Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|4311
Gene name
LocationContig_29:67297..68624
Strand-
Gene length (bp)1327
Transcript length (bp)1251
Coding sequence length (bp)1251
Protein length (aa) 417

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13516 LRR_6 Leucine Rich repeat 1.5E-02 224 243
PF13516 LRR_6 Leucine Rich repeat 2.3E-02 278 300

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P41391|RNA1_SCHPO Ran GTPase-activating protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rna1 PE=1 SV=1 8 338 6.0E-99
sp|P11745|RNA1_YEAST Ran GTPase-activating protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RNA1 PE=1 SV=2 6 332 1.0E-63
sp|Q9VIW3|RAGP1_DROME Ran GTPase-activating protein OS=Drosophila melanogaster GN=RanGAP PE=1 SV=1 9 324 3.0E-44
sp|O13066|RAGP1_XENLA Ran GTPase-activating protein 1 OS=Xenopus laevis GN=rangap1 PE=2 SV=1 8 324 2.0E-43
sp|P46061|RAGP1_MOUSE Ran GTPase-activating protein 1 OS=Mus musculus GN=Rangap1 PE=1 SV=2 9 324 5.0E-42
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P41391|RNA1_SCHPO Ran GTPase-activating protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rna1 PE=1 SV=1 8 338 6.0E-99
sp|P11745|RNA1_YEAST Ran GTPase-activating protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RNA1 PE=1 SV=2 6 332 1.0E-63
sp|Q9VIW3|RAGP1_DROME Ran GTPase-activating protein OS=Drosophila melanogaster GN=RanGAP PE=1 SV=1 9 324 3.0E-44
sp|O13066|RAGP1_XENLA Ran GTPase-activating protein 1 OS=Xenopus laevis GN=rangap1 PE=2 SV=1 8 324 2.0E-43
sp|P46061|RAGP1_MOUSE Ran GTPase-activating protein 1 OS=Mus musculus GN=Rangap1 PE=1 SV=2 9 324 5.0E-42
sp|P46060|RAGP1_HUMAN Ran GTPase-activating protein 1 OS=Homo sapiens GN=RANGAP1 PE=1 SV=1 9 324 2.0E-41
sp|P34342|RGP2_CAEEL Ran GTPase-activating protein 2 OS=Caenorhabditis elegans GN=ran-2 PE=4 SV=3 2 327 5.0E-35
sp|P34342|RGP2_CAEEL Ran GTPase-activating protein 2 OS=Caenorhabditis elegans GN=ran-2 PE=4 SV=3 7 293 1.0E-28
sp|Q9LE82|RAGP1_ARATH RAN GTPase-activating protein 1 OS=Arabidopsis thaliana GN=RANGAP1 PE=1 SV=1 7 293 2.0E-12
sp|Q8HZP9|RINI_PANTR Ribonuclease inhibitor OS=Pan troglodytes GN=RNH1 PE=2 SV=3 186 330 3.0E-06
sp|Q19857|PPR37_CAEEL Protein phosphatase 1 regulatory subunit 37 homolog OS=Caenorhabditis elegans GN=F28C1.3 PE=3 SV=5 87 381 3.0E-06
sp|P29315|RINI_RAT Ribonuclease inhibitor OS=Rattus norvegicus GN=Rnh1 PE=1 SV=2 118 336 5.0E-06
sp|Q9R1M5|NALP5_MOUSE NACHT, LRR and PYD domains-containing protein 5 OS=Mus musculus GN=Nlrp5 PE=1 SV=2 35 322 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0003674 molecular_function No
GO:0005488 binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 40 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|4311
MVDSAKIFSLEGQGLKLDTAEDVEAHIAPLRENDVEEVRLLGNTLGVEACKLLGQVLVTKKNLKVANLADIFTGR
LLSEIPDALSALLTSILNLPKLNTINLNDNAFGLNTQAPLVAFLSSHVPLQHLHLNNNGLGPRAGILIADALSEL
HEKKEAARKDGTQIPDLETIICGRNRLENGSMTAWAKTLSLHNKLKEIKMIQNGIRQEGISHLLNEGLSHATELQ
ILDLQDNTLTLVGAEALAKVAPRWALLRELGIGDSLLGAKGAILLSEALAQGNNKKLEILRLQYNDITSAGIKRF
ASAARDALPALKRIELNGNKFSEDDDSILALQVLLEKRKENSANHDEDGDDCWGVDDLSDLEDEDSQDESDEEEI
EREEMAEKMVKDAEEAEEEPVVQLDDKDVDALAKELKKTSI*
Coding >OphauB2|4311
ATGGTCGACTCTGCTAAAATATTTTCTCTTGAGGGCCAAGGTCTCAAACTCGACACTGCGGAAGACGTCGAAGCT
CACATTGCCCCCTTGCGGGAAAACGACGTGGAAGAAGTTCGTCTGCTGGGCAATACGCTGGGCGTTGAGGCTTGT
AAGCTGCTTGGCCAAGTTCTTGTCACCAAGAAGAATCTCAAGGTGGCAAACTTGGCCGACATTTTCACCGGCCGC
CTCTTGTCCGAGATTCCCGACGCTCTCTCTGCCCTCCTCACGTCCATTCTTAACCTCCCCAAACTCAACACCATT
AACCTCAATGATAACGCGTTTGGCCTGAATACTCAAGCCCCCCTGGTTGCCTTTCTTTCCTCTCACGTTCCGCTG
CAGCACCTCCATCTCAATAACAATGGACTGGGCCCTCGTGCCGGCATTCTCATTGCCGACGCCTTGTCAGAGCTT
CACGAGAAGAAGGAGGCGGCGCGCAAGGACGGAACGCAGATTCCCGATTTAGAGACTATTATTTGTGGCCGAAAT
CGACTTGAAAATGGCAGCATGACGGCTTGGGCCAAGACGCTGAGCTTACACAATAAGCTCAAAGAGATCAAGATG
ATACAAAACGGCATTCGCCAGGAAGGCATTTCACATCTTCTCAATGAGGGTTTGAGCCACGCCACTGAGCTGCAA
ATACTCGATTTGCAGGACAATACCCTTACCCTCGTGGGAGCCGAGGCTCTTGCCAAAGTTGCCCCGCGCTGGGCC
CTGCTTCGCGAACTCGGCATTGGCGACTCTCTTCTTGGTGCAAAGGGCGCCATTCTCCTTTCTGAAGCTCTTGCC
CAGGGCAATAACAAGAAACTCGAGATTCTACGCCTGCAGTACAATGACATTACATCTGCCGGCATCAAGCGCTTT
GCCTCTGCCGCTCGAGACGCCCTCCCGGCTCTCAAGCGTATCGAACTCAATGGCAACAAGTTTTCTGAAGACGAC
GACTCGATTCTCGCCCTTCAAGTCCTTTTGGAGAAGCGCAAGGAAAACTCTGCCAACCACGATGAAGATGGCGAC
GACTGCTGGGGCGTGGACGACCTGAGCGACCTTGAAGACGAAGATAGCCAAGATGAGTCGGACGAAGAAGAAATT
GAGCGCGAAGAAATGGCTGAGAAGATGGTCAAGGATGCTGAAGAAGCCGAGGAAGAACCCGTGGTACAACTCGAC
GACAAGGATGTCGACGCCCTGGCCAAGGAACTCAAGAAGACGTCTATATAA
Transcript >OphauB2|4311
ATGGTCGACTCTGCTAAAATATTTTCTCTTGAGGGCCAAGGTCTCAAACTCGACACTGCGGAAGACGTCGAAGCT
CACATTGCCCCCTTGCGGGAAAACGACGTGGAAGAAGTTCGTCTGCTGGGCAATACGCTGGGCGTTGAGGCTTGT
AAGCTGCTTGGCCAAGTTCTTGTCACCAAGAAGAATCTCAAGGTGGCAAACTTGGCCGACATTTTCACCGGCCGC
CTCTTGTCCGAGATTCCCGACGCTCTCTCTGCCCTCCTCACGTCCATTCTTAACCTCCCCAAACTCAACACCATT
AACCTCAATGATAACGCGTTTGGCCTGAATACTCAAGCCCCCCTGGTTGCCTTTCTTTCCTCTCACGTTCCGCTG
CAGCACCTCCATCTCAATAACAATGGACTGGGCCCTCGTGCCGGCATTCTCATTGCCGACGCCTTGTCAGAGCTT
CACGAGAAGAAGGAGGCGGCGCGCAAGGACGGAACGCAGATTCCCGATTTAGAGACTATTATTTGTGGCCGAAAT
CGACTTGAAAATGGCAGCATGACGGCTTGGGCCAAGACGCTGAGCTTACACAATAAGCTCAAAGAGATCAAGATG
ATACAAAACGGCATTCGCCAGGAAGGCATTTCACATCTTCTCAATGAGGGTTTGAGCCACGCCACTGAGCTGCAA
ATACTCGATTTGCAGGACAATACCCTTACCCTCGTGGGAGCCGAGGCTCTTGCCAAAGTTGCCCCGCGCTGGGCC
CTGCTTCGCGAACTCGGCATTGGCGACTCTCTTCTTGGTGCAAAGGGCGCCATTCTCCTTTCTGAAGCTCTTGCC
CAGGGCAATAACAAGAAACTCGAGATTCTACGCCTGCAGTACAATGACATTACATCTGCCGGCATCAAGCGCTTT
GCCTCTGCCGCTCGAGACGCCCTCCCGGCTCTCAAGCGTATCGAACTCAATGGCAACAAGTTTTCTGAAGACGAC
GACTCGATTCTCGCCCTTCAAGTCCTTTTGGAGAAGCGCAAGGAAAACTCTGCCAACCACGATGAAGATGGCGAC
GACTGCTGGGGCGTGGACGACCTGAGCGACCTTGAAGACGAAGATAGCCAAGATGAGTCGGACGAAGAAGAAATT
GAGCGCGAAGAAATGGCTGAGAAGATGGTCAAGGATGCTGAAGAAGCCGAGGAAGAACCCGTGGTACAACTCGAC
GACAAGGATGTCGACGCCCTGGCCAAGGAACTCAAGAAGACGTCTATATAA
Gene >OphauB2|4311
ATGGTCGACTCTGCTAAAATATTTTCTCTTGAGGGCCAAGGTCTCAAACTCGACACTGCGGAAGACGTCGAAGCT
CACATTGCCCCCTTGCGGGAAAACGACGTGGAAGAAGTTCGTCTGCTGGGCAATACGCTGGGCGTTGAGGCTTGT
AAGCTGCTTGGCCAAGTTCTTGTCACCAAGAAGAATCTCAAGGTAACAAGACACGAGCCCCTGAAAACAACGCAA
CTTTTTAGGCCATCTCTTCTGACTCTGTGCAAAACAAAAACAGGTGGCAAACTTGGCCGACATTTTCACCGGCCG
CCTCTTGTCCGAGATTCCCGACGCTCTCTCTGCCCTCCTCACGTCCATTCTTAACCTCCCCAAACTCAACACCAT
TAACCTCAATGATAACGCGTTTGGCCTGAATACTCAAGCCCCCCTGGTTGCCTTTCTTTCCTCTCACGTTCCGCT
GCAGCACCTCCATCTCAATAACAATGGACTGGGCCCTCGTGCCGGCATTCTCATTGCCGACGCCTTGTCAGAGCT
TCACGAGAAGAAGGAGGCGGCGCGCAAGGACGGAACGCAGATTCCCGATTTAGAGACTATTATTTGTGGCCGAAA
TCGACTTGAAAATGGCAGCATGACGGCTTGGGCCAAGACGCTGAGCTTACACAATAAGCTCAAAGAGATCAAGAT
GATACAAAACGGCATTCGCCAGGAAGGCATTTCACATCTTCTCAATGAGGGTTTGAGCCACGCCACTGAGCTGCA
AATACTCGATTTGCAGGACAATACCCTTACCCTCGTGGGAGCCGAGGCTCTTGCCAAAGTTGCCCCGCGCTGGGC
CCTGCTTCGCGAACTCGGCATTGGCGACTCTCTTCTTGGTGCAAAGGGCGCCATTCTCCTTTCTGAAGCTCTTGC
CCAGGGCAATAACAAGAAACTCGAGATTCTACGCCTGCAGTACAATGACATTACATCTGCCGGCATCAAGCGCTT
TGCCTCTGCCGCTCGAGACGCCCTCCCGGCTCTCAAGCGTATCGAACTCAATGGCAACAAGTTTTCTGAAGACGA
CGACTCGATTCTCGCCCTTCAAGTCCTTTTGGAGAAGCGCAAGGAAAACTCTGCCAACCACGATGAAGATGGCGA
CGACTGCTGGGGCGTGGACGACCTGAGCGACCTTGAAGACGAAGATAGCCAAGATGAGTCGGACGAAGAAGAAAT
TGAGCGCGAAGAAATGGCTGAGAAGATGGTCAAGGATGCTGAAGAAGCCGAGGAAGAACCCGTGGTACAACTCGA
CGACAAGGATGTCGACGCCCTGGCCAAGGAACTCAAGAAGACGTCTATATAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail