Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|4297
Gene name
LocationContig_29:24722..26214
Strand-
Gene length (bp)1492
Transcript length (bp)1419
Coding sequence length (bp)1419
Protein length (aa) 473

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF11991 Trp_DMAT Tryptophan dimethylallyltransferase 2.5E-92 68 420

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q6Q874|SIRD_LEPMC 4-O-dimethylallyl-L-tyrosine synthase OS=Leptosphaeria maculans GN=sirD PE=1 SV=1 50 460 1.0E-57
sp|Q4WYG3|7DMAW_ASPFU 7-dimethylallyltryptophan synthase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=etpPT PE=1 SV=2 70 458 3.0E-45
sp|M1WA41|DMAW1_CLAP2 Tryptophan dimethylallyltransferase 1 OS=Claviceps purpurea (strain 20.1) GN=dmaW1 PE=3 SV=1 63 407 4.0E-30
sp|Q9C141|DMAW2_CLAP2 Tryptophan dimethylallyltransferase 2 OS=Claviceps purpurea (strain 20.1) GN=dmaW2 PE=3 SV=1 63 407 6.0E-30
sp|Q6X2E2|DMAW1_EPICN Tryptophan dimethylallyltransferase 1 OS=Epichloe coenophiala GN=dmaW1 PE=3 SV=1 58 448 6.0E-30
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q6Q874|SIRD_LEPMC 4-O-dimethylallyl-L-tyrosine synthase OS=Leptosphaeria maculans GN=sirD PE=1 SV=1 50 460 1.0E-57
sp|Q4WYG3|7DMAW_ASPFU 7-dimethylallyltryptophan synthase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=etpPT PE=1 SV=2 70 458 3.0E-45
sp|M1WA41|DMAW1_CLAP2 Tryptophan dimethylallyltransferase 1 OS=Claviceps purpurea (strain 20.1) GN=dmaW1 PE=3 SV=1 63 407 4.0E-30
sp|Q9C141|DMAW2_CLAP2 Tryptophan dimethylallyltransferase 2 OS=Claviceps purpurea (strain 20.1) GN=dmaW2 PE=3 SV=1 63 407 6.0E-30
sp|Q6X2E2|DMAW1_EPICN Tryptophan dimethylallyltransferase 1 OS=Epichloe coenophiala GN=dmaW1 PE=3 SV=1 58 448 6.0E-30
sp|Q6X1E1|DMAW_BALOB Tryptophan dimethylallyltransferase OS=Balansia obtecta GN=dmaW PE=3 SV=1 62 414 2.0E-29
sp|P0CT20|DMAW1_CLAPU Tryptophan dimethylallyltransferase 1 OS=Claviceps purpurea GN=dmaW1 PE=1 SV=1 63 407 6.0E-29
sp|Q50EL0|DMAW_ASPFU Tryptophan dimethylallyltransferase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=fgaPT2 PE=1 SV=2 55 407 2.0E-28
sp|Q6X2E3|DMAW_EPINE Tryptophan dimethylallyltransferase OS=Epichloe typhina x Neotyphodium lolii GN=dmaW PE=3 SV=1 52 446 7.0E-28
sp|Q6X2E1|DMAW2_EPICN Tryptophan dimethylallyltransferase 2 OS=Epichloe coenophiala GN=dmaW2 PE=3 SV=1 52 446 7.0E-28
sp|Q12594|DMAW_CLAFS Tryptophan dimethylallyltransferase OS=Claviceps fusiformis GN=dmaW PE=1 SV=1 58 406 9.0E-25
sp|Q4WZ67|FGPT1_ASPFU Fumigaclavine A dimethylallyltransferase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=fgaPT1 PE=1 SV=1 63 388 1.0E-24
sp|I4AY86|BREPT_ASPVE Brevianamide F reverse prenyltransferase OS=Aspergillus versicolor GN=brePT PE=1 SV=1 72 460 1.0E-21
sp|Q4WAW7|FTMB_ASPFU Tryprostatin B synthase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=ftmPT1 PE=1 SV=2 55 343 1.0E-21
sp|B9WZX3|FTMB_ASPFM Tryprostatin B synthase OS=Neosartorya fumigata GN=ftmPT1 PE=3 SV=1 55 343 1.0E-21
sp|A1DA62|FTMB_NEOFI Tryprostatin B synthase OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=ftmPT1 PE=3 SV=2 55 343 7.0E-21
sp|A1DA66|FTMH_NEOFI 12-alpha,13-alpha-dihydroxyfumitremorgin C prenyltransferase OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=ftmPT2 PE=3 SV=1 63 346 5.0E-19
sp|Q4WAX1|FTMH_ASPFU 12-alpha,13-alpha-dihydroxyfumitremorgin C prenyltransferase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=ftmPT2 PE=3 SV=1 63 346 4.0E-16
sp|B9WZX7|FTMH_ASPFM 12-alpha,13-alpha-dihydroxyfumitremorgin C prenyltransferase OS=Neosartorya fumigata GN=ftmPT2 PE=1 SV=1 63 346 8.0E-16
sp|A1DJ20|FTMT3_NEOFI Verruculogen prenyltransferase OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=ftmPT3 PE=1 SV=1 63 458 2.0E-11
[Show less]

GO

GO Term Description Terminal node
GO:0016765 transferase activity, transferring alkyl or aryl (other than methyl) groups Yes
GO:0009820 alkaloid metabolic process Yes
GO:0008150 biological_process No
GO:0071704 organic substance metabolic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0008152 metabolic process No
GO:0003674 molecular_function No
GO:0016740 transferase activity No
GO:0003824 catalytic activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 30 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|4297
MSQTLHEESPELQLGRYQLALSGLGKSLGDPERRKHDAKITRYFNYPVELSVWQRVNSELDGFESVHHRFWWSRH
TGKALAILLYHAQYPADLQYRNLRFFAEAVAPHLGACPEILGSHGQMWPSFMTDDGTPVEISWDWGTKNSPPMIR
YSVEPIGLHAGTSIDPGNLIAGPAFQERLARSLPTMRLEWFHHFKDFFSMSNVKQGEFDEDIRDHNSSIFYAFDC
SETDIIPKVYFFPKWRAKVSGQSNLNVLFQAMRAAPHVTDENFKAGDMFYAFCSSAGSRLLEHEMLAIDLIDPLR
SRLKIYFRSRETSFNSVINIMTLGGRIRNPKRCESLVELHRLWNALFGVSDAVDEPLRHVEHRTAGILYNVEFRL
GEALPVAKIYLPVRHYSASDEAVICGLNDYFQDGQRGKYMPDYIKAMTTLFTPKSMREGSGVQTYVGCAIRPDGS
LRVISYFKPQELAHLLESEAAS*
Coding >OphauB2|4297
ATGTCTCAGACTTTGCATGAAGAAAGCCCCGAACTACAACTCGGGCGCTATCAATTAGCCTTGAGTGGCCTTGGC
AAATCACTCGGAGACCCTGAACGTCGAAAACATGACGCGAAAATCACTCGCTACTTCAACTACCCGGTTGAGCTT
TCGGTCTGGCAACGCGTCAACTCGGAGCTCGACGGCTTTGAGAGCGTCCACCATCGCTTCTGGTGGAGTCGCCAT
ACTGGAAAAGCCCTAGCTATTCTCCTGTATCATGCCCAGTATCCAGCAGACTTGCAGTATCGGAACCTGAGGTTT
TTTGCTGAAGCCGTGGCTCCGCATCTCGGCGCTTGTCCGGAAATCTTGGGCAGCCATGGACAAATGTGGCCGAGC
TTCATGACTGATGATGGGACTCCTGTCGAGATAAGCTGGGACTGGGGCACAAAGAACTCACCACCAATGATTCGA
TACTCGGTAGAGCCCATTGGGCTGCATGCAGGCACCTCTATTGACCCCGGAAACTTGATTGCTGGACCAGCCTTT
CAAGAGCGGCTGGCTCGCTCACTGCCGACTATGAGATTGGAGTGGTTTCATCATTTCAAAGACTTTTTTAGCATG
TCCAACGTCAAGCAAGGCGAGTTTGATGAGGATATCCGAGACCACAACTCTAGCATCTTTTACGCCTTTGACTGT
TCAGAAACCGACATCATACCAAAAGTCTACTTCTTCCCCAAGTGGAGAGCAAAAGTATCCGGCCAGTCGAACCTA
AATGTCCTCTTCCAAGCCATGCGCGCCGCTCCCCACGTTACGGATGAAAACTTCAAGGCTGGTGACATGTTTTAC
GCCTTTTGCTCCAGCGCGGGCAGCAGACTGCTAGAACACGAGATGCTCGCCATTGATCTCATTGATCCGCTGCGG
TCCCGGCTCAAGATTTATTTCCGCTCGCGCGAGACAAGCTTCAACTCTGTCATCAACATCATGACGCTCGGAGGC
CGGATCCGAAACCCCAAGCGGTGCGAGAGCCTGGTTGAGCTTCACAGGCTTTGGAATGCGCTCTTTGGTGTATCC
GACGCGGTGGATGAGCCTCTGCGCCATGTTGAGCATCGCACCGCGGGAATACTCTACAATGTCGAGTTTAGGCTC
GGCGAGGCATTGCCCGTGGCCAAGATTTATCTCCCCGTTCGGCATTACTCTGCAAGCGACGAGGCTGTCATTTGT
GGCTTGAACGACTACTTTCAAGACGGGCAAAGGGGCAAGTACATGCCCGACTACATCAAGGCCATGACTACACTA
TTTACTCCAAAGTCAATGAGAGAAGGCTCAGGCGTGCAGACCTATGTTGGGTGTGCGATTCGGCCAGATGGCTCA
CTAAGGGTGATTTCCTACTTTAAGCCCCAGGAACTAGCACACTTGTTGGAATCCGAGGCGGCTTCATAG
Transcript >OphauB2|4297
ATGTCTCAGACTTTGCATGAAGAAAGCCCCGAACTACAACTCGGGCGCTATCAATTAGCCTTGAGTGGCCTTGGC
AAATCACTCGGAGACCCTGAACGTCGAAAACATGACGCGAAAATCACTCGCTACTTCAACTACCCGGTTGAGCTT
TCGGTCTGGCAACGCGTCAACTCGGAGCTCGACGGCTTTGAGAGCGTCCACCATCGCTTCTGGTGGAGTCGCCAT
ACTGGAAAAGCCCTAGCTATTCTCCTGTATCATGCCCAGTATCCAGCAGACTTGCAGTATCGGAACCTGAGGTTT
TTTGCTGAAGCCGTGGCTCCGCATCTCGGCGCTTGTCCGGAAATCTTGGGCAGCCATGGACAAATGTGGCCGAGC
TTCATGACTGATGATGGGACTCCTGTCGAGATAAGCTGGGACTGGGGCACAAAGAACTCACCACCAATGATTCGA
TACTCGGTAGAGCCCATTGGGCTGCATGCAGGCACCTCTATTGACCCCGGAAACTTGATTGCTGGACCAGCCTTT
CAAGAGCGGCTGGCTCGCTCACTGCCGACTATGAGATTGGAGTGGTTTCATCATTTCAAAGACTTTTTTAGCATG
TCCAACGTCAAGCAAGGCGAGTTTGATGAGGATATCCGAGACCACAACTCTAGCATCTTTTACGCCTTTGACTGT
TCAGAAACCGACATCATACCAAAAGTCTACTTCTTCCCCAAGTGGAGAGCAAAAGTATCCGGCCAGTCGAACCTA
AATGTCCTCTTCCAAGCCATGCGCGCCGCTCCCCACGTTACGGATGAAAACTTCAAGGCTGGTGACATGTTTTAC
GCCTTTTGCTCCAGCGCGGGCAGCAGACTGCTAGAACACGAGATGCTCGCCATTGATCTCATTGATCCGCTGCGG
TCCCGGCTCAAGATTTATTTCCGCTCGCGCGAGACAAGCTTCAACTCTGTCATCAACATCATGACGCTCGGAGGC
CGGATCCGAAACCCCAAGCGGTGCGAGAGCCTGGTTGAGCTTCACAGGCTTTGGAATGCGCTCTTTGGTGTATCC
GACGCGGTGGATGAGCCTCTGCGCCATGTTGAGCATCGCACCGCGGGAATACTCTACAATGTCGAGTTTAGGCTC
GGCGAGGCATTGCCCGTGGCCAAGATTTATCTCCCCGTTCGGCATTACTCTGCAAGCGACGAGGCTGTCATTTGT
GGCTTGAACGACTACTTTCAAGACGGGCAAAGGGGCAAGTACATGCCCGACTACATCAAGGCCATGACTACACTA
TTTACTCCAAAGTCAATGAGAGAAGGCTCAGGCGTGCAGACCTATGTTGGGTGTGCGATTCGGCCAGATGGCTCA
CTAAGGGTGATTTCCTACTTTAAGCCCCAGGAACTAGCACACTTGTTGGAATCCGAGGCGGCTTCATAG
Gene >OphauB2|4297
ATGTCTCAGACTTTGCATGAAGAAAGCCCCGAACTACAACTCGGGCGCTATCAATTAGCCTTGAGTGGCCTTGGC
AAATCACTCGGAGACCCTGAACGTCGAAAACATGACGCGAAAATCACTCGCTACTTCAACTACCCGGTTGAGCTT
TCGGTCTGGCAACGCGTCAACTCGGAGCTCGACGGCTTTGAGAGCGTCCACCATCGCTTCTGGTGGAGTCGCCAT
ACTGGAAAAGCCCTAGCTATTCTCCTGTATCATGCCCAGTATCCAGCAGACTTGCAGTATCGGAACCTGAGGTTT
TTTGCTGAAGCCGTGGCTCCGCATCTCGGCGCTTGTCCGGAAATCTTGGGCAGCCATGGACAAATGTGGCCGAGC
TTCATGACTGATGATGGGACTCCTGTCGAGATAAGCTGGGACTGGGGCACAAAGAACTCACCACCAATGATTCGA
TACTCGGTAGAGCCCATTGGGCTGCATGCAGGCACCTCTATTGACCCCGGAAACTTGATTGCTGGACCAGCCTTT
CAAGAGCGGCTGGCTCGCTCACTGCCGACTATGAGATTGGAGTGGTTTCATCATTTCAAAGACTTTTTTAGCATG
TCCAACGTCAAGCAAGGCGAGTTTGATGAGGATATCCGAGACCACAACTCTAGCATCTTTTACGCCTTTGACTGT
TCAGAAACCGACATCATACCAAAAGTCTACTTCTTCCCCAAGTGGAGAGCAAAAGTATCCGGCCAGTCGAACCTA
AATGTCCTCTTCCAAGCCATGCGCGCCGCTCCCCACGTTACGGATGAAAACTTCAAGGCTGGTGACATGTTTTAC
GCCTTTTGCTCCAGCGCGGGCAGCAGACTGCTAGAACACGAGATGCTCGCCATTGATCTCATTGATCCGCTGCGG
TCCCGGCTCAAGATTTATTTCCGCTCGCGCGAGACAAGCTTCAACTCTGTCATCAACATCATGACGCTCGGAGGC
CGGATCCGAAACCCCAAGCGGTGCGAGAGCCTGGTTGAGCTTCACAGGCTTTGGAATGCGCTCTTTGGTGTATCC
GACGCGGTGGATGAGCCTCTGCGCCATGTTGAGCATCGCACCGCGGGAATACTCTACAATGTCGAGTTTAGGCTC
GGCGAGGCATTGCCCGTGGCCAAGATTTATCTCCCCGTTCGGCATTACTCTGCAAGCGACGAGGCTGTCATTTGT
GGCTTGAACGACTACTTTCAAGACGGGCAAAGGGGCAAGTACATGCCCGACTACATCAAGGCCATGACTACACTA
TTGTGAGTTTTTTTTCCAATGCGAGTTTTATTTGCAGTTATTCGCTGGGGGAAATTCTACTAAGACATCTTGCAG
TACTCCAAAGTCAATGAGAGAAGGCTCAGGCGTGCAGACCTATGTTGGGTGTGCGATTCGGCCAGATGGCTCACT
AAGGGTGATTTCCTACTTTAAGCCCCAGGAACTAGCACACTTGTTGGAATCCGAGGCGGCTTCATAG

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail