Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|4284
Gene name
LocationContig_288:8475..9228
Strand-
Gene length (bp)753
Transcript length (bp)414
Coding sequence length (bp)414
Protein length (aa) 138

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01230 HIT HIT domain 1.2E-21 15 104
PF11969 DcpS_C Scavenger mRNA decapping enzyme C-term binding 1.2E-09 13 111
PF04677 CwfJ_C_1 Protein similar to CwfJ C-terminus 1 2.3E-05 32 107

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O94586|HNT1_SCHPO Hit family protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=hnt1 PE=3 SV=1 9 137 7.0E-43
sp|Q04344|HNT1_YEAST Hit family protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HNT1 PE=1 SV=2 4 117 1.0E-40
sp|Q58276|Y866_METJA Uncharacterized HIT-like protein MJ0866 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ0866 PE=3 SV=2 14 126 7.0E-23
sp|O07513|HIT_BACSU Protein hit OS=Bacillus subtilis (strain 168) GN=hit PE=1 SV=1 14 137 1.0E-17
sp|P9WML1|YHI2_MYCTU Uncharacterized HIT-like protein Rv1262c OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv1262c PE=3 SV=1 14 106 2.0E-17
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O94586|HNT1_SCHPO Hit family protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=hnt1 PE=3 SV=1 9 137 7.0E-43
sp|Q04344|HNT1_YEAST Hit family protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HNT1 PE=1 SV=2 4 117 1.0E-40
sp|Q58276|Y866_METJA Uncharacterized HIT-like protein MJ0866 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ0866 PE=3 SV=2 14 126 7.0E-23
sp|O07513|HIT_BACSU Protein hit OS=Bacillus subtilis (strain 168) GN=hit PE=1 SV=1 14 137 1.0E-17
sp|P9WML1|YHI2_MYCTU Uncharacterized HIT-like protein Rv1262c OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv1262c PE=3 SV=1 14 106 2.0E-17
sp|P9WML0|YHI2_MYCTO Uncharacterized HIT-like protein MT1300 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT1300 PE=3 SV=1 14 106 2.0E-17
sp|P94252|YHIT_BORBU Uncharacterized HIT-like protein BB_0379 OS=Borrelia burgdorferi (strain ATCC 35210 / B31 / CIP 102532 / DSM 4680) GN=BB_0379 PE=3 SV=1 16 137 5.0E-17
sp|P64382|YHIT_HELPY Uncharacterized HIT-like protein HP_0404 OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=HP_0404 PE=1 SV=1 14 102 5.0E-13
sp|P64383|YHIT_HELPJ Uncharacterized HIT-like protein jhp_0977 OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=jhp_0977 PE=3 SV=1 14 102 5.0E-13
sp|P47378|YHIT_MYCGE Uncharacterized HIT-like protein MG132 OS=Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195) GN=MG132 PE=3 SV=1 9 135 7.0E-13
sp|P32083|YHIT_MYCHR Uncharacterized 13.1 kDa HIT-like protein in P37 5'region OS=Mycoplasma hyorhinis PE=3 SV=1 16 103 2.0E-12
sp|P75504|YHIT_MYCPN Uncharacterized 16.1 kDa HIT-like protein OS=Mycoplasma pneumoniae (strain ATCC 29342 / M129) GN=MPN_273 PE=3 SV=1 6 124 1.0E-11
sp|C4LYI2|HIT_ENTHI Histidine triad nucleotide-binding protein OS=Entamoeba histolytica GN=EHI_093910 PE=1 SV=1 9 102 7.0E-11
sp|P26724|YHIT_AZOBR Uncharacterized 13.2 kDa HIT-like protein in hisE 3'region OS=Azospirillum brasilense PE=3 SV=1 14 102 1.0E-10
sp|O66536|YHIT_AQUAE Uncharacterized HIT-like protein aq_141 OS=Aquifex aeolicus (strain VF5) GN=aq_141 PE=3 SV=1 13 116 4.0E-10
sp|P95937|YHIT_SULSO Uncharacterized HIT-like protein SSO2163 OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=SSO2163 PE=3 SV=1 22 103 1.0E-09
sp|P32084|Y1390_SYNE7 Uncharacterized HIT-like protein Synpcc7942_1390 OS=Synechococcus elongatus (strain PCC 7942) GN=Synpcc7942_1390 PE=3 SV=1 1 116 2.0E-09
sp|P80912|HINT1_RABIT Histidine triad nucleotide-binding protein 1 OS=Oryctolagus cuniculus GN=HINT1 PE=1 SV=2 16 116 4.0E-09
sp|Q5RF69|HINT1_PONAB Histidine triad nucleotide-binding protein 1 OS=Pongo abelii GN=HINT1 PE=2 SV=3 16 116 4.0E-09
sp|P62959|HINT1_RAT Histidine triad nucleotide-binding protein 1 OS=Rattus norvegicus GN=Hint1 PE=1 SV=5 16 116 5.0E-09
sp|P70349|HINT1_MOUSE Histidine triad nucleotide-binding protein 1 OS=Mus musculus GN=Hint1 PE=1 SV=3 16 116 5.0E-09
sp|P49773|HINT1_HUMAN Histidine triad nucleotide-binding protein 1 OS=Homo sapiens GN=HINT1 PE=1 SV=2 16 116 7.0E-09
sp|O07817|HITA_NEIGO Protein HitA OS=Neisseria gonorrhoeae GN=hitA PE=3 SV=1 9 105 1.0E-08
sp|P42856|ZB14_MAIZE 14 kDa zinc-binding protein OS=Zea mays GN=ZBP14 PE=1 SV=1 16 116 2.0E-08
sp|P53795|HINT_CAEEL Histidine triad nucleotide-binding protein 1 OS=Caenorhabditis elegans GN=hint-1 PE=3 SV=1 16 116 3.0E-08
sp|P62958|HINT1_BOVIN Histidine triad nucleotide-binding protein 1 OS=Bos taurus GN=HINT1 PE=1 SV=2 16 116 4.0E-08
sp|Q23921|PKIA_DICDI Protein pkiA OS=Dictyostelium discoideum GN=pkiA PE=1 SV=2 14 116 5.0E-08
sp|Q8SQ21|HINT2_BOVIN Histidine triad nucleotide-binding protein 2, mitochondrial OS=Bos taurus GN=HINT2 PE=2 SV=1 17 116 6.0E-08
sp|Q9Z863|YHIT_CHLPN HIT-like protein CPn_0488/CP_0266/CPj0488/CpB0508 OS=Chlamydia pneumoniae GN=CPn_0488 PE=3 SV=1 15 102 2.0E-07
sp|P42855|ZB14_BRAJU 14 kDa zinc-binding protein (Fragment) OS=Brassica juncea PE=2 SV=1 14 116 2.0E-07
sp|P49776|APH1_SCHPO Bis(5'-nucleosyl)-tetraphosphatase [asymmetrical] OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=aph1 PE=1 SV=2 12 104 4.0E-07
sp|O76463|NFT1_CAEEL Nitrilase and fragile histidine triad fusion protein NitFhit OS=Caenorhabditis elegans GN=nft-1 PE=1 SV=1 8 104 5.0E-07
sp|P73481|YHIT_SYNY3 Uncharacterized HIT-like protein slr1234 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=slr1234 PE=3 SV=1 16 116 3.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0003824 catalytic activity Yes
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 16 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|4284
MASDAYIGLVDFASGEIPCMKLFESDKTLAFLDIGPISKGHALVIPKYHGAKLVDVPDEHLTEILPILKKLVRAT
GATDYNILQNNGTLAHQQVHHVHFHMIPKPNETEGLGIGWPATSNGDMKQLQSLCDDIKSNM*
Coding >OphauB2|4284
ATGGCTAGTGATGCTTACATCGGGCTCGTCGACTTTGCATCAGGCGAGATTCCCTGCATGAAGTTATTTGAGAGC
GACAAGACTCTTGCCTTTCTTGACATCGGTCCCATTAGCAAAGGACATGCTCTTGTCATTCCCAAGTATCACGGA
GCCAAACTTGTCGATGTCCCCGATGAGCATTTGACCGAAATATTGCCAATTCTTAAAAAGCTTGTTCGCGCCACA
GGTGCCACCGATTACAATATATTACAGAATAACGGTACCCTCGCGCATCAGCAAGTTCATCATGTTCATTTCCAC
ATGATTCCCAAGCCAAACGAGACGGAAGGACTAGGGATCGGTTGGCCAGCCACTAGCAACGGCGACATGAAACAA
CTTCAAAGCCTGTGCGACGATATCAAATCTAACATGTAA
Transcript >OphauB2|4284
ATGGCTAGTGATGCTTACATCGGGCTCGTCGACTTTGCATCAGGCGAGATTCCCTGCATGAAGTTATTTGAGAGC
GACAAGACTCTTGCCTTTCTTGACATCGGTCCCATTAGCAAAGGACATGCTCTTGTCATTCCCAAGTATCACGGA
GCCAAACTTGTCGATGTCCCCGATGAGCATTTGACCGAAATATTGCCAATTCTTAAAAAGCTTGTTCGCGCCACA
GGTGCCACCGATTACAATATATTACAGAATAACGGTACCCTCGCGCATCAGCAAGTTCATCATGTTCATTTCCAC
ATGATTCCCAAGCCAAACGAGACGGAAGGACTAGGGATCGGTTGGCCAGCCACTAGCAACGGCGACATGAAACAA
CTTCAAAGCCTGTGCGACGATATCAAATCTAACATGTAA
Gene >OphauB2|4284
ATGGCTAGTGATGCTTACATCGGGCTCGTCGACTTTGCATCAGGCGAGATTCCCTGCATGAAGTTATTTGAGAGC
GACAAGACTCTTGCCTTTCTTGACATCGGTCCCATTAGCAAAGGACATGCTGTATGTCTAGACTCTTGTCTCTCC
ATCTTGGCCTTCAAGCCATAATCAAAAGCCAAGGCCATGTCAATTTGATATCGCGCTAATATTCGTCTCGCAGCT
TGTCATTCCCAAGTATCACGGAGCCAAACTTGTCGATGTCCCCGATGAGCATTTGACCGAAATATTGGTGAGATT
CTCTTCTCATCAACATCCGCAAGGCCCATCTAGCTTTCCAAGGGGATGCTCATGGTCGAATGGCTCCTATACAGC
CAATTCTTAAAAAGCTTGTTCGCGCCACAGGTGCCACCGATTACAATATATTACAGAATAACGGTACCCTCGCGC
ATCAGCAAGTTCATCATGTAAGCGATATCTCGAACTTGAGATGTGACGAAAGATAGTTCAGGAGATATTCCTACT
AGACAAACAGGCTAACGAGGATATTTTTCATCCAGGTTCATTTCCACATGGTATGAATTCCTTATACTTCTGACG
CTATTTCACTAGCTTTTGCACTCACGTTTTTAATTCAATCAGATTCCCAAGCCAAACGAGACGGAAGGACTAGGG
ATCGGTTGGCCAGCCACTAGCAACGGCGACATGAAACAACTTCAAAGCCTGTGCGACGATATCAAATCTAACATG
TAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail