Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|4297
Gene name
LocationContig_29:24722..26214
Strand-
Gene length (bp)1492
Transcript length (bp)1419
Coding sequence length (bp)1419
Protein length (aa) 473

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF11991 Trp_DMAT Tryptophan dimethylallyltransferase 4.9E-92 68 420

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q6Q874|SIRD_LEPMC 4-O-dimethylallyl-L-tyrosine synthase OS=Leptosphaeria maculans GN=sirD PE=1 SV=1 50 460 1.0E-57
sp|Q4WYG3|7DMAW_ASPFU 7-dimethylallyltryptophan synthase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=etpPT PE=1 SV=2 70 458 3.0E-45
sp|M1WA41|DMAW1_CLAP2 Tryptophan dimethylallyltransferase 1 OS=Claviceps purpurea (strain 20.1) GN=dmaW1 PE=3 SV=1 63 407 4.0E-30
sp|Q9C141|DMAW2_CLAP2 Tryptophan dimethylallyltransferase 2 OS=Claviceps purpurea (strain 20.1) GN=dmaW2 PE=3 SV=1 63 407 6.0E-30
sp|Q6X2E2|DMAW1_EPICN Tryptophan dimethylallyltransferase 1 OS=Epichloe coenophiala GN=dmaW1 PE=3 SV=1 58 448 6.0E-30
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q6Q874|SIRD_LEPMC 4-O-dimethylallyl-L-tyrosine synthase OS=Leptosphaeria maculans GN=sirD PE=1 SV=1 50 460 1.0E-57
sp|Q4WYG3|7DMAW_ASPFU 7-dimethylallyltryptophan synthase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=etpPT PE=1 SV=2 70 458 3.0E-45
sp|M1WA41|DMAW1_CLAP2 Tryptophan dimethylallyltransferase 1 OS=Claviceps purpurea (strain 20.1) GN=dmaW1 PE=3 SV=1 63 407 4.0E-30
sp|Q9C141|DMAW2_CLAP2 Tryptophan dimethylallyltransferase 2 OS=Claviceps purpurea (strain 20.1) GN=dmaW2 PE=3 SV=1 63 407 6.0E-30
sp|Q6X2E2|DMAW1_EPICN Tryptophan dimethylallyltransferase 1 OS=Epichloe coenophiala GN=dmaW1 PE=3 SV=1 58 448 6.0E-30
sp|Q6X1E1|DMAW_BALOB Tryptophan dimethylallyltransferase OS=Balansia obtecta GN=dmaW PE=3 SV=1 62 414 2.0E-29
sp|P0CT20|DMAW1_CLAPU Tryptophan dimethylallyltransferase 1 OS=Claviceps purpurea GN=dmaW1 PE=1 SV=1 63 407 6.0E-29
sp|Q50EL0|DMAW_ASPFU Tryptophan dimethylallyltransferase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=fgaPT2 PE=1 SV=2 55 407 2.0E-28
sp|Q6X2E3|DMAW_EPINE Tryptophan dimethylallyltransferase OS=Epichloe typhina x Neotyphodium lolii GN=dmaW PE=3 SV=1 52 446 7.0E-28
sp|Q6X2E1|DMAW2_EPICN Tryptophan dimethylallyltransferase 2 OS=Epichloe coenophiala GN=dmaW2 PE=3 SV=1 52 446 7.0E-28
sp|Q12594|DMAW_CLAFS Tryptophan dimethylallyltransferase OS=Claviceps fusiformis GN=dmaW PE=1 SV=1 58 406 9.0E-25
sp|Q4WZ67|FGPT1_ASPFU Fumigaclavine A dimethylallyltransferase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=fgaPT1 PE=1 SV=1 63 388 1.0E-24
sp|I4AY86|BREPT_ASPVE Brevianamide F reverse prenyltransferase OS=Aspergillus versicolor GN=brePT PE=1 SV=1 72 460 1.0E-21
sp|Q4WAW7|FTMB_ASPFU Tryprostatin B synthase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=ftmPT1 PE=1 SV=2 55 343 1.0E-21
sp|B9WZX3|FTMB_ASPFM Tryprostatin B synthase OS=Neosartorya fumigata GN=ftmPT1 PE=3 SV=1 55 343 1.0E-21
sp|A1DA62|FTMB_NEOFI Tryprostatin B synthase OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=ftmPT1 PE=3 SV=2 55 343 7.0E-21
sp|A1DA66|FTMH_NEOFI 12-alpha,13-alpha-dihydroxyfumitremorgin C prenyltransferase OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=ftmPT2 PE=3 SV=1 63 346 5.0E-19
sp|Q4WAX1|FTMH_ASPFU 12-alpha,13-alpha-dihydroxyfumitremorgin C prenyltransferase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=ftmPT2 PE=3 SV=1 63 346 4.0E-16
sp|B9WZX7|FTMH_ASPFM 12-alpha,13-alpha-dihydroxyfumitremorgin C prenyltransferase OS=Neosartorya fumigata GN=ftmPT2 PE=1 SV=1 63 346 8.0E-16
sp|A1DJ20|FTMT3_NEOFI Verruculogen prenyltransferase OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=ftmPT3 PE=1 SV=1 63 458 2.0E-11
[Show less]

GO

GO Term Description Terminal node
GO:0009820 alkaloid metabolic process Yes
GO:0016765 transferase activity, transferring alkyl or aryl (other than methyl) groups Yes
GO:0003824 catalytic activity No
GO:0006807 nitrogen compound metabolic process No
GO:0003674 molecular_function No
GO:0008152 metabolic process No
GO:0008150 biological_process No
GO:0071704 organic substance metabolic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0016740 transferase activity No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

Gene cluster ID Type of secondary metabolism gene
Cluster 22 DMAT

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup924
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis map64 (Brazil) OphauB2|4297 (this protein)
Ophiocordyceps camponoti-floridani Ophcf2|01146
Ophiocordyceps camponoti-floridani Ophcf2|05445
Ophiocordyceps camponoti-rufipedis Ophun1|5184
Ophiocordyceps camponoti-rufipedis Ophun1|85
Ophiocordyceps kimflemingae Ophio5|7676
Ophiocordyceps subramaniannii Hirsu2|6418
Ophiocordyceps subramaniannii Hirsu2|6419

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|4297
MSQTLHEESPELQLGRYQLALSGLGKSLGDPERRKHDAKITRYFNYPVELSVWQRVNSELDGFESVHHRFWWSRH
TGKALAILLYHAQYPADLQYRNLRFFAEAVAPHLGACPEILGSHGQMWPSFMTDDGTPVEISWDWGTKNSPPMIR
YSVEPIGLHAGTSIDPGNLIAGPAFQERLARSLPTMRLEWFHHFKDFFSMSNVKQGEFDEDIRDHNSSIFYAFDC
SETDIIPKVYFFPKWRAKVSGQSNLNVLFQAMRAAPHVTDENFKAGDMFYAFCSSAGSRLLEHEMLAIDLIDPLR
SRLKIYFRSRETSFNSVINIMTLGGRIRNPKRCESLVELHRLWNALFGVSDAVDEPLRHVEHRTAGILYNVEFRL
GEALPVAKIYLPVRHYSASDEAVICGLNDYFQDGQRGKYMPDYIKAMTTLFTPKSMREGSGVQTYVGCAIRPDGS
LRVISYFKPQELAHLLESEAAS*
Coding >OphauB2|4297
ATGTCTCAGACTTTGCATGAAGAAAGCCCCGAACTACAACTCGGGCGCTATCAATTAGCCTTGAGTGGCCTTGGC
AAATCACTCGGAGACCCTGAACGTCGAAAACATGACGCGAAAATCACTCGCTACTTCAACTACCCGGTTGAGCTT
TCGGTCTGGCAACGCGTCAACTCGGAGCTCGACGGCTTTGAGAGCGTCCACCATCGCTTCTGGTGGAGTCGCCAT
ACTGGAAAAGCCCTAGCTATTCTCCTGTATCATGCCCAGTATCCAGCAGACTTGCAGTATCGGAACCTGAGGTTT
TTTGCTGAAGCCGTGGCTCCGCATCTCGGCGCTTGTCCGGAAATCTTGGGCAGCCATGGACAAATGTGGCCGAGC
TTCATGACTGATGATGGGACTCCTGTCGAGATAAGCTGGGACTGGGGCACAAAGAACTCACCACCAATGATTCGA
TACTCGGTAGAGCCCATTGGGCTGCATGCAGGCACCTCTATTGACCCCGGAAACTTGATTGCTGGACCAGCCTTT
CAAGAGCGGCTGGCTCGCTCACTGCCGACTATGAGATTGGAGTGGTTTCATCATTTCAAAGACTTTTTTAGCATG
TCCAACGTCAAGCAAGGCGAGTTTGATGAGGATATCCGAGACCACAACTCTAGCATCTTTTACGCCTTTGACTGT
TCAGAAACCGACATCATACCAAAAGTCTACTTCTTCCCCAAGTGGAGAGCAAAAGTATCCGGCCAGTCGAACCTA
AATGTCCTCTTCCAAGCCATGCGCGCCGCTCCCCACGTTACGGATGAAAACTTCAAGGCTGGTGACATGTTTTAC
GCCTTTTGCTCCAGCGCGGGCAGCAGACTGCTAGAACACGAGATGCTCGCCATTGATCTCATTGATCCGCTGCGG
TCCCGGCTCAAGATTTATTTCCGCTCGCGCGAGACAAGCTTCAACTCTGTCATCAACATCATGACGCTCGGAGGC
CGGATCCGAAACCCCAAGCGGTGCGAGAGCCTGGTTGAGCTTCACAGGCTTTGGAATGCGCTCTTTGGTGTATCC
GACGCGGTGGATGAGCCTCTGCGCCATGTTGAGCATCGCACCGCGGGAATACTCTACAATGTCGAGTTTAGGCTC
GGCGAGGCATTGCCCGTGGCCAAGATTTATCTCCCCGTTCGGCATTACTCTGCAAGCGACGAGGCTGTCATTTGT
GGCTTGAACGACTACTTTCAAGACGGGCAAAGGGGCAAGTACATGCCCGACTACATCAAGGCCATGACTACACTA
TTTACTCCAAAGTCAATGAGAGAAGGCTCAGGCGTGCAGACCTATGTTGGGTGTGCGATTCGGCCAGATGGCTCA
CTAAGGGTGATTTCCTACTTTAAGCCCCAGGAACTAGCACACTTGTTGGAATCCGAGGCGGCTTCATAG
Transcript >OphauB2|4297
ATGTCTCAGACTTTGCATGAAGAAAGCCCCGAACTACAACTCGGGCGCTATCAATTAGCCTTGAGTGGCCTTGGC
AAATCACTCGGAGACCCTGAACGTCGAAAACATGACGCGAAAATCACTCGCTACTTCAACTACCCGGTTGAGCTT
TCGGTCTGGCAACGCGTCAACTCGGAGCTCGACGGCTTTGAGAGCGTCCACCATCGCTTCTGGTGGAGTCGCCAT
ACTGGAAAAGCCCTAGCTATTCTCCTGTATCATGCCCAGTATCCAGCAGACTTGCAGTATCGGAACCTGAGGTTT
TTTGCTGAAGCCGTGGCTCCGCATCTCGGCGCTTGTCCGGAAATCTTGGGCAGCCATGGACAAATGTGGCCGAGC
TTCATGACTGATGATGGGACTCCTGTCGAGATAAGCTGGGACTGGGGCACAAAGAACTCACCACCAATGATTCGA
TACTCGGTAGAGCCCATTGGGCTGCATGCAGGCACCTCTATTGACCCCGGAAACTTGATTGCTGGACCAGCCTTT
CAAGAGCGGCTGGCTCGCTCACTGCCGACTATGAGATTGGAGTGGTTTCATCATTTCAAAGACTTTTTTAGCATG
TCCAACGTCAAGCAAGGCGAGTTTGATGAGGATATCCGAGACCACAACTCTAGCATCTTTTACGCCTTTGACTGT
TCAGAAACCGACATCATACCAAAAGTCTACTTCTTCCCCAAGTGGAGAGCAAAAGTATCCGGCCAGTCGAACCTA
AATGTCCTCTTCCAAGCCATGCGCGCCGCTCCCCACGTTACGGATGAAAACTTCAAGGCTGGTGACATGTTTTAC
GCCTTTTGCTCCAGCGCGGGCAGCAGACTGCTAGAACACGAGATGCTCGCCATTGATCTCATTGATCCGCTGCGG
TCCCGGCTCAAGATTTATTTCCGCTCGCGCGAGACAAGCTTCAACTCTGTCATCAACATCATGACGCTCGGAGGC
CGGATCCGAAACCCCAAGCGGTGCGAGAGCCTGGTTGAGCTTCACAGGCTTTGGAATGCGCTCTTTGGTGTATCC
GACGCGGTGGATGAGCCTCTGCGCCATGTTGAGCATCGCACCGCGGGAATACTCTACAATGTCGAGTTTAGGCTC
GGCGAGGCATTGCCCGTGGCCAAGATTTATCTCCCCGTTCGGCATTACTCTGCAAGCGACGAGGCTGTCATTTGT
GGCTTGAACGACTACTTTCAAGACGGGCAAAGGGGCAAGTACATGCCCGACTACATCAAGGCCATGACTACACTA
TTTACTCCAAAGTCAATGAGAGAAGGCTCAGGCGTGCAGACCTATGTTGGGTGTGCGATTCGGCCAGATGGCTCA
CTAAGGGTGATTTCCTACTTTAAGCCCCAGGAACTAGCACACTTGTTGGAATCCGAGGCGGCTTCATAG
Gene >OphauB2|4297
ATGTCTCAGACTTTGCATGAAGAAAGCCCCGAACTACAACTCGGGCGCTATCAATTAGCCTTGAGTGGCCTTGGC
AAATCACTCGGAGACCCTGAACGTCGAAAACATGACGCGAAAATCACTCGCTACTTCAACTACCCGGTTGAGCTT
TCGGTCTGGCAACGCGTCAACTCGGAGCTCGACGGCTTTGAGAGCGTCCACCATCGCTTCTGGTGGAGTCGCCAT
ACTGGAAAAGCCCTAGCTATTCTCCTGTATCATGCCCAGTATCCAGCAGACTTGCAGTATCGGAACCTGAGGTTT
TTTGCTGAAGCCGTGGCTCCGCATCTCGGCGCTTGTCCGGAAATCTTGGGCAGCCATGGACAAATGTGGCCGAGC
TTCATGACTGATGATGGGACTCCTGTCGAGATAAGCTGGGACTGGGGCACAAAGAACTCACCACCAATGATTCGA
TACTCGGTAGAGCCCATTGGGCTGCATGCAGGCACCTCTATTGACCCCGGAAACTTGATTGCTGGACCAGCCTTT
CAAGAGCGGCTGGCTCGCTCACTGCCGACTATGAGATTGGAGTGGTTTCATCATTTCAAAGACTTTTTTAGCATG
TCCAACGTCAAGCAAGGCGAGTTTGATGAGGATATCCGAGACCACAACTCTAGCATCTTTTACGCCTTTGACTGT
TCAGAAACCGACATCATACCAAAAGTCTACTTCTTCCCCAAGTGGAGAGCAAAAGTATCCGGCCAGTCGAACCTA
AATGTCCTCTTCCAAGCCATGCGCGCCGCTCCCCACGTTACGGATGAAAACTTCAAGGCTGGTGACATGTTTTAC
GCCTTTTGCTCCAGCGCGGGCAGCAGACTGCTAGAACACGAGATGCTCGCCATTGATCTCATTGATCCGCTGCGG
TCCCGGCTCAAGATTTATTTCCGCTCGCGCGAGACAAGCTTCAACTCTGTCATCAACATCATGACGCTCGGAGGC
CGGATCCGAAACCCCAAGCGGTGCGAGAGCCTGGTTGAGCTTCACAGGCTTTGGAATGCGCTCTTTGGTGTATCC
GACGCGGTGGATGAGCCTCTGCGCCATGTTGAGCATCGCACCGCGGGAATACTCTACAATGTCGAGTTTAGGCTC
GGCGAGGCATTGCCCGTGGCCAAGATTTATCTCCCCGTTCGGCATTACTCTGCAAGCGACGAGGCTGTCATTTGT
GGCTTGAACGACTACTTTCAAGACGGGCAAAGGGGCAAGTACATGCCCGACTACATCAAGGCCATGACTACACTA
TTGTGAGTTTTTTTTCCAATGCGAGTTTTATTTGCAGTTATTCGCTGGGGGAAATTCTACTAAGACATCTTGCAG
TACTCCAAAGTCAATGAGAGAAGGCTCAGGCGTGCAGACCTATGTTGGGTGTGCGATTCGGCCAGATGGCTCACT
AAGGGTGATTTCCTACTTTAAGCCCCAGGAACTAGCACACTTGTTGGAATCCGAGGCGGCTTCATAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail