Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|4306
Gene name
LocationContig_29:49783..51509
Strand+
Gene length (bp)1726
Transcript length (bp)1668
Coding sequence length (bp)1668
Protein length (aa) 556

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04677 CwfJ_C_1 Protein similar to CwfJ C-terminus 1 1.6E-22 307 436
PF04676 CwfJ_C_2 Protein similar to CwfJ C-terminus 2 1.9E-16 477 549

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q10414|MU161_SCHPO CWF19-like protein mug161 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mug161 PE=1 SV=1 6 549 2.0E-67
sp|A1Z8J0|C19L1_DROME CWF19-like protein 1 homolog OS=Drosophila melanogaster GN=CG7741 PE=2 SV=1 2 549 2.0E-45
sp|Q8CI33|C19L1_MOUSE CWF19-like protein 1 OS=Mus musculus GN=Cwf19l1 PE=1 SV=2 5 550 2.0E-36
sp|O16216|C19L1_CAEEL CWF19-like protein 1 homolog OS=Caenorhabditis elegans GN=F17A9.2 PE=3 SV=2 1 553 7.0E-36
sp|Q8AVL0|C19L1_XENLA CWF19-like protein 1 OS=Xenopus laevis GN=cwf19l1 PE=2 SV=1 5 551 8.0E-35
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q10414|MU161_SCHPO CWF19-like protein mug161 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mug161 PE=1 SV=1 6 549 2.0E-67
sp|A1Z8J0|C19L1_DROME CWF19-like protein 1 homolog OS=Drosophila melanogaster GN=CG7741 PE=2 SV=1 2 549 2.0E-45
sp|Q8CI33|C19L1_MOUSE CWF19-like protein 1 OS=Mus musculus GN=Cwf19l1 PE=1 SV=2 5 550 2.0E-36
sp|O16216|C19L1_CAEEL CWF19-like protein 1 homolog OS=Caenorhabditis elegans GN=F17A9.2 PE=3 SV=2 1 553 7.0E-36
sp|Q8AVL0|C19L1_XENLA CWF19-like protein 1 OS=Xenopus laevis GN=cwf19l1 PE=2 SV=1 5 551 8.0E-35
sp|P53255|DRN1_YEAST CWF19-like protein DRN1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DRN1 PE=1 SV=1 120 553 1.0E-33
sp|Q5RGJ5|C19L1_DANRE CWF19-like protein 1 OS=Danio rerio GN=cwf19l1 PE=2 SV=1 5 550 2.0E-33
sp|Q5R8R4|C19L1_PONAB CWF19-like protein 1 OS=Pongo abelii GN=CWF19L1 PE=2 SV=1 5 550 3.0E-33
sp|Q69YN2|C19L1_HUMAN CWF19-like protein 1 OS=Homo sapiens GN=CWF19L1 PE=1 SV=2 5 550 1.0E-32
sp|Q84WU9|C3H64_ARATH Zinc finger CCCH domain-containing protein 64 OS=Arabidopsis thaliana GN=At5g56900 PE=2 SV=1 4 547 6.0E-28
sp|Q69NK8|C3H59_ORYSJ Zinc finger CCCH domain-containing protein 59 OS=Oryza sativa subsp. japonica GN=Os09g0364000 PE=2 SV=1 5 547 8.0E-26
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 36 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|4306
MATPKIIVFGSLNGQLKPALKKLAALHAKNDFALAILTGDVFAPDDDADLISELLAGSIEIAIPTYFSLGVRPLP
LAITQKLAANEPICDNFFYLDKRSITTTAEGIRIVVLAGLLDSDANGDEATQPHLPSHSLQDAKTLRGANSADVL
LTSMWPAEIWSRSKVALEPQQQAALLSSQPLAELCAALKPRYHLSASPGAFFYEREPFVQPAASDSDPVPSVTRF
ISMAPFGNTAKAKAMYAFSLNKTDVSLPAGVTPCPFAALHPHKKRGPQDSGSYNRFGTLDRDASDGYGRGHKRRR
HAAPPPGPDRCYFCLSNPNISAHMCCSIGDESYITTAKGPLLTNTIFADRGLDFAAHFIIIPLPHAATMASLDSL
SDATGEASRAYNEMVRFRESLQAMIASQSSFRLGTVTWEISRDRNVHLIWQLVAVPADLIQNGVVEAAFRVEAEN
NKYPAFATRDLSLQDQAAFGDFFRVWLWADNGEDRIKGKSLVMPLPNDLRFDLQFGRRVLAKLLGLEKRFVWQDC
EQDVDEETRQVEVFRKAFAKWDFTVQQDES*
Coding >OphauB2|4306
ATGGCCACTCCCAAGATAATCGTATTTGGGAGTCTCAACGGCCAGCTCAAGCCCGCCTTGAAGAAGCTGGCCGCC
CTGCACGCCAAAAACGACTTTGCTCTCGCCATTCTCACCGGCGACGTCTTTGCGCCCGACGACGACGCCGACCTC
ATTTCCGAGCTCCTCGCTGGCTCAATCGAAATTGCTATACCCACCTACTTTTCTCTTGGCGTGCGTCCTCTACCA
CTAGCCATTACGCAGAAACTCGCAGCCAATGAGCCCATTTGCGACAACTTTTTCTATCTAGACAAGCGCTCCATC
ACCACTACAGCAGAGGGCATCCGCATCGTCGTGCTCGCCGGGCTCTTGGACTCTGATGCCAATGGCGACGAAGCT
ACTCAGCCACACCTCCCCTCCCACAGCCTCCAAGACGCCAAGACGCTACGCGGCGCAAACAGTGCCGATGTCCTC
CTAACCTCGATGTGGCCAGCCGAAATCTGGTCCCGCTCCAAAGTCGCTCTCGAACCCCAGCAACAGGCCGCCCTG
CTAAGCAGCCAGCCACTTGCTGAGCTCTGTGCCGCACTCAAGCCTCGCTATCACCTGTCGGCCTCTCCCGGCGCC
TTCTTTTACGAGCGAGAGCCCTTTGTCCAACCCGCAGCCAGTGACTCTGACCCGGTTCCATCAGTCACTCGCTTC
ATCTCCATGGCGCCCTTTGGCAACACTGCCAAGGCCAAGGCCATGTATGCATTCAGCCTCAACAAGACTGATGTC
TCTCTCCCTGCCGGTGTCACGCCTTGTCCCTTTGCTGCCCTGCATCCGCACAAGAAGCGTGGACCCCAAGACTCT
GGCTCCTATAACCGCTTTGGCACTCTTGACCGAGACGCCTCGGACGGCTACGGCCGGGGCCACAAGCGACGCCGA
CACGCTGCTCCACCTCCCGGACCCGACCGCTGCTACTTTTGCCTCTCCAACCCAAACATATCTGCACACATGTGC
TGCAGCATTGGTGACGAATCATACATCACCACTGCCAAGGGCCCGCTCCTCACAAATACCATTTTTGCCGACCGT
GGCCTCGACTTTGCTGCCCACTTCATCATCATTCCCCTTCCCCATGCCGCCACCATGGCCAGCCTAGACTCCCTC
TCAGACGCCACGGGCGAAGCCTCGAGAGCTTACAACGAAATGGTGCGCTTCCGCGAGTCACTTCAGGCCATGATT
GCCTCACAGTCGTCCTTTCGTCTAGGAACAGTCACCTGGGAAATCAGCCGCGACCGAAACGTCCATCTCATCTGG
CAACTCGTCGCCGTCCCCGCCGACCTCATTCAAAACGGAGTCGTGGAAGCCGCCTTTAGGGTCGAGGCTGAAAAT
AACAAATACCCAGCTTTTGCCACTAGGGATCTTTCCCTCCAAGACCAAGCCGCCTTTGGAGACTTTTTCCGCGTC
TGGCTTTGGGCCGATAATGGCGAGGACCGAATTAAGGGCAAGTCCCTCGTTATGCCTCTGCCCAACGACTTGCGT
TTTGACTTGCAGTTTGGCCGCCGCGTCTTGGCCAAGCTCCTCGGCTTGGAAAAACGCTTTGTCTGGCAAGACTGC
GAACAAGATGTCGATGAAGAGACTAGGCAGGTCGAGGTCTTTCGCAAGGCCTTTGCCAAGTGGGACTTTACCGTG
CAACAGGATGAGAGCTAA
Transcript >OphauB2|4306
ATGGCCACTCCCAAGATAATCGTATTTGGGAGTCTCAACGGCCAGCTCAAGCCCGCCTTGAAGAAGCTGGCCGCC
CTGCACGCCAAAAACGACTTTGCTCTCGCCATTCTCACCGGCGACGTCTTTGCGCCCGACGACGACGCCGACCTC
ATTTCCGAGCTCCTCGCTGGCTCAATCGAAATTGCTATACCCACCTACTTTTCTCTTGGCGTGCGTCCTCTACCA
CTAGCCATTACGCAGAAACTCGCAGCCAATGAGCCCATTTGCGACAACTTTTTCTATCTAGACAAGCGCTCCATC
ACCACTACAGCAGAGGGCATCCGCATCGTCGTGCTCGCCGGGCTCTTGGACTCTGATGCCAATGGCGACGAAGCT
ACTCAGCCACACCTCCCCTCCCACAGCCTCCAAGACGCCAAGACGCTACGCGGCGCAAACAGTGCCGATGTCCTC
CTAACCTCGATGTGGCCAGCCGAAATCTGGTCCCGCTCCAAAGTCGCTCTCGAACCCCAGCAACAGGCCGCCCTG
CTAAGCAGCCAGCCACTTGCTGAGCTCTGTGCCGCACTCAAGCCTCGCTATCACCTGTCGGCCTCTCCCGGCGCC
TTCTTTTACGAGCGAGAGCCCTTTGTCCAACCCGCAGCCAGTGACTCTGACCCGGTTCCATCAGTCACTCGCTTC
ATCTCCATGGCGCCCTTTGGCAACACTGCCAAGGCCAAGGCCATGTATGCATTCAGCCTCAACAAGACTGATGTC
TCTCTCCCTGCCGGTGTCACGCCTTGTCCCTTTGCTGCCCTGCATCCGCACAAGAAGCGTGGACCCCAAGACTCT
GGCTCCTATAACCGCTTTGGCACTCTTGACCGAGACGCCTCGGACGGCTACGGCCGGGGCCACAAGCGACGCCGA
CACGCTGCTCCACCTCCCGGACCCGACCGCTGCTACTTTTGCCTCTCCAACCCAAACATATCTGCACACATGTGC
TGCAGCATTGGTGACGAATCATACATCACCACTGCCAAGGGCCCGCTCCTCACAAATACCATTTTTGCCGACCGT
GGCCTCGACTTTGCTGCCCACTTCATCATCATTCCCCTTCCCCATGCCGCCACCATGGCCAGCCTAGACTCCCTC
TCAGACGCCACGGGCGAAGCCTCGAGAGCTTACAACGAAATGGTGCGCTTCCGCGAGTCACTTCAGGCCATGATT
GCCTCACAGTCGTCCTTTCGTCTAGGAACAGTCACCTGGGAAATCAGCCGCGACCGAAACGTCCATCTCATCTGG
CAACTCGTCGCCGTCCCCGCCGACCTCATTCAAAACGGAGTCGTGGAAGCCGCCTTTAGGGTCGAGGCTGAAAAT
AACAAATACCCAGCTTTTGCCACTAGGGATCTTTCCCTCCAAGACCAAGCCGCCTTTGGAGACTTTTTCCGCGTC
TGGCTTTGGGCCGATAATGGCGAGGACCGAATTAAGGGCAAGTCCCTCGTTATGCCTCTGCCCAACGACTTGCGT
TTTGACTTGCAGTTTGGCCGCCGCGTCTTGGCCAAGCTCCTCGGCTTGGAAAAACGCTTTGTCTGGCAAGACTGC
GAACAAGATGTCGATGAAGAGACTAGGCAGGTCGAGGTCTTTCGCAAGGCCTTTGCCAAGTGGGACTTTACCGTG
CAACAGGATGAGAGCTAA
Gene >OphauB2|4306
ATGGCCACTCCCAAGATGTGCGTTTCCTCCCCGCTTCATTTCCCCCGCTATGCTCTCTTGCTAACCGCCCTGCAG
AATCGTATTTGGGAGTCTCAACGGCCAGCTCAAGCCCGCCTTGAAGAAGCTGGCCGCCCTGCACGCCAAAAACGA
CTTTGCTCTCGCCATTCTCACCGGCGACGTCTTTGCGCCCGACGACGACGCCGACCTCATTTCCGAGCTCCTCGC
TGGCTCAATCGAAATTGCTATACCCACCTACTTTTCTCTTGGCGTGCGTCCTCTACCACTAGCCATTACGCAGAA
ACTCGCAGCCAATGAGCCCATTTGCGACAACTTTTTCTATCTAGACAAGCGCTCCATCACCACTACAGCAGAGGG
CATCCGCATCGTCGTGCTCGCCGGGCTCTTGGACTCTGATGCCAATGGCGACGAAGCTACTCAGCCACACCTCCC
CTCCCACAGCCTCCAAGACGCCAAGACGCTACGCGGCGCAAACAGTGCCGATGTCCTCCTAACCTCGATGTGGCC
AGCCGAAATCTGGTCCCGCTCCAAAGTCGCTCTCGAACCCCAGCAACAGGCCGCCCTGCTAAGCAGCCAGCCACT
TGCTGAGCTCTGTGCCGCACTCAAGCCTCGCTATCACCTGTCGGCCTCTCCCGGCGCCTTCTTTTACGAGCGAGA
GCCCTTTGTCCAACCCGCAGCCAGTGACTCTGACCCGGTTCCATCAGTCACTCGCTTCATCTCCATGGCGCCCTT
TGGCAACACTGCCAAGGCCAAGGCCATGTATGCATTCAGCCTCAACAAGACTGATGTCTCTCTCCCTGCCGGTGT
CACGCCTTGTCCCTTTGCTGCCCTGCATCCGCACAAGAAGCGTGGACCCCAAGACTCTGGCTCCTATAACCGCTT
TGGCACTCTTGACCGAGACGCCTCGGACGGCTACGGCCGGGGCCACAAGCGACGCCGACACGCTGCTCCACCTCC
CGGACCCGACCGCTGCTACTTTTGCCTCTCCAACCCAAACATATCTGCACACATGTGCTGCAGCATTGGTGACGA
ATCATACATCACCACTGCCAAGGGCCCGCTCCTCACAAATACCATTTTTGCCGACCGTGGCCTCGACTTTGCTGC
CCACTTCATCATCATTCCCCTTCCCCATGCCGCCACCATGGCCAGCCTAGACTCCCTCTCAGACGCCACGGGCGA
AGCCTCGAGAGCTTACAACGAAATGGTGCGCTTCCGCGAGTCACTTCAGGCCATGATTGCCTCACAGTCGTCCTT
TCGTCTAGGAACAGTCACCTGGGAAATCAGCCGCGACCGAAACGTCCATCTCATCTGGCAACTCGTCGCCGTCCC
CGCCGACCTCATTCAAAACGGAGTCGTGGAAGCCGCCTTTAGGGTCGAGGCTGAAAATAACAAATACCCAGCTTT
TGCCACTAGGGATCTTTCCCTCCAAGACCAAGCCGCCTTTGGAGACTTTTTCCGCGTCTGGCTTTGGGCCGATAA
TGGCGAGGACCGAATTAAGGGCAAGTCCCTCGTTATGCCTCTGCCCAACGACTTGCGTTTTGACTTGCAGTTTGG
CCGCCGCGTCTTGGCCAAGCTCCTCGGCTTGGAAAAACGCTTTGTCTGGCAAGACTGCGAACAAGATGTCGATGA
AGAGACTAGGCAGGTCGAGGTCTTTCGCAAGGCCTTTGCCAAGTGGGACTTTACCGTGCAACAGGATGAGAGCTA
A

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail