Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|4284
Gene name
LocationContig_288:8475..9228
Strand-
Gene length (bp)753
Transcript length (bp)414
Coding sequence length (bp)414
Protein length (aa) 138

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01230 HIT HIT domain 1.2E-21 15 104
PF11969 DcpS_C Scavenger mRNA decapping enzyme C-term binding 1.2E-09 13 111
PF04677 CwfJ_C_1 Protein similar to CwfJ C-terminus 1 2.3E-05 32 107

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O94586|HNT1_SCHPO Hit family protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=hnt1 PE=3 SV=1 9 137 7.0E-43
sp|Q04344|HNT1_YEAST Hit family protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HNT1 PE=1 SV=2 4 117 1.0E-40
sp|Q58276|Y866_METJA Uncharacterized HIT-like protein MJ0866 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ0866 PE=3 SV=2 14 126 7.0E-23
sp|O07513|HIT_BACSU Protein hit OS=Bacillus subtilis (strain 168) GN=hit PE=1 SV=1 14 137 1.0E-17
sp|P9WML1|YHI2_MYCTU Uncharacterized HIT-like protein Rv1262c OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv1262c PE=3 SV=1 14 106 2.0E-17
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O94586|HNT1_SCHPO Hit family protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=hnt1 PE=3 SV=1 9 137 7.0E-43
sp|Q04344|HNT1_YEAST Hit family protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HNT1 PE=1 SV=2 4 117 1.0E-40
sp|Q58276|Y866_METJA Uncharacterized HIT-like protein MJ0866 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ0866 PE=3 SV=2 14 126 7.0E-23
sp|O07513|HIT_BACSU Protein hit OS=Bacillus subtilis (strain 168) GN=hit PE=1 SV=1 14 137 1.0E-17
sp|P9WML1|YHI2_MYCTU Uncharacterized HIT-like protein Rv1262c OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv1262c PE=3 SV=1 14 106 2.0E-17
sp|P9WML0|YHI2_MYCTO Uncharacterized HIT-like protein MT1300 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT1300 PE=3 SV=1 14 106 2.0E-17
sp|P94252|YHIT_BORBU Uncharacterized HIT-like protein BB_0379 OS=Borrelia burgdorferi (strain ATCC 35210 / B31 / CIP 102532 / DSM 4680) GN=BB_0379 PE=3 SV=1 16 137 5.0E-17
sp|P64382|YHIT_HELPY Uncharacterized HIT-like protein HP_0404 OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=HP_0404 PE=1 SV=1 14 102 5.0E-13
sp|P64383|YHIT_HELPJ Uncharacterized HIT-like protein jhp_0977 OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=jhp_0977 PE=3 SV=1 14 102 5.0E-13
sp|P47378|YHIT_MYCGE Uncharacterized HIT-like protein MG132 OS=Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195) GN=MG132 PE=3 SV=1 9 135 7.0E-13
sp|P32083|YHIT_MYCHR Uncharacterized 13.1 kDa HIT-like protein in P37 5'region OS=Mycoplasma hyorhinis PE=3 SV=1 16 103 2.0E-12
sp|P75504|YHIT_MYCPN Uncharacterized 16.1 kDa HIT-like protein OS=Mycoplasma pneumoniae (strain ATCC 29342 / M129) GN=MPN_273 PE=3 SV=1 6 124 1.0E-11
sp|C4LYI2|HIT_ENTHI Histidine triad nucleotide-binding protein OS=Entamoeba histolytica GN=EHI_093910 PE=1 SV=1 9 102 7.0E-11
sp|P26724|YHIT_AZOBR Uncharacterized 13.2 kDa HIT-like protein in hisE 3'region OS=Azospirillum brasilense PE=3 SV=1 14 102 1.0E-10
sp|O66536|YHIT_AQUAE Uncharacterized HIT-like protein aq_141 OS=Aquifex aeolicus (strain VF5) GN=aq_141 PE=3 SV=1 13 116 4.0E-10
sp|P95937|YHIT_SULSO Uncharacterized HIT-like protein SSO2163 OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=SSO2163 PE=3 SV=1 22 103 1.0E-09
sp|P32084|Y1390_SYNE7 Uncharacterized HIT-like protein Synpcc7942_1390 OS=Synechococcus elongatus (strain PCC 7942) GN=Synpcc7942_1390 PE=3 SV=1 1 116 2.0E-09
sp|P80912|HINT1_RABIT Histidine triad nucleotide-binding protein 1 OS=Oryctolagus cuniculus GN=HINT1 PE=1 SV=2 16 116 4.0E-09
sp|Q5RF69|HINT1_PONAB Histidine triad nucleotide-binding protein 1 OS=Pongo abelii GN=HINT1 PE=2 SV=3 16 116 4.0E-09
sp|P62959|HINT1_RAT Histidine triad nucleotide-binding protein 1 OS=Rattus norvegicus GN=Hint1 PE=1 SV=5 16 116 5.0E-09
sp|P70349|HINT1_MOUSE Histidine triad nucleotide-binding protein 1 OS=Mus musculus GN=Hint1 PE=1 SV=3 16 116 5.0E-09
sp|P49773|HINT1_HUMAN Histidine triad nucleotide-binding protein 1 OS=Homo sapiens GN=HINT1 PE=1 SV=2 16 116 7.0E-09
sp|O07817|HITA_NEIGO Protein HitA OS=Neisseria gonorrhoeae GN=hitA PE=3 SV=1 9 105 1.0E-08
sp|P42856|ZB14_MAIZE 14 kDa zinc-binding protein OS=Zea mays GN=ZBP14 PE=1 SV=1 16 116 2.0E-08
sp|P53795|HINT_CAEEL Histidine triad nucleotide-binding protein 1 OS=Caenorhabditis elegans GN=hint-1 PE=3 SV=1 16 116 3.0E-08
sp|P62958|HINT1_BOVIN Histidine triad nucleotide-binding protein 1 OS=Bos taurus GN=HINT1 PE=1 SV=2 16 116 4.0E-08
sp|Q23921|PKIA_DICDI Protein pkiA OS=Dictyostelium discoideum GN=pkiA PE=1 SV=2 14 116 5.0E-08
sp|Q8SQ21|HINT2_BOVIN Histidine triad nucleotide-binding protein 2, mitochondrial OS=Bos taurus GN=HINT2 PE=2 SV=1 17 116 6.0E-08
sp|Q9Z863|YHIT_CHLPN HIT-like protein CPn_0488/CP_0266/CPj0488/CpB0508 OS=Chlamydia pneumoniae GN=CPn_0488 PE=3 SV=1 15 102 2.0E-07
sp|P42855|ZB14_BRAJU 14 kDa zinc-binding protein (Fragment) OS=Brassica juncea PE=2 SV=1 14 116 2.0E-07
sp|P49776|APH1_SCHPO Bis(5'-nucleosyl)-tetraphosphatase [asymmetrical] OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=aph1 PE=1 SV=2 12 104 4.0E-07
sp|O76463|NFT1_CAEEL Nitrilase and fragile histidine triad fusion protein NitFhit OS=Caenorhabditis elegans GN=nft-1 PE=1 SV=1 8 104 5.0E-07
sp|P73481|YHIT_SYNY3 Uncharacterized HIT-like protein slr1234 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=slr1234 PE=3 SV=1 16 116 3.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0003824 catalytic activity Yes
GO:0003674 molecular_function No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup6108
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4834
Ophiocordyceps australis map64 (Brazil) OphauB2|4284 (this protein)
Ophiocordyceps camponoti-floridani Ophcf2|01779
Ophiocordyceps kimflemingae Ophio5|4979
Ophiocordyceps subramaniannii Hirsu2|3593

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|4284
MASDAYIGLVDFASGEIPCMKLFESDKTLAFLDIGPISKGHALVIPKYHGAKLVDVPDEHLTEILPILKKLVRAT
GATDYNILQNNGTLAHQQVHHVHFHMIPKPNETEGLGIGWPATSNGDMKQLQSLCDDIKSNM*
Coding >OphauB2|4284
ATGGCTAGTGATGCTTACATCGGGCTCGTCGACTTTGCATCAGGCGAGATTCCCTGCATGAAGTTATTTGAGAGC
GACAAGACTCTTGCCTTTCTTGACATCGGTCCCATTAGCAAAGGACATGCTCTTGTCATTCCCAAGTATCACGGA
GCCAAACTTGTCGATGTCCCCGATGAGCATTTGACCGAAATATTGCCAATTCTTAAAAAGCTTGTTCGCGCCACA
GGTGCCACCGATTACAATATATTACAGAATAACGGTACCCTCGCGCATCAGCAAGTTCATCATGTTCATTTCCAC
ATGATTCCCAAGCCAAACGAGACGGAAGGACTAGGGATCGGTTGGCCAGCCACTAGCAACGGCGACATGAAACAA
CTTCAAAGCCTGTGCGACGATATCAAATCTAACATGTAA
Transcript >OphauB2|4284
ATGGCTAGTGATGCTTACATCGGGCTCGTCGACTTTGCATCAGGCGAGATTCCCTGCATGAAGTTATTTGAGAGC
GACAAGACTCTTGCCTTTCTTGACATCGGTCCCATTAGCAAAGGACATGCTCTTGTCATTCCCAAGTATCACGGA
GCCAAACTTGTCGATGTCCCCGATGAGCATTTGACCGAAATATTGCCAATTCTTAAAAAGCTTGTTCGCGCCACA
GGTGCCACCGATTACAATATATTACAGAATAACGGTACCCTCGCGCATCAGCAAGTTCATCATGTTCATTTCCAC
ATGATTCCCAAGCCAAACGAGACGGAAGGACTAGGGATCGGTTGGCCAGCCACTAGCAACGGCGACATGAAACAA
CTTCAAAGCCTGTGCGACGATATCAAATCTAACATGTAA
Gene >OphauB2|4284
ATGGCTAGTGATGCTTACATCGGGCTCGTCGACTTTGCATCAGGCGAGATTCCCTGCATGAAGTTATTTGAGAGC
GACAAGACTCTTGCCTTTCTTGACATCGGTCCCATTAGCAAAGGACATGCTGTATGTCTAGACTCTTGTCTCTCC
ATCTTGGCCTTCAAGCCATAATCAAAAGCCAAGGCCATGTCAATTTGATATCGCGCTAATATTCGTCTCGCAGCT
TGTCATTCCCAAGTATCACGGAGCCAAACTTGTCGATGTCCCCGATGAGCATTTGACCGAAATATTGGTGAGATT
CTCTTCTCATCAACATCCGCAAGGCCCATCTAGCTTTCCAAGGGGATGCTCATGGTCGAATGGCTCCTATACAGC
CAATTCTTAAAAAGCTTGTTCGCGCCACAGGTGCCACCGATTACAATATATTACAGAATAACGGTACCCTCGCGC
ATCAGCAAGTTCATCATGTAAGCGATATCTCGAACTTGAGATGTGACGAAAGATAGTTCAGGAGATATTCCTACT
AGACAAACAGGCTAACGAGGATATTTTTCATCCAGGTTCATTTCCACATGGTATGAATTCCTTATACTTCTGACG
CTATTTCACTAGCTTTTGCACTCACGTTTTTAATTCAATCAGATTCCCAAGCCAAACGAGACGGAAGGACTAGGG
ATCGGTTGGCCAGCCACTAGCAACGGCGACATGAAACAACTTCAAAGCCTGTGCGACGATATCAAATCTAACATG
TAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail