Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|4293
Gene name
LocationContig_29:13595..15125
Strand-
Gene length (bp)1530
Transcript length (bp)1530
Coding sequence length (bp)1530
Protein length (aa) 510

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01375 Enterotoxin_a Heat-labile enterotoxin alpha chain 1.3E-07 42 206
PF01375 Enterotoxin_a Heat-labile enterotoxin alpha chain 5.9E-07 254 402

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P01555|CHTA_VIBCH Cholera enterotoxin subunit A OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=ctxA PE=1 SV=1 40 175 2.0E-06

GO

GO Term Description Terminal node
GO:0090729 toxin activity Yes
GO:0005615 extracellular space Yes
GO:0110165 cellular anatomical entity No
GO:0003674 molecular_function No
GO:0005575 cellular_component No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 27 0.45

Transmembrane Domains

Domain # Start End Length
1 7 29 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|4293
MIFSRFANVAAPASLLCLFWLGYGNASIVPHAPNAVMRRAPDDFVYRGDTRGPDKVRPDGGFQPSGYYWNNPSAF
NIHRHVRGDPVFMPRSGSSSGESNSLRRSRCSSSSSCPDWADAYVSTAVLANEAAIFAYPDEDGNFGYLYRIHIT
PNMLTVQSQHEREVAALGGIPWSAVSAYTQLRSRDEEFPSVIPESRWTENPDFDPEWNRFSTAMTASTLLEGPDA
MTTAITLMDRPSIGGPMGWSGQFPLFGDHHFVYRGDARSPQEIAQDGGFQPQGDGWQNQGSAFHFDRHYAAGPNG
CGLEESGNSGFVFRTAYVTLEQDRDVAETQGSWLYEIRATPNMIDDNNPETDVFALGGVHWSQIRRYTNMTGNPG
ERHRVDEAAWINNPNYDAATYQRGESAVFARVNGNFPEVLRNGNTDSGGSDGPSCDRDRRAMAAARNFMTHTRGM
RDLYGPFPPRFSRYPAIDGIPGPGPPPPPETVDAQGKKNSFSQKTMQKHPHYSSCANNC*
Coding >OphauB2|4293
ATGATATTTTCACGGTTTGCCAATGTGGCCGCTCCAGCATCACTACTATGTCTTTTCTGGCTCGGTTATGGAAAT
GCTAGCATCGTACCACACGCACCCAACGCGGTGATGCGCCGCGCACCGGATGACTTTGTCTACCGCGGAGACACA
AGAGGTCCAGATAAAGTTCGCCCGGATGGTGGCTTTCAACCCTCAGGCTACTATTGGAACAACCCGTCAGCCTTC
AACATTCACCGACATGTAAGGGGTGATCCTGTATTTATGCCCAGGTCAGGCAGCAGCAGCGGAGAGTCGAATTCG
CTGCGACGGTCAAGGTGTTCTTCTTCCAGTTCCTGCCCAGATTGGGCCGACGCCTATGTGTCAACGGCAGTTTTG
GCCAACGAGGCAGCCATTTTTGCCTATCCAGACGAGGATGGCAATTTTGGATACTTGTACCGGATTCATATTACG
CCGAATATGCTCACAGTACAAAGCCAACATGAACGCGAAGTGGCTGCCCTAGGAGGTATCCCTTGGTCGGCAGTA
TCGGCTTACACACAGCTTAGAAGCCGAGATGAAGAGTTTCCCAGTGTCATTCCAGAGAGCCGGTGGACAGAAAAC
CCCGACTTTGACCCCGAATGGAATAGGTTTTCCACAGCCATGACCGCGTCTACTCTCTTGGAGGGGCCCGACGCC
ATGACCACAGCCATAACCTTGATGGACCGGCCCAGCATTGGTGGCCCCATGGGTTGGAGTGGGCAGTTCCCGCTG
TTTGGCGATCATCATTTCGTCTACCGTGGAGATGCAAGAAGCCCTCAAGAAATAGCACAAGACGGCGGATTCCAG
CCTCAAGGCGACGGCTGGCAAAACCAAGGATCGGCATTCCATTTCGATCGACACTATGCTGCGGGTCCTAATGGT
TGCGGATTAGAAGAGTCTGGCAACTCTGGCTTCGTCTTTCGAACTGCCTATGTTACACTGGAACAAGACAGAGAC
GTGGCGGAAACTCAAGGCTCCTGGCTCTACGAGATTCGTGCCACGCCAAACATGATTGATGACAATAATCCTGAA
ACAGACGTTTTTGCTCTGGGCGGTGTTCACTGGTCGCAAATTAGGAGATATACAAACATGACGGGGAATCCAGGG
GAGCGTCACAGAGTCGATGAAGCTGCTTGGATCAACAATCCAAACTACGACGCTGCAACATACCAACGGGGCGAA
TCTGCCGTTTTTGCTCGCGTCAATGGAAACTTTCCAGAAGTATTAAGAAATGGCAATACAGACTCTGGCGGCTCT
GATGGCCCGAGCTGCGACCGGGACCGTCGCGCAATGGCAGCAGCACGTAATTTCATGACCCATACCAGGGGTATG
CGTGATCTTTATGGCCCTTTTCCGCCCCGCTTCTCGCGATACCCAGCTATAGACGGTATTCCCGGACCAGGTCCC
CCACCTCCCCCCGAAACTGTGGATGCGCAGGGTAAGAAGAACTCCTTTTCGCAAAAGACTATGCAAAAGCATCCT
CATTACAGCAGTTGCGCTAACAATTGTTAA
Transcript >OphauB2|4293
ATGATATTTTCACGGTTTGCCAATGTGGCCGCTCCAGCATCACTACTATGTCTTTTCTGGCTCGGTTATGGAAAT
GCTAGCATCGTACCACACGCACCCAACGCGGTGATGCGCCGCGCACCGGATGACTTTGTCTACCGCGGAGACACA
AGAGGTCCAGATAAAGTTCGCCCGGATGGTGGCTTTCAACCCTCAGGCTACTATTGGAACAACCCGTCAGCCTTC
AACATTCACCGACATGTAAGGGGTGATCCTGTATTTATGCCCAGGTCAGGCAGCAGCAGCGGAGAGTCGAATTCG
CTGCGACGGTCAAGGTGTTCTTCTTCCAGTTCCTGCCCAGATTGGGCCGACGCCTATGTGTCAACGGCAGTTTTG
GCCAACGAGGCAGCCATTTTTGCCTATCCAGACGAGGATGGCAATTTTGGATACTTGTACCGGATTCATATTACG
CCGAATATGCTCACAGTACAAAGCCAACATGAACGCGAAGTGGCTGCCCTAGGAGGTATCCCTTGGTCGGCAGTA
TCGGCTTACACACAGCTTAGAAGCCGAGATGAAGAGTTTCCCAGTGTCATTCCAGAGAGCCGGTGGACAGAAAAC
CCCGACTTTGACCCCGAATGGAATAGGTTTTCCACAGCCATGACCGCGTCTACTCTCTTGGAGGGGCCCGACGCC
ATGACCACAGCCATAACCTTGATGGACCGGCCCAGCATTGGTGGCCCCATGGGTTGGAGTGGGCAGTTCCCGCTG
TTTGGCGATCATCATTTCGTCTACCGTGGAGATGCAAGAAGCCCTCAAGAAATAGCACAAGACGGCGGATTCCAG
CCTCAAGGCGACGGCTGGCAAAACCAAGGATCGGCATTCCATTTCGATCGACACTATGCTGCGGGTCCTAATGGT
TGCGGATTAGAAGAGTCTGGCAACTCTGGCTTCGTCTTTCGAACTGCCTATGTTACACTGGAACAAGACAGAGAC
GTGGCGGAAACTCAAGGCTCCTGGCTCTACGAGATTCGTGCCACGCCAAACATGATTGATGACAATAATCCTGAA
ACAGACGTTTTTGCTCTGGGCGGTGTTCACTGGTCGCAAATTAGGAGATATACAAACATGACGGGGAATCCAGGG
GAGCGTCACAGAGTCGATGAAGCTGCTTGGATCAACAATCCAAACTACGACGCTGCAACATACCAACGGGGCGAA
TCTGCCGTTTTTGCTCGCGTCAATGGAAACTTTCCAGAAGTATTAAGAAATGGCAATACAGACTCTGGCGGCTCT
GATGGCCCGAGCTGCGACCGGGACCGTCGCGCAATGGCAGCAGCACGTAATTTCATGACCCATACCAGGGGTATG
CGTGATCTTTATGGCCCTTTTCCGCCCCGCTTCTCGCGATACCCAGCTATAGACGGTATTCCCGGACCAGGTCCC
CCACCTCCCCCCGAAACTGTGGATGCGCAGGGTAAGAAGAACTCCTTTTCGCAAAAGACTATGCAAAAGCATCCT
CATTACAGCAGTTGCGCTAACAATTGTTAA
Gene >OphauB2|4293
ATGATATTTTCACGGTTTGCCAATGTGGCCGCTCCAGCATCACTACTATGTCTTTTCTGGCTCGGTTATGGAAAT
GCTAGCATCGTACCACACGCACCCAACGCGGTGATGCGCCGCGCACCGGATGACTTTGTCTACCGCGGAGACACA
AGAGGTCCAGATAAAGTTCGCCCGGATGGTGGCTTTCAACCCTCAGGCTACTATTGGAACAACCCGTCAGCCTTC
AACATTCACCGACATGTAAGGGGTGATCCTGTATTTATGCCCAGGTCAGGCAGCAGCAGCGGAGAGTCGAATTCG
CTGCGACGGTCAAGGTGTTCTTCTTCCAGTTCCTGCCCAGATTGGGCCGACGCCTATGTGTCAACGGCAGTTTTG
GCCAACGAGGCAGCCATTTTTGCCTATCCAGACGAGGATGGCAATTTTGGATACTTGTACCGGATTCATATTACG
CCGAATATGCTCACAGTACAAAGCCAACATGAACGCGAAGTGGCTGCCCTAGGAGGTATCCCTTGGTCGGCAGTA
TCGGCTTACACACAGCTTAGAAGCCGAGATGAAGAGTTTCCCAGTGTCATTCCAGAGAGCCGGTGGACAGAAAAC
CCCGACTTTGACCCCGAATGGAATAGGTTTTCCACAGCCATGACCGCGTCTACTCTCTTGGAGGGGCCCGACGCC
ATGACCACAGCCATAACCTTGATGGACCGGCCCAGCATTGGTGGCCCCATGGGTTGGAGTGGGCAGTTCCCGCTG
TTTGGCGATCATCATTTCGTCTACCGTGGAGATGCAAGAAGCCCTCAAGAAATAGCACAAGACGGCGGATTCCAG
CCTCAAGGCGACGGCTGGCAAAACCAAGGATCGGCATTCCATTTCGATCGACACTATGCTGCGGGTCCTAATGGT
TGCGGATTAGAAGAGTCTGGCAACTCTGGCTTCGTCTTTCGAACTGCCTATGTTACACTGGAACAAGACAGAGAC
GTGGCGGAAACTCAAGGCTCCTGGCTCTACGAGATTCGTGCCACGCCAAACATGATTGATGACAATAATCCTGAA
ACAGACGTTTTTGCTCTGGGCGGTGTTCACTGGTCGCAAATTAGGAGATATACAAACATGACGGGGAATCCAGGG
GAGCGTCACAGAGTCGATGAAGCTGCTTGGATCAACAATCCAAACTACGACGCTGCAACATACCAACGGGGCGAA
TCTGCCGTTTTTGCTCGCGTCAATGGAAACTTTCCAGAAGTATTAAGAAATGGCAATACAGACTCTGGCGGCTCT
GATGGCCCGAGCTGCGACCGGGACCGTCGCGCAATGGCAGCAGCACGTAATTTCATGACCCATACCAGGGGTATG
CGTGATCTTTATGGCCCTTTTCCGCCCCGCTTCTCGCGATACCCAGCTATAGACGGTATTCCCGGACCAGGTCCC
CCACCTCCCCCCGAAACTGTGGATGCGCAGGGTAAGAAGAACTCCTTTTCGCAAAAGACTATGCAAAAGCATCCT
CATTACAGCAGTTGCGCTAACAATTGTTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail