 60 kDa chaperonin OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=groL PE=3 SV=1 27 172 2.0E-09
sp|Q487Q9|CH60_COLP3 60 kDa chaperonin OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=groL PE=3 SV=1 11 151 2.0E-09
sp|Q8KJ18|CH60_STRCV 60 kDa chaperonin OS=Streptococcus constellatus GN=groL PE=3 SV=1 27 172 2.0E-09
sp|Q8KJ20|CH60_STRAP 60 kDa chaperonin OS=Streptococcus anginosus GN=groL PE=3 SV=1 27 172 2.0E-09
sp|B8E1A9|CH60_DICTD 60 kDa chaperonin OS=Dictyoglomus turgidum (strain Z-1310 / DSM 6724) GN=groL PE=3 SV=1 24 149 2.0E-09
sp|B2JFE0|CH60_BURP8 60 kDa chaperonin OS=Burkholderia phymatum (strain DSM 17167 / STM815) GN=groL PE=3 SV=1 11 168 2.0E-09
sp|Q6GF43|CH60_STAAR 60 kDa chaperonin OS=Staphylococcus aureus (strain MRSA252) GN=groL PE=3 SV=1 37 525 2.0E-09
sp|A5CWP6|CH60_VESOH 60 kDa chaperonin OS=Vesicomyosocius okutanii subsp. Calyptogena okutanii (strain HA) GN=groL PE=3 SV=1 37 168 2.0E-09
sp|A9VQG8|CH60_BACWK 60 kDa chaperonin OS=Bacillus weihenstephanensis (strain KBAB4) GN=groL PE=3 SV=1 27 171 2.0E-09
sp|P48210|CH60_BORPE 60 kDa chaperonin OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=groL PE=3 SV=1 11 149 3.0E-09
sp|Q0I885|CH601_SYNS3 60 kDa chaperonin 1 OS=Synechococcus sp. (strain CC9311) GN=groL1 PE=3 SV=1 36 149 3.0E-09
sp|C0MES3|CH60_STRS7 60 kDa chaperonin OS=Streptococcus equi subsp. zooepidemicus (strain H70) GN=groL PE=3 SV=1 27 172 3.0E-09
sp|P0C0N7|CH60_STAES 60 kDa chaperonin OS=Staphylococcus epidermidis (strain ATCC 12228) GN=groL PE=3 SV=2 37 148 3.0E-09
sp|Q5HMZ1|CH60_STAEQ 60 kDa chaperonin OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=groL PE=3 SV=1 37 148 3.0E-09
sp|Q7W134|CH60_BORPA 60 kDa chaperonin OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=groL PE=3 SV=1 11 149 3.0E-09
sp|Q7WNS4|CH60_BORBR 60 kDa chaperonin OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=groL PE=3 SV=1 11 149 3.0E-09
sp|B0U418|CH60_XYLFM 60 kDa chaperonin OS=Xylella fastidiosa (strain M12) GN=groL PE=3 SV=1 27 166 3.0E-09
sp|Q0VRW6|CH60_ALCBS 60 kDa chaperonin OS=Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2) GN=groL PE=3 SV=1 17 166 3.0E-09
sp|P58723|CH60_BURTH 60 kDa chaperonin OS=Burkholderia thailandensis GN=groL PE=3 SV=1 11 151 3.0E-09
sp|Q2SYJ5|CH601_BURTA 60 kDa chaperonin 1 OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=groL1 PE=3 SV=1 11 151 3.0E-09
sp|A0K536|CH601_BURCH 60 kDa chaperonin 1 OS=Burkholderia cenocepacia (strain HI2424) GN=groL1 PE=3 SV=1 11 151 3.0E-09
sp|Q1BYL5|CH601_BURCA 60 kDa chaperonin 1 OS=Burkholderia cenocepacia (strain AU 1054) GN=groL1 PE=3 SV=1 11 151 3.0E-09
sp|Q9ZFD8|CH60_BURVI 60 kDa chaperonin OS=Burkholderia vietnamiensis GN=groL PE=3 SV=1 11 151 3.0E-09
sp|A4JC03|CH601_BURVG 60 kDa chaperonin 1 OS=Burkholderia vietnamiensis (strain G4 / LMG 22486) GN=groL1 PE=3 SV=1 11 151 3.0E-09
sp|Q9KJ23|CH60_LACJO 60 kDa chaperonin OS=Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533) GN=groL PE=3 SV=2 27 176 3.0E-09
sp|Q9ZFE0|CH60_BURCE 60 kDa chaperonin OS=Burkholderia cepacia GN=groL PE=3 SV=1 11 151 3.0E-09
sp|Q4L7R4|CH60_STAHJ 60 kDa chaperonin OS=Staphylococcus haemolyticus (strain JCSC1435) GN=groL PE=3 SV=1 37 148 4.0E-09
sp|Q045Q8|CH60_LACGA 60 kDa chaperonin OS=Lactobacillus gasseri (strain ATCC 33323 / DSM 20243 / JCM 1131 / NCIMB 11718 / AM63) GN=groL PE=3 SV=1 27 176 4.0E-09
sp|Q0B1N7|CH603_BURCM 60 kDa chaperonin 3 OS=Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) GN=groL3 PE=3 SV=1 11 151 4.0E-09
sp|Q9L7P5|CH601_VIBPA 60 kDa chaperonin 1 OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=groL1 PE=3 SV=2 37 166 4.0E-09
sp|Q8KM30|CH60_OLEAN 60 kDa chaperonin OS=Oleispira antarctica GN=groL PE=3 SV=1 27 163 4.0E-09
sp|A8YTH8|CH60_LACH4 60 kDa chaperonin OS=Lactobacillus helveticus (strain DPC 4571) GN=groL PE=3 SV=1 27 186 4.0E-09
sp|Q2RGL8|CH602_MOOTA 60 kDa chaperonin 2 OS=Moorella thermoacetica (strain ATCC 39073) GN=groL2 PE=3 SV=1 39 196 4.0E-09
sp|B5YDR9|CH60_DICT6 60 kDa chaperonin OS=Dictyoglomus thermophilum (strain ATCC 35947 / DSM 3960 / H-6-12) GN=groL PE=3 SV=1 24 149 4.0E-09
sp|O32847|CH60_LACZE 60 kDa chaperonin OS=Lactobacillus zeae GN=groL PE=3 SV=1 27 166 5.0E-09
sp|B3W9W7|CH60_LACCB 60 kDa chaperonin OS=Lactobacillus casei (strain BL23) GN=groL PE=3 SV=1 27 166 5.0E-09
sp|Q035Y9|CH60_LACC3 60 kDa chaperonin OS=Lactobacillus casei (strain ATCC 334) GN=groL PE=3 SV=1 27 166 5.0E-09
sp|P60545|CH601_MYCPA 60 kDa chaperonin 1 OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=groL1 PE=3 SV=1 37 186 5.0E-09
sp|C4ZD46|CH60_EUBR3 60 kDa chaperonin OS=Eubacterium rectale (strain ATCC 33656 / VPI 0990) GN=groL PE=3 SV=1 37 148 5.0E-09
sp|Q04E64|CH60_OENOB 60 kDa chaperonin OS=Oenococcus oeni (strain ATCC BAA-331 / PSU-1) GN=groL PE=3 SV=1 37 167 5.0E-09
sp|B1I661|CH60_DESAP 60 kDa chaperonin OS=Desulforudis audaxviator (strain MP104C) GN=groL PE=3 SV=1 11 148 5.0E-09
sp|A9B6A4|CH60_HERA2 60 kDa chaperonin OS=Herpetosiphon aurantiacus (strain ATCC 23779 / DSM 785) GN=groL PE=3 SV=1 37 168 6.0E-09
sp|C4L1L2|CH60_EXISA 60 kDa chaperonin OS=Exiguobacterium sp. (strain ATCC BAA-1283 / AT1b) GN=groL PE=3 SV=1 36 148 6.0E-09
sp|O68324|CH60_LACHE 60 kDa chaperonin OS=Lactobacillus helveticus GN=groL PE=3 SV=1 37 186 7.0E-09
sp|Q048Y3|CH60_LACDB 60 kDa chaperonin OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC BAA-365) GN=groL PE=3 SV=1 27 167 7.0E-09
sp|Q1G937|CH60_LACDA 60 kDa chaperonin OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC 11842 / DSM 20081 / JCM 1002 / NBRC 13953 / NCIMB 11778) GN=groL PE=3 SV=1 27 167 7.0E-09
sp|B9L698|CH60_NAUPA 60 kDa chaperonin OS=Nautilia profundicola (strain ATCC BAA-1463 / DSM 18972 / AmH) GN=groL PE=3 SV=1 27 148 8.0E-09
sp|Q88YM5|CH60_LACPL 60 kDa chaperonin OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=groL PE=3 SV=1 27 167 8.0E-09
sp|Q8VT58|CH60_STRGN 60 kDa chaperonin OS=Streptococcus gordonii GN=groL PE=3 SV=1 27 172 8.0E-09
sp|P21241|RUBB_BRANA RuBisCO large subunit-binding protein subunit beta, chloroplastic OS=Brassica napus PE=2 SV=1 37 175 8.0E-09
sp|A8AZE1|CH60_STRGC 60 kDa chaperonin OS=Streptococcus gordonii (strain Challis / ATCC 35105 / CH1 / DL1 / V288) GN=groL PE=3 SV=1 27 172 9.0E-09
sp|Q3J729|CH60_NITOC 60 kDa chaperonin OS=Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848) GN=groL PE=3 SV=1 37 181 9.0E-09
sp|Q0KDR7|CH60_CUPNH 60 kDa chaperonin OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=groL PE=3 SV=1 11 168 9.0E-09
sp|A4JPD1|CH602_BURVG 60 kDa chaperonin 2 OS=Burkholderia vietnamiensis (strain G4 / LMG 22486) GN=groL2 PE=3 SV=1 11 195 9.0E-09
sp|Q9C667|CPNB4_ARATH Chaperonin 60 subunit beta 4, chloroplastic OS=Arabidopsis thaliana GN=CPN60B4 PE=1 SV=1 33 466 9.0E-09
sp|Q46XW6|CH60_CUPPJ 60 kDa chaperonin OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=groL PE=3 SV=1 11 168 9.0E-09
sp|Q60AY0|CH601_METCA 60 kDa chaperonin 1 OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=groL1 PE=3 SV=1 11 181 1.0E-08
sp|Q3ADX3|CH60_CARHZ 60 kDa chaperonin OS=Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901) GN=groL PE=3 SV=1 17 177 1.0E-08
sp|Q493W7|CH60_BLOPB 60 kDa chaperonin OS=Blochmannia pennsylvanicus (strain BPEN) GN=groL PE=3 SV=1 11 181 1.0E-08
sp|A7HNA3|CH60_FERNB 60 kDa chaperonin OS=Fervidobacterium nodosum (strain ATCC 35602 / DSM 5306 / Rt17-B1) GN=groL PE=3 SV=1 36 189 1.0E-08
sp|Q7U348|CH60_BLOFL 60 kDa chaperonin OS=Blochmannia floridanus GN=groL PE=3 SV=1 11 181 1.0E-08
sp|Q8CXL3|CH60_OCEIH 60 kDa chaperonin OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=groL PE=3 SV=1 37 162 1.0E-08
sp|B2T0I0|CH60_BURPP 60 kDa chaperonin OS=Burkholderia phytofirmans (strain DSM 17436 / PsJN) GN=groL PE=3 SV=1 11 168 1.0E-08
sp|A4J8H4|CH60_DESRM 60 kDa chaperonin OS=Desulfotomaculum reducens (strain MI-1) GN=groL PE=3 SV=1 17 148 1.0E-08
sp|A0T0X0|CH60_THAPS 60 kDa chaperonin, chloroplastic OS=Thalassiosira pseudonana GN=groL PE=3 SV=1 39 530 1.0E-08
sp|Q8Y1P8|CH60_RALSO 60 kDa chaperonin OS=Ralstonia solanacearum (strain GMI1000) GN=groL PE=3 SV=1 11 149 1.0E-08
sp|Q9PFP2|CH60_XYLFA 60 kDa chaperonin OS=Xylella fastidiosa (strain 9a5c) GN=groL PE=3 SV=1 17 166 1.0E-08
sp|Q87BC0|CH60_XYLFT 60 kDa chaperonin OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=groL PE=3 SV=1 17 166 1.0E-08
sp|B2I7D4|CH60_XYLF2 60 kDa chaperonin OS=Xylella fastidiosa (strain M23) GN=groL PE=3 SV=1 17 166 1.0E-08
sp|Q7TTT6|CH602_SYNPX 60 kDa chaperonin 2 OS=Synechococcus sp. (strain WH8102) GN=groL2 PE=3 SV=1 36 149 1.0E-08
sp|P08926|RUBA_PEA RuBisCO large subunit-binding protein subunit alpha, chloroplastic OS=Pisum sativum PE=1 SV=2 37 525 1.0E-08
sp|Q2SDG0|CH60_HAHCH 60 kDa chaperonin OS=Hahella chejuensis (strain KCTC 2396) GN=groL PE=3 SV=1 27 166 1.0E-08
sp|A0KGL1|CH60_AERHH 60 kDa chaperonin OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=groL PE=3 SV=1 27 152 2.0E-08
sp|Q144Q6|CH601_BURXL 60 kDa chaperonin 1 OS=Burkholderia xenovorans (strain LB400) GN=groL1 PE=3 SV=1 11 168 2.0E-08
sp|Q8R5T7|CH60_CALS4 60 kDa chaperonin OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=groL PE=3 SV=1 36 171 2.0E-08
sp|B1XRX1|CH60_POLNS 60 kDa chaperonin OS=Polynucleobacter necessarius subsp. necessarius (strain STIR1) GN=groL PE=3 SV=1 11 166 2.0E-08
sp|Q93G07|CH60_LACAC 60 kDa chaperonin OS=Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM) GN=groL PE=3 SV=2 27 186 2.0E-08
sp|Q7UM99|CH601_RHOBA 60 kDa chaperonin 1 OS=Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1) GN=groL1 PE=3 SV=2 37 160 2.0E-08
sp|A9M0Q6|CH60_NEIM0 60 kDa chaperonin OS=Neisseria meningitidis serogroup C (strain 053442) GN=groL PE=3 SV=1 26 147 2.0E-08
sp|Q3A0V2|CH60_PELCD 60 kDa chaperonin OS=Pelobacter carbinolicus (strain DSM 2380 / Gra Bd 1) GN=groL PE=3 SV=1 27 166 2.0E-08
sp|Q5F541|CH60_NEIG1 60 kDa chaperonin OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) GN=groL PE=3 SV=1 26 147 2.0E-08
sp|A8AMQ6|CH60_CITK8 60 kDa chaperonin OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=groL PE=3 SV=1 11 166 2.0E-08
sp|B4RRA1|CH60_NEIG2 60 kDa chaperonin OS=Neisseria gonorrhoeae (strain NCCP11945) GN=groL PE=3 SV=1 26 147 2.0E-08
sp|A5WD52|CH60_PSYWF 60 kDa chaperonin OS=Psychrobacter sp. (strain PRwf-1) GN=groL PE=3 SV=1 37 166 2.0E-08
sp|A1KW52|CH60_NEIMF 60 kDa chaperonin OS=Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18) GN=groL PE=3 SV=1 26 147 2.0E-08
sp|P57006|CH60_NEIMA 60 kDa chaperonin OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=groL PE=3 SV=1 26 147 2.0E-08
sp|O66212|CH60_RAOPL 60 kDa chaperonin (Fragment) OS=Raoultella planticola GN=groL PE=3 SV=1 11 166 2.0E-08
sp|O66194|CH60_PLUGE 60 kDa chaperonin (Fragment) OS=Pluralibacter gergoviae GN=groL PE=3 SV=1 11 166 2.0E-08
sp|B9E899|CH60_MACCJ 60 kDa chaperonin OS=Macrococcus caseolyticus (strain JCSC5402) GN=groL PE=3 SV=1 27 172 2.0E-08
sp|A7MX54|CH60_VIBCB 60 kDa chaperonin OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120) GN=groL PE=3 SV=1 37 166 2.0E-08
sp|B5F2L0|CH60_SALA4 60 kDa chaperonin OS=Salmonella agona (strain SL483) GN=groL PE=3 SV=1 11 166 2.0E-08
sp|P0A1D3|CH60_SALTY 60 kDa chaperonin OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=groL PE=3 SV=2 11 166 2.0E-08
sp|P0A1D4|CH60_SALTI 60 kDa chaperonin OS=Salmonella typhi GN=groL PE=3 SV=2 11 166 2.0E-08
sp|B4TSC6|CH60_SALSV 60 kDa chaperonin OS=Salmonella schwarzengrund (strain CVM19633) GN=groL PE=3 SV=1 11 166 2.0E-08
sp|B5BKF4|CH60_SALPK 60 kDa chaperonin OS=Salmonella paratyphi A (strain AKU_12601) GN=groL PE=3 SV=1 11 166 2.0E-08
sp|C0Q6A2|CH60_SALPC 60 kDa chaperonin OS=Salmonella paratyphi C (strain RKS4594) GN=groL PE=3 SV=1 11 166 2.0E-08
sp|A9N3Z7|CH60_SALPB 60 kDa chaperonin OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=groL PE=3 SV=1 11 166 2.0E-08
sp|Q5PL62|CH60_SALPA 60 kDa chaperonin OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=groL PE=3 SV=1 11 166 2.0E-08
sp|B4TF80|CH60_SALHS 60 kDa chaperonin OS=Salmonella heidelberg (strain SL476) GN=groL PE=3 SV=1 11 166 2.0E-08
sp|B5R991|CH60_SALG2 60 kDa chaperonin OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=groL PE=3 SV=1 11 166 2.0E-08
sp|B5R005|CH60_SALEP 60 kDa chaperonin OS=Salmonella enteritidis PT4 (strain P125109) GN=groL PE=3 SV=1 11 166 2.0E-08
sp|B5FRK2|CH60_SALDC 60 kDa chaperonin OS=Salmonella dublin (strain CT_02021853) GN=groL PE=3 SV=1 11 166 2.0E-08
sp|Q57GP7|CH60_SALCH 60 kDa chaperonin OS=Salmonella choleraesuis (strain SC-B67) GN=groL PE=3 SV=1 11 166 2.0E-08
sp|Q1QDC9|CH60_PSYCK 60 kDa chaperonin OS=Psychrobacter cryohalolentis (strain K5) GN=groL PE=3 SV=1 37 166 2.0E-08
sp|Q1LQS4|CH60_CUPMC 60 kDa chaperonin OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) GN=groL PE=3 SV=1 11 149 2.0E-08
sp|B3E8G0|CH60_GEOLS 60 kDa chaperonin OS=Geobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ) GN=groL PE=3 SV=1 27 148 2.0E-08
sp|Q9WWL4|CH60_METSS 60 kDa chaperonin OS=Methylovorus sp. (strain SS1 / DSM 11726) GN=groL PE=3 SV=1 11 151 2.0E-08
sp|Q4FU94|CH60_PSYA2 60 kDa chaperonin OS=Psychrobacter arcticus (strain DSM 17307 / 273-4) GN=groL PE=3 SV=1 37 166 2.0E-08
sp|O60008|HSP60_PARBA Heat shock protein 60, mitochondrial OS=Paracoccidioides lutzii (strain ATCC MYA-826 / Pb01) GN=HSP60 PE=1 SV=1 13 195 2.0E-08
sp|P08927|RUBB_PEA RuBisCO large subunit-binding protein subunit beta, chloroplastic OS=Pisum sativum PE=1 SV=2 37 175 2.0E-08
sp|Q2T3W7|CH602_BURTA 60 kDa chaperonin 2 OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=groL2 PE=3 SV=1 17 149 2.0E-08
sp|C4Z3R4|CH60_EUBE2 60 kDa chaperonin OS=Eubacterium eligens (strain ATCC 27750 / VPI C15-48) GN=groL PE=3 SV=1 37 152 2.0E-08
sp|A0T0H6|CH60_PHATC 60 kDa chaperonin, chloroplastic OS=Phaeodactylum tricornutum (strain CCAP 1055/1) GN=groL PE=3 SV=1 37 530 3.0E-08
sp|B3R2Y3|CH60_CUPTR 60 kDa chaperonin OS=Cupriavidus taiwanensis (strain R1 / LMG 19424) GN=groL PE=3 SV=1 11 149 3.0E-08
sp|Q9LJE4|CPNB2_ARATH Chaperonin 60 subunit beta 2, chloroplastic OS=Arabidopsis thaliana GN=CPN60B2 PE=1 SV=1 37 175 3.0E-08
sp|P21240|CPNB1_ARATH Chaperonin 60 subunit beta 1, chloroplastic OS=Arabidopsis thaliana GN=CPN60B1 PE=1 SV=3 37 175 3.0E-08
sp|A5GMX4|CH601_SYNPW 60 kDa chaperonin 1 OS=Synechococcus sp. (strain WH7803) GN=groL1 PE=3 SV=1 17 149 3.0E-08
sp|Q7V643|CH601_PROMM 60 kDa chaperonin 1 OS=Prochlorococcus marinus (strain MIT 9313) GN=groL1 PE=3 SV=1 16 151 3.0E-08
sp|Q1WSW0|CH60_LACS1 60 kDa chaperonin OS=Lactobacillus salivarius (strain UCC118) GN=groL PE=3 SV=1 27 148 3.0E-08
sp|A0PME9|CH601_MYCUA 60 kDa chaperonin 1 OS=Mycobacterium ulcerans (strain Agy99) GN=groL1 PE=3 SV=1 37 186 3.0E-08
sp|A4TEN6|CH602_MYCGI 60 kDa chaperonin 2 OS=Mycobacterium gilvum (strain PYR-GCK) GN=groL2 PE=3 SV=1 37 186 3.0E-08
sp|Q2FWN4|CH60_STAA8 60 kDa chaperonin OS=Staphylococcus aureus (strain NCTC 8325) GN=groL PE=3 SV=1 37 148 3.0E-08
sp|A8Z4T2|CH60_STAAT 60 kDa chaperonin OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=groL PE=3 SV=1 37 148 3.0E-08
sp|A6QIM7|CH60_STAAE 60 kDa chaperonin OS=Staphylococcus aureus (strain Newman) GN=groL PE=3 SV=1 37 148 3.0E-08
sp|Q5HEH2|CH60_STAAC 60 kDa chaperonin OS=Staphylococcus aureus (strain COL) GN=groL PE=3 SV=1 37 148 3.0E-08
sp|Q2FF95|CH60_STAA3 60 kDa chaperonin OS=Staphylococcus aureus (strain USA300) GN=groL PE=3 SV=1 37 148 3.0E-08
sp|Q00767|CH601_STRAL 60 kDa chaperonin 1 OS=Streptomyces albus G GN=groL1 PE=1 SV=3 37 525 3.0E-08
sp|B0TCA0|CH60_HELMI 60 kDa chaperonin OS=Heliobacterium modesticaldum (strain ATCC 51547 / Ice1) GN=groL PE=3 SV=1 37 148 3.0E-08
sp|P29842|CH60_NEIGO 60 kDa chaperonin OS=Neisseria gonorrhoeae GN=groL PE=1 SV=3 26 147 3.0E-08
sp|A2C7E2|CH602_PROM3 60 kDa chaperonin 2 OS=Prochlorococcus marinus (strain MIT 9303) GN=groL2 PE=3 SV=1 16 151 3.0E-08
sp|P63767|CH60_STAAW 60 kDa chaperonin OS=Staphylococcus aureus (strain MW2) GN=groL PE=3 SV=1 37 148 3.0E-08
sp|Q6G7S8|CH60_STAAS 60 kDa chaperonin OS=Staphylococcus aureus (strain MSSA476) GN=groL PE=3 SV=1 37 148 3.0E-08
sp|P99083|CH60_STAAN 60 kDa chaperonin OS=Staphylococcus aureus (strain N315) GN=groL PE=1 SV=1 37 148 3.0E-08
sp|P63766|CH60_STAAM 60 kDa chaperonin OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=groL PE=3 SV=1 37 148 3.0E-08
sp|A5IUH6|CH60_STAA9 60 kDa chaperonin OS=Staphylococcus aureus (strain JH9) GN=groL PE=3 SV=1 37 148 3.0E-08
sp|A6U3B5|CH60_STAA2 60 kDa chaperonin OS=Staphylococcus aureus (strain JH1) GN=groL PE=3 SV=1 37 148 3.0E-08
sp|A7X4J1|CH60_STAA1 60 kDa chaperonin OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=groL PE=3 SV=1 37 148 3.0E-08
sp|Q2YUD8|CH60_STAAB 60 kDa chaperonin OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=groL PE=3 SV=1 37 148 3.0E-08
sp|B4EXE2|CH60_PROMH 60 kDa chaperonin OS=Proteus mirabilis (strain HI4320) GN=groL PE=3 SV=1 37 166 3.0E-08
sp|O02649|CH60_DROME 60 kDa heat shock protein, mitochondrial OS=Drosophila melanogaster GN=Hsp60 PE=1 SV=3 26 149 4.0E-08
sp|Q2Y6I6|CH60_NITMU 60 kDa chaperonin OS=Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849) GN=groL PE=3 SV=1 11 149 4.0E-08
sp|Q7WVY0|CH602_ANASL 60 kDa chaperonin 2 OS=Anabaena sp. (strain L31) GN=groL2 PE=1 SV=1 36 148 4.0E-08
sp|A9KSJ1|CH60_CLOPH 60 kDa chaperonin OS=Clostridium phytofermentans (strain ATCC 700394 / DSM 18823 / ISDg) GN=groL PE=3 SV=1 37 152 4.0E-08
sp|Q0T9P8|CH60_ECOL5 60 kDa chaperonin OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=groL PE=3 SV=1 11 166 4.0E-08
sp|Q7MBB4|CH602_GLOVI 60 kDa chaperonin 2 OS=Gloeobacter violaceus (strain PCC 7421) GN=groL2 PE=3 SV=1 36 153 4.0E-08
sp|Q1BCW7|CH602_MYCSS 60 kDa chaperonin 2 OS=Mycobacterium sp. (strain MCS) GN=groL2 PE=3 SV=1 37 186 4.0E-08
sp|A1UC26|CH602_MYCSK 60 kDa chaperonin 2 OS=Mycobacterium sp. (strain KMS) GN=groL2 PE=3 SV=1 37 186 4.0E-08
sp|A3PVQ7|CH602_MYCSJ 60 kDa chaperonin 2 OS=Mycobacterium sp. (strain JLS) GN=groL2 PE=3 SV=1 37 186 4.0E-08
sp|B2FIU9|CH60_STRMK 60 kDa chaperonin OS=Stenotrophomonas maltophilia (strain K279a) GN=groL PE=3 SV=1 11 166 4.0E-08
sp|A9GB11|CH601_SORC5 60 kDa chaperonin 1 OS=Sorangium cellulosum (strain So ce56) GN=groL1 PE=3 SV=1 27 163 4.0E-08
sp|Q7NT31|CH601_CHRVO 60 kDa chaperonin 1 OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=groL1 PE=3 SV=1 11 528 4.0E-08
sp|Q1C0Y0|CH60_YERPA 60 kDa chaperonin OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=groL PE=3 SV=1 11 166 4.0E-08
sp|B1JMR1|CH60_YERPY 60 kDa chaperonin OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=groL PE=3 SV=1 11 166 4.0E-08
sp|Q66FD5|CH60_YERPS 60 kDa chaperonin OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=groL PE=3 SV=1 11 166 4.0E-08
sp|A4TRR0|CH60_YERPP 60 kDa chaperonin OS=Yersinia pestis (strain Pestoides F) GN=groL PE=3 SV=1 11 166 4.0E-08
sp|Q1CED4|CH60_YERPN 60 kDa chaperonin OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=groL PE=3 SV=1 11 166 4.0E-08
sp|A9QYQ1|CH60_YERPG 60 kDa chaperonin OS=Yersinia pestis bv. Antiqua (strain Angola) GN=groL PE=3 SV=1 11 166 4.0E-08
sp|Q8ZIY3|CH60_YERPE 60 kDa chaperonin OS=Yersinia pestis GN=groL PE=3 SV=1 11 166 4.0E-08
sp|B2K1Y4|CH60_YERPB 60 kDa chaperonin OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=groL PE=3 SV=1 11 166 4.0E-08
sp|A7FN01|CH60_YERP3 60 kDa chaperonin OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=groL PE=3 SV=1 11 166 4.0E-08
sp|P0C193|CH60_SODGL 60 kDa chaperonin OS=Sodalis glossinidius GN=groL PE=3 SV=1 11 166 5.0E-08
sp|Q2NW94|CH60_SODGM 60 kDa chaperonin OS=Sodalis glossinidius (strain morsitans) GN=groL PE=1 SV=1 11 166 5.0E-08
sp|O66192|CH60_KLUIN 60 kDa chaperonin (Fragment) OS=Kluyvera intermedia GN=groL PE=3 SV=1 11 166 5.0E-08
sp|A9MFR9|CH60_SALAR 60 kDa chaperonin OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=groL PE=3 SV=1 11 166 5.0E-08
sp|P48219|CH60_YEREN 60 kDa chaperonin OS=Yersinia enterocolitica GN=groL PE=3 SV=1 11 166 5.0E-08
sp|O66204|CH60_SERFI 60 kDa chaperonin (Fragment) OS=Serratia ficaria GN=groL PE=3 SV=1 11 166 5.0E-08
sp|Q63N20|CH602_BURPS 60 kDa chaperonin 2 OS=Burkholderia pseudomallei (strain K96243) GN=groL2 PE=3 SV=1 17 149 5.0E-08
sp|Q3JGX2|CH602_BURP1 60 kDa chaperonin 2 OS=Burkholderia pseudomallei (strain 1710b) GN=groL2 PE=3 SV=1 17 149 5.0E-08
sp|A6VWY0|CH60_MARMS 60 kDa chaperonin OS=Marinomonas sp. (strain MWYL1) GN=groL PE=3 SV=1 11 166 5.0E-08
sp|P42385|CH60_NEIMB 60 kDa chaperonin OS=Neisseria meningitidis serogroup B (strain MC58) GN=groL PE=1 SV=2 26 147 5.0E-08
sp|A3NHB6|CH602_BURP6 60 kDa chaperonin 2 OS=Burkholderia pseudomallei (strain 668) GN=groL2 PE=3 SV=1 17 149 5.0E-08
sp|A1JIP3|CH60_YERE8 60 kDa chaperonin OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=groL PE=3 SV=1 11 166 5.0E-08
sp|P37578|CH601_MYCLE 60 kDa chaperonin 1 OS=Mycobacterium leprae (strain TN) GN=groL1 PE=3 SV=1 27 163 5.0E-08
sp|A3P2X2|CH602_BURP0 60 kDa chaperonin 2 OS=Burkholderia pseudomallei (strain 1106a) GN=groL2 PE=3 SV=1 17 149 6.0E-08
sp|O66206|CH60_SERMA 60 kDa chaperonin (Fragment) OS=Serratia marcescens GN=groL PE=3 SV=1 11 166 6.0E-08
sp|Q7MBB2|CH60_MYCGA 60 kDa chaperonin OS=Mycoplasma gallisepticum (strain R(low / passage 15 / clone 2)) GN=groL PE=3 SV=2 37 199 6.0E-08
sp|Q1LSP5|CH60_BAUCH 60 kDa chaperonin OS=Baumannia cicadellinicola subsp. Homalodisca coagulata GN=groL PE=3 SV=1 37 166 6.0E-08
sp|A5EX17|CH60_DICNV 60 kDa chaperonin OS=Dichelobacter nodosus (strain VCS1703A) GN=groL PE=3 SV=1 11 166 6.0E-08
sp|C3K1A0|CH60_PSEFS 60 kDa chaperonin OS=Pseudomonas fluorescens (strain SBW25) GN=groL PE=3 SV=1 27 166 7.0E-08
sp|B8GL19|CH60_THISH 60 kDa chaperonin OS=Thioalkalivibrio sulfidiphilus (strain HL-EbGR7) GN=groL PE=3 SV=1 11 166 7.0E-08
sp|A8G8S7|CH60_SERP5 60 kDa chaperonin OS=Serratia proteamaculans (strain 568) GN=groL PE=3 SV=1 11 166 7.0E-08
sp|B2A5V3|CH60_NATTJ 60 kDa chaperonin OS=Natranaerobius thermophilus (strain ATCC BAA-1301 / DSM 18059 / JW/NM-WN-LF) GN=groL PE=3 SV=1 37 196 7.0E-08
sp|Q01RQ2|CH60_SOLUE 60 kDa chaperonin OS=Solibacter usitatus (strain Ellin6076) GN=groL PE=3 SV=1 25 149 7.0E-08
sp|B2VL84|CH60_ERWT9 60 kDa chaperonin OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=groL PE=3 SV=1 11 166 7.0E-08
sp|Q38YR7|CH60_LACSS 60 kDa chaperonin OS=Lactobacillus sakei subsp. sakei (strain 23K) GN=groL PE=3 SV=1 27 163 7.0E-08
sp|P48212|CH60_CLOTH 60 kDa chaperonin OS=Clostridium thermocellum (strain ATCC 27405 / DSM 1237 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) GN=groL PE=1 SV=3 37 148 8.0E-08
sp|Q3K7L6|CH60_PSEPF 60 kDa chaperonin OS=Pseudomonas fluorescens (strain Pf0-1) GN=groL PE=3 SV=1 27 166 8.0E-08
sp|C4XGI2|CH60_DESMR 60 kDa chaperonin OS=Desulfovibrio magneticus (strain ATCC 700980 / DSM 13731 / RS-1) GN=groL PE=3 SV=1 37 196 8.0E-08
sp|B5E9Y2|CH60_GEOBB 60 kDa chaperonin OS=Geobacter bemidjiensis (strain Bem / ATCC BAA-1014 / DSM 16622) GN=groL PE=3 SV=1 37 148 8.0E-08
sp|Q93EU6|CH60_ENTFA 60 kDa chaperonin OS=Enterococcus faecalis (strain ATCC 700802 / V583) GN=groL PE=3 SV=2 27 171 8.0E-08
sp|B0TX65|CH60_FRAP2 60 kDa chaperonin OS=Francisella philomiragia subsp. philomiragia (strain ATCC 25017) GN=groL PE=3 SV=1 27 166 8.0E-08
sp|A1ST72|CH601_PSYIN 60 kDa chaperonin 1 OS=Psychromonas ingrahamii (strain 37) GN=groL1 PE=3 SV=1 27 181 8.0E-08
sp|C6DY43|CH60_GEOSM 60 kDa chaperonin OS=Geobacter sp. (strain M21) GN=groL PE=3 SV=1 37 148 8.0E-08
sp|C0Z361|CPNB3_ARATH Chaperonin 60 subunit beta 3, chloroplastic OS=Arabidopsis thaliana GN=CPN60B3 PE=1 SV=1 37 168 8.0E-08
sp|B4SKL8|CH60_STRM5 60 kDa chaperonin OS=Stenotrophomonas maltophilia (strain R551-3) GN=groL PE=3 SV=1 11 166 8.0E-08
sp|A0QKR2|CH601_MYCA1 60 kDa chaperonin 1 OS=Mycobacterium avium (strain 104) GN=groL1 PE=3 SV=1 37 186 8.0E-08
sp|P48216|CH60_PSEPU 60 kDa chaperonin OS=Pseudomonas putida GN=groL PE=1 SV=3 27 166 9.0E-08
sp|B2V8F1|CH60_SULSY 60 kDa chaperonin OS=Sulfurihydrogenibium sp. (strain YO3AOP1) GN=groL PE=3 SV=1 37 149 9.0E-08
sp|Q87X14|CH60_PSESM 60 kDa chaperonin OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=groL PE=3 SV=1 25 166 9.0E-08
sp|Q48EI5|CH60_PSE14 60 kDa chaperonin OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=groL PE=3 SV=1 27 166 9.0E-08
sp|Q4ZP20|CH60_PSEU2 60 kDa chaperonin OS=Pseudomonas syringae pv. syringae (strain B728a) GN=groL PE=3 SV=1 27 166 9.0E-08
sp|O33500|CH60_PSEST 60 kDa chaperonin OS=Pseudomonas stutzeri GN=groL PE=3 SV=1 27 166 9.0E-08
sp|O66214|CH60_RAOOR 60 kDa chaperonin (Fragment) OS=Raoultella ornithinolytica GN=groL PE=3 SV=1 11 166 9.0E-08
sp|O66210|CH60_KLEOX 60 kDa chaperonin (Fragment) OS=Klebsiella oxytoca GN=groL PE=3 SV=1 11 166 9.0E-08
sp|A1SXK4|CH602_PSYIN 60 kDa chaperonin 2 OS=Psychromonas ingrahamii (strain 37) GN=groL2 PE=3 SV=1 27 166 9.0E-08
sp|Q2KXZ3|CH60_BORA1 60 kDa chaperonin OS=Bordetella avium (strain 197N) GN=groL PE=3 SV=1 11 149 1.0E-07
sp|A5U892|CH602_MYCTA 60 kDa chaperonin 2 OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=groL2 PE=3 SV=1 37 149 1.0E-07
sp|A1KPA8|CH602_MYCBP 60 kDa chaperonin 2 OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) GN=groL2 PE=3 SV=1 37 149 1.0E-07
sp|P9WPE9|CH601_MYCTU 60 kDa chaperonin 1 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=groEL1 PE=1 SV=1 37 149 1.0E-07
sp|P9WPE8|CH601_MYCTO 60 kDa chaperonin 1 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=groEL1 PE=3 SV=1 37 149 1.0E-07
sp|P0A519|CH601_MYCBO 60 kDa chaperonin 1 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=groL1 PE=1 SV=1 37 149 1.0E-07
sp|Q9ANR9|CH60_WIGBR 60 kDa chaperonin OS=Wigglesworthia glossinidia brevipalpis GN=groL PE=3 SV=1 27 163 1.0E-07
sp|B0RAY1|CH60_CLAMS 60 kDa chaperonin OS=Clavibacter michiganensis subsp. sepedonicus (strain ATCC 33113 / DSM 20744 / JCM 9667 / LMG 2889 / C-1) GN=groL PE=3 SV=1 37 187 1.0E-07
sp|A5CTX3|CH60_CLAM3 60 kDa chaperonin OS=Clavibacter michiganensis subsp. michiganensis (strain NCPPB 382) GN=groL PE=3 SV=1 37 187 1.0E-07
sp|Q2LTG7|CH602_SYNAS 60 kDa chaperonin 2 OS=Syntrophus aciditrophicus (strain SB) GN=groL2 PE=3 SV=1 27 147 1.0E-07
sp|O66218|CH60_PANAN 60 kDa chaperonin (Fragment) OS=Pantoea ananas GN=groL PE=3 SV=1 11 166 1.0E-07
sp|Q15PD3|CH60_PSEA6 60 kDa chaperonin OS=Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087) GN=groL PE=3 SV=1 37 166 1.0E-07
sp|A0LEH2|CH601_SYNFM 60 kDa chaperonin 1 OS=Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB) GN=groL1 PE=3 SV=1 37 147 1.0E-07
sp|B5FFY0|CH60_VIBFM 60 kDa chaperonin OS=Vibrio fischeri (strain MJ11) GN=groL PE=3 SV=1 37 176 1.0E-07
sp|Q5E8E6|CH60_VIBF1 60 kDa chaperonin OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=groL PE=3 SV=1 37 176 1.0E-07
sp|Q8GBB4|CH60_AZOVI 60 kDa chaperonin OS=Azotobacter vinelandii GN=groL PE=3 SV=1 27 177 1.0E-07
sp|Q13NE4|CH604_BURXL 60 kDa chaperonin 4 OS=Burkholderia xenovorans (strain LB400) GN=groL4 PE=3 SV=1 17 149 1.0E-07
sp|A5W8M6|CH60_PSEP1 60 kDa chaperonin OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=groL PE=3 SV=1 27 166 1.0E-07
sp|Q9XAU7|CH60_PSEHT 60 kDa chaperonin OS=Pseudoalteromonas haloplanktis (strain TAC 125) GN=groL PE=3 SV=2 27 166 1.0E-07
sp|P78012|CH60_MYCPN 60 kDa chaperonin OS=Mycoplasma pneumoniae (strain ATCC 29342 / M129) GN=groL PE=1 SV=1 37 518 1.0E-07
sp|C4LCA2|CH60_TOLAT 60 kDa chaperonin OS=Tolumonas auensis (strain DSM 9187 / TA4) GN=groL PE=3 SV=1 37 166 1.0E-07
sp|Q19NJ4|CH602_ECOK1 60 kDa chaperonin 2 OS=Escherichia coli O1:K1 / APEC GN=groL2 PE=3 SV=1 11 149 1.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0005524 ATP binding Yes
GO:0017076 purine nucleotide binding No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0000166 nucleotide binding No
GO:0043167 ion binding No
GO:0097159 organic cyclic compound binding No
GO:1901265 nucleoside phosphate binding No
GO:0030554 adenyl nucleotide binding No
GO:0032555 purine ribonucleotide binding No
GO:1901363 heterocyclic compound binding No
GO:0032553 ribonucleotide binding No
GO:0043168 anion binding No
GO:0036094 small molecule binding No
GO:0032559 adenyl ribonucleotide binding No
GO:0005488 binding No
GO:0003674 molecular_function No
GO:0097367 carbohydrate derivative binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 41 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|4315
MSAPAVANAGSSQNATFRDKEKPMAVRSSNIVAARAVADAVRTSLGPRGMDKMIRSGKGETIITNDGHTMLKSMS
VMHPTAKMLVNLAGAQDVEAGDGTTSVVVICGSLLGAADKLLSKGIHPSVISEAFQRAAAAAVEILHDMSQPISL
NDTASLLQAANTSLSSKIVSQYSNLLGPMAVNAVTKTIDIKTADNVDLKNIRIIRKVGGTIEDSELIDGLVLHQP
VLKNAGGPTRMEKARIGLIQFQLSPPKPDMENTIQVNDYRQMDKIVKEERLYLLNMAKKIKKAKCNVLLIQKSIL
RDAVNDLSLHFLAKLGILAIKDIERDEVEFICKSTGCKPIADIDSFTEDKLGFAELVEESESGGSRMVKITGAKA
TGKTVSVVVRGANSLILEEAERSLHDALCVVRCLVKKKALIAGGGAAEIEIASQLSKKARSLSGTEAICWKAFAD
AMEVIPTTLAENAGLNSIKVVTDLRHRHELGEKNAGVSIKSGGVNLNIHKENVLQPLLVSTSAIELAAETVKMIL
RIDDIALTR*
Coding >OphauB2|4315
ATGTCTGCGCCAGCTGTCGCAAATGCTGGCTCGTCTCAGAATGCCACCTTTAGAGACAAGGAAAAGCCAATGGCT
GTCCGGTCTTCCAACATTGTTGCCGCCAGAGCTGTCGCGGACGCGGTTCGGACTTCGCTGGGGCCTCGAGGCATG
GATAAAATGATTCGAAGCGGCAAGGGCGAAACAATAATCACCAACGATGGCCACACAATGCTCAAAAGCATGTCC
GTCATGCACCCTACAGCCAAGATGCTGGTCAATTTGGCTGGAGCTCAAGACGTGGAGGCTGGCGACGGAACGACG
TCGGTCGTGGTCATTTGCGGCAGCCTGCTGGGGGCAGCCGACAAGCTGCTCTCCAAAGGCATCCACCCCTCGGTC
ATTTCCGAGGCCTTTCAAAGAGCAGCAGCAGCAGCAGTAGAGATTTTGCACGACATGTCACAACCAATTTCGCTC
AATGATACCGCCTCGCTTCTACAAGCTGCCAACACGTCCCTGTCGTCCAAAATCGTGTCGCAATATTCCAATCTC
CTTGGGCCAATGGCGGTTAATGCGGTCACCAAGACAATAGACATCAAAACTGCGGACAATGTCGATCTCAAGAAT
ATTCGCATAATCAGAAAAGTCGGAGGGACAATCGAGGACAGCGAGCTGATTGATGGCTTGGTGCTCCATCAGCCT
GTGCTCAAAAACGCAGGCGGGCCTACAAGGATGGAAAAGGCGCGGATTGGGCTCATTCAGTTCCAGCTCAGCCCC
CCCAAACCAGATATGGAAAACACTATTCAGGTCAATGACTACCGACAAATGGACAAGATTGTCAAGGAAGAGCGG
CTCTATCTCCTAAACATGGCCAAAAAGATCAAAAAGGCCAAGTGCAATGTGCTGTTGATTCAAAAATCAATTCTA
CGCGATGCTGTCAACGACTTGTCTCTGCATTTCCTTGCAAAACTCGGCATTCTTGCCATCAAGGATATTGAACGA
GACGAGGTGGAATTTATTTGCAAGTCTACAGGGTGCAAGCCCATTGCCGACATTGACTCCTTTACCGAGGACAAG
CTGGGATTTGCCGAGCTAGTGGAGGAATCTGAATCAGGTGGCTCGCGCATGGTCAAGATTACAGGAGCCAAGGCA
ACTGGCAAGACGGTGTCGGTTGTGGTGCGAGGAGCCAACTCGCTGATATTGGAGGAGGCCGAGAGAAGTCTCCAC
GATGCCCTCTGCGTGGTGCGCTGCCTAGTCAAGAAGAAGGCACTGATTGCGGGCGGCGGCGCAGCCGAAATTGAG
ATTGCGTCACAACTATCCAAGAAGGCGCGAAGCCTTAGCGGAACAGAGGCTATTTGCTGGAAGGCGTTTGCTGAT
GCCATGGAGGTTATACCAACAACCTTGGCCGAGAATGCGGGGCTCAACAGCATCAAGGTTGTGACTGATTTGCGG
CATCGGCACGAGCTGGGAGAAAAGAATGCTGGCGTGAGCATCAAATCAGGGGGCGTCAACCTCAACATCCACAAG
GAGAATGTCTTGCAGCCGCTGCTGGTGAGCACGAGCGCCATTGAGCTTGCGGCGGAGACGGTCAAGATGATTTTG
CGTATAGATGACATTGCCTTGACGAGATAA
Transcript >OphauB2|4315
ATGTCTGCGCCAGCTGTCGCAAATGCTGGCTCGTCTCAGAATGCCACCTTTAGAGACAAGGAAAAGCCAATGGCT
GTCCGGTCTTCCAACATTGTTGCCGCCAGAGCTGTCGCGGACGCGGTTCGGACTTCGCTGGGGCCTCGAGGCATG
GATAAAATGATTCGAAGCGGCAAGGGCGAAACAATAATCACCAACGATGGCCACACAATGCTCAAAAGCATGTCC
GTCATGCACCCTACAGCCAAGATGCTGGTCAATTTGGCTGGAGCTCAAGACGTGGAGGCTGGCGACGGAACGACG
TCGGTCGTGGTCATTTGCGGCAGCCTGCTGGGGGCAGCCGACAAGCTGCTCTCCAAAGGCATCCACCCCTCGGTC
ATTTCCGAGGCCTTTCAAAGAGCAGCAGCAGCAGCAGTAGAGATTTTGCACGACATGTCACAACCAATTTCGCTC
AATGATACCGCCTCGCTTCTACAAGCTGCCAACACGTCCCTGTCGTCCAAAATCGTGTCGCAATATTCCAATCTC
CTTGGGCCAATGGCGGTTAATGCGGTCACCAAGACAATAGACATCAAAACTGCGGACAATGTCGATCTCAAGAAT
ATTCGCATAATCAGAAAAGTCGGAGGGACAATCGAGGACAGCGAGCTGATTGATGGCTTGGTGCTCCATCAGCCT
GTGCTCAAAAACGCAGGCGGGCCTACAAGGATGGAAAAGGCGCGGATTGGGCTCATTCAGTTCCAGCTCAGCCCC
CCCAAACCAGATATGGAAAACACTATTCAGGTCAATGACTACCGACAAATGGACAAGATTGTCAAGGAAGAGCGG
CTCTATCTCCTAAACATGGCCAAAAAGATCAAAAAGGCCAAGTGCAATGTGCTGTTGATTCAAAAATCAATTCTA
CGCGATGCTGTCAACGACTTGTCTCTGCATTTCCTTGCAAAACTCGGCATTCTTGCCATCAAGGATATTGAACGA
GACGAGGTGGAATTTATTTGCAAGTCTACAGGGTGCAAGCCCATTGCCGACATTGACTCCTTTACCGAGGACAAG
CTGGGATTTGCCGAGCTAGTGGAGGAATCTGAATCAGGTGGCTCGCGCATGGTCAAGATTACAGGAGCCAAGGCA
ACTGGCAAGACGGTGTCGGTTGTGGTGCGAGGAGCCAACTCGCTGATATTGGAGGAGGCCGAGAGAAGTCTCCAC
GATGCCCTCTGCGTGGTGCGCTGCCTAGTCAAGAAGAAGGCACTGATTGCGGGCGGCGGCGCAGCCGAAATTGAG
ATTGCGTCACAACTATCCAAGAAGGCGCGAAGCCTTAGCGGAACAGAGGCTATTTGCTGGAAGGCGTTTGCTGAT
GCCATGGAGGTTATACCAACAACCTTGGCCGAGAATGCGGGGCTCAACAGCATCAAGGTTGTGACTGATTTGCGG
CATCGGCACGAGCTGGGAGAAAAGAATGCTGGCGTGAGCATCAAATCAGGGGGCGTCAACCTCAACATCCACAAG
GAGAATGTCTTGCAGCCGCTGCTGGTGAGCACGAGCGCCATTGAGCTTGCGGCGGAGACGGTCAAGATGATTTTG
CGTATAGATGACATTGCCTTGACGAGATAA
Gene >OphauB2|4315
ATGTCTGCGCCAGCTGTCGCAAATGCTGGCTCGTCTCAGAATGCCACCTTTAGAGTATGCAAAGCTCTCGAGACT
GCGCGACTGGCCCCGCTGACAGCTTCCAGGACAAGGAAAAGCCAATGGCTGTCCGGTCTTCCAACATTGTTGCCG
CCAGAGGTTCGAACTTGAATGGATTCCATCTCTTTTTACCTGACGGCGACTGACGTTGTAGCAGCTGTCGCGGAC
GCGGTTCGGACTTCGCTGGGGCCTCGAGGCATGGATAAAATGATTCGAAGCGGCAAGGGCGAAACAATAATCACC
AACGATGGCCACACAATGCTCAAAAGCATGTCCGTCATGCACCCTACAGCCAAGATGCTGGTCAATTTGGCTGGA
GCTCAAGACGTGGAGGCTGGCGACGGAACGACGTCGGTCGTGGTCATTTGCGGCAGCCTGCTGGGGGCAGCCGAC
AAGCTGCTCTCCAAAGGCATCCACCCCTCGGTCATTTCCGAGGCCTTTCAAAGAGCAGCAGCAGCAGCAGTAGAG
ATTTTGCACGACATGTCACAACCAATTTCGCTCAATGATACCGCCTCGCTTCTACAAGCTGCCAACACGTCCCTG
TCGTCCAAAATCGTGTCGCAATATTCCAATCTCCTTGGGCCAATGGCGGTTAATGCGGTCACCAAGACAATAGAC
ATCAAAACTGCGGACAATGTCGATCTCAAGAATATTCGCATAATCAGAAAAGTCGGAGGGACAATCGAGGACAGC
GAGCTGATTGATGGCTTGGTGCTCCATCAGCCTGTGCTCAAAAACGCAGGCGGGCCTACAAGGATGGAAAAGGCG
CGGATTGGGCTCATTCAGTTCCAGCTCAGCCCCCCCAAACCAGATGTAAGTTGACATGGGTCCATTTGGCTTGTT
CTAGACTAGAGAGTGTCGGTTGGCTGACTTTTGGCATACAGATGGAAAACACTATTCAGGTCAATGACTACCGAC
AAATGGACAAGATTGTCAAGGAAGAGCGGCTCTATCTCCTAAACATGGCCAAAAAGATCAAAAAGGCCAAGTGCA
ATGTGCTGTTGATTCAAAAATCAATTCTACGCGATGCTGTCAACGACTTGTCTCTGCATTTCCTTGCAAAACTCG
GCATTCTTGCCATCAAGGATATTGAACGAGACGAGGTGGAATTTATTTGCAAGTCTACAGGGTGCAAGCCCATTG
CCGACATTGACTCCTTTACCGAGGACAAGCTGGGATTTGCCGAGCTAGTGGAGGAATCTGAATCAGGTGGCTCGC
GCATGGTCAAGATTACAGGAGCCAAGGCAACTGGCAAGACGGTGTCGGTTGTGGTGCGAGGAGCCAACTCGCTGA
TATTGGAGGAGGCCGAGAGAAGTCTCCACGATGCCCTCTGCGTGGTGCGCTGCCTAGTCAAGAAGAAGGCACTGA
TTGCGGGCGGCGGCGCAGCCGAAATTGAGATTGCGTCACAACTATCCAAGAAGGCGCGAAGCCTTAGCGGAACAG
AGGCTATTTGCTGGAAGGCGTTTGCTGATGCCATGGAGGTTATACCAACAACCTTGGCCGAGAATGCGGGGCTCA
ACAGCATCAAGGTTGTGACTGATTTGCGGCATCGGCACGAGCTGGGAGAAAAGAATGCTGGCGTGAGCATCAAAT
CAGGGGGCGTCAACCTCAACATCCACAAGGAGAATGTCTTGCAGCCGCTGCTGGTGAGCACGAGCGCCATTGAGC
TTGCGGCGGAGACGGTCAAGATGATTTTGCGTATAGATGACATTGCCTTGACGAGATAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail