Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|4296
Gene name
LocationContig_29:22859..23385
Strand-
Gene length (bp)526
Transcript length (bp)342
Coding sequence length (bp)342
Protein length (aa) 114

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00221 Lyase_aromatic Aromatic amino acid lyase 2.9E-15 33 107

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|A8AZ70|HUTH_STRGC Histidine ammonia-lyase OS=Streptococcus gordonii (strain Challis / ATCC 35105 / CH1 / DL1 / V288) GN=hutH PE=3 SV=1 28 102 3.0E-09
sp|A3CL24|HUTH_STRSV Histidine ammonia-lyase OS=Streptococcus sanguinis (strain SK36) GN=hutH PE=3 SV=2 28 102 3.0E-09
sp|P58083|HUTH_STRP1 Histidine ammonia-lyase OS=Streptococcus pyogenes serotype M1 GN=hutH PE=3 SV=1 28 102 5.0E-09
sp|P0DB75|HUTH_STRPQ Histidine ammonia-lyase OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=hutH PE=3 SV=1 28 102 7.0E-09
sp|P0DB74|HUTH_STRP3 Histidine ammonia-lyase OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=hutH PE=3 SV=1 28 102 7.0E-09
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|A8AZ70|HUTH_STRGC Histidine ammonia-lyase OS=Streptococcus gordonii (strain Challis / ATCC 35105 / CH1 / DL1 / V288) GN=hutH PE=3 SV=1 28 102 3.0E-09
sp|A3CL24|HUTH_STRSV Histidine ammonia-lyase OS=Streptococcus sanguinis (strain SK36) GN=hutH PE=3 SV=2 28 102 3.0E-09
sp|P58083|HUTH_STRP1 Histidine ammonia-lyase OS=Streptococcus pyogenes serotype M1 GN=hutH PE=3 SV=1 28 102 5.0E-09
sp|P0DB75|HUTH_STRPQ Histidine ammonia-lyase OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=hutH PE=3 SV=1 28 102 7.0E-09
sp|P0DB74|HUTH_STRP3 Histidine ammonia-lyase OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=hutH PE=3 SV=1 28 102 7.0E-09
sp|Q5X9K4|HUTH_STRP6 Histidine ammonia-lyase OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=hutH PE=3 SV=2 28 102 7.0E-09
sp|Q8NZ46|HUTH_STRP8 Histidine ammonia-lyase OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=hutH PE=3 SV=1 28 102 2.0E-08
sp|A2RGS5|HUTH_STRPG Histidine ammonia-lyase OS=Streptococcus pyogenes serotype M5 (strain Manfredo) GN=hutH PE=3 SV=1 28 102 2.0E-08
sp|B5XIY2|HUTH_STRPZ Histidine ammonia-lyase OS=Streptococcus pyogenes serotype M49 (strain NZ131) GN=hutH PE=3 SV=1 28 102 3.0E-08
sp|Q5L310|HUTH_GEOKA Histidine ammonia-lyase OS=Geobacillus kaustophilus (strain HTA426) GN=hutH PE=3 SV=1 26 112 5.0E-08
sp|P52777|PALY_PINTA Phenylalanine ammonia-lyase OS=Pinus taeda GN=PAL PE=3 SV=1 10 105 1.0E-07
sp|P11544|PALY_RHOTO Phenylalanine/tyrosine ammonia-lyase OS=Rhodosporidium toruloides GN=PAL PE=1 SV=2 10 103 3.0E-07
sp|Q5WAZ6|HUTH_BACSK Histidine ammonia-lyase OS=Bacillus clausii (strain KSM-K16) GN=hutH PE=3 SV=1 26 101 3.0E-07
sp|P10248|PALY_RHOMI Phenylalanine ammonia-lyase OS=Rhodotorula mucilaginosa GN=PAL PE=3 SV=2 26 103 7.0E-07
sp|Q73Q56|HUTH_TREDE Histidine ammonia-lyase OS=Treponema denticola (strain ATCC 35405 / CIP 103919 / DSM 14222) GN=hutH PE=3 SV=1 26 113 1.0E-06
sp|Q96V77|PALY_USTMA Phenylalanine ammonia-lyase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=PAL1 PE=3 SV=2 4 92 2.0E-06
sp|O23865|PAL1_DAUCA Phenylalanine ammonia-lyase 1 OS=Daucus carota GN=PAL1 PE=3 SV=1 26 105 4.0E-06
sp|P27990|PALY_MEDSA Phenylalanine ammonia-lyase OS=Medicago sativa PE=2 SV=1 26 105 5.0E-06
sp|Q9M568|PAL1_RUBID Phenylalanine ammonia-lyase 1 OS=Rubus idaeus GN=PAL1 PE=2 SV=1 12 105 5.0E-06
sp|P35510|PAL1_ARATH Phenylalanine ammonia-lyase 1 OS=Arabidopsis thaliana GN=PAL1 PE=1 SV=3 26 105 5.0E-06
sp|P27991|PAL1_SOYBN Phenylalanine ammonia-lyase 1 OS=Glycine max GN=PAL1 PE=3 SV=1 26 105 6.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 17 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|4296
MNHSDIILRQWESLEALICAKDSATVLLTGRTLSIPDVIAVARYNVSSDIDVSAIKAMEMSQGLLEQRMRSGDVI
YGVNTGFGGSADLRTKNLIELQRALIRELHYASSSSFP*
Coding >OphauB2|4296
ATGAATCACTCGGATATTATCCTAAGGCAGTGGGAGTCCCTAGAGGCTCTAATCTGCGCAAAGGACTCGGCCACA
GTTTTACTTACAGGACGCACGCTAAGTATCCCAGATGTCATAGCTGTCGCGCGTTACAATGTGTCATCAGATATC
GATGTGTCTGCTATCAAGGCTATGGAAATGAGCCAGGGCCTGCTTGAACAAAGAATGCGCTCTGGGGATGTCATC
TATGGGGTGAATACCGGGTTTGGAGGCTCTGCCGACCTCCGGACCAAGAACCTCATTGAATTGCAGCGGGCACTC
ATCCGAGAGCTTCACTATGCATCGTCATCATCTTTCCCTTGA
Transcript >OphauB2|4296
ATGAATCACTCGGATATTATCCTAAGGCAGTGGGAGTCCCTAGAGGCTCTAATCTGCGCAAAGGACTCGGCCACA
GTTTTACTTACAGGACGCACGCTAAGTATCCCAGATGTCATAGCTGTCGCGCGTTACAATGTGTCATCAGATATC
GATGTGTCTGCTATCAAGGCTATGGAAATGAGCCAGGGCCTGCTTGAACAAAGAATGCGCTCTGGGGATGTCATC
TATGGGGTGAATACCGGGTTTGGAGGCTCTGCCGACCTCCGGACCAAGAACCTCATTGAATTGCAGCGGGCACTC
ATCCGAGAGCTTCACTATGCATCGTCATCATCTTTCCCTTGA
Gene >OphauB2|4296
ATGAATCACTCGGATATTATCCTAAGGCAGTGGGAGTCCCTAGAGGCTCTAATCTGCGCAAAGGACTCGGCCACA
GTTTTACTTACAGGACGCACGCTAAGTATCCCAGATGTCATAGCTGTCGCGCGGTGGGTTGGCCTCCTCATTGTC
TATCAGGCACTCAAGTATACCTTTATCTAATTAAAAATTATAGTTACAATGTGTCATCAGATATCGATGTGTCTG
CTATCAAGGCTATGGAAATGAGCCAGGGCCTGCTTGAACAAAGAATGCGCTCTGGGGATGTCATCTATGGTGCGC
GCTTATTGATAGTGACCATTTATGCCTTGGGCTAATTTTTTGTGGCCACAGGGGTGAATACCGGGTTTGGAGGCT
CTGCCGACCTCCGGACCAAGAACCTCATTGAATTGCAGCGGGCACTCATCCGAGAGCTTCACTATGGTATTCTAC
CAGCAGGGGAGAGAGACCACCGTCCTTTGCCGCTCCAAGAGAGCTTAGCCAAGCATCGTCATCATCTTTCCCTTG
A

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail