Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|4276
Gene name
LocationContig_286:5304..8702
Strand-
Gene length (bp)3398
Transcript length (bp)3321
Coding sequence length (bp)3321
Protein length (aa) 1107

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13426 PAS_9 PAS domain 1.5E-18 435 548
PF13426 PAS_9 PAS domain 9.0E-01 636 721
PF13426 PAS_9 PAS domain 8.4E-01 754 819
PF08447 PAS_3 PAS fold 8.2E-11 640 715
PF00320 GATA GATA zinc finger 1.4E-14 961 994
PF00989 PAS PAS fold 3.1E-05 622 725

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9ST27|PHOT2_ORYSJ Phototropin-2 OS=Oryza sativa subsp. japonica GN=PHOT2 PE=1 SV=1 435 559 3.0E-21
sp|P93025|PHOT2_ARATH Phototropin-2 OS=Arabidopsis thaliana GN=PHOT2 PE=1 SV=2 435 559 9.0E-20
sp|Q2NB77|LVHK2_ERYLH Blue-light-activated histidine kinase 2 OS=Erythrobacter litoralis (strain HTCC2594) GN=ELI_04860 PE=1 SV=1 434 560 1.0E-19
sp|Q9ST27|PHOT2_ORYSJ Phototropin-2 OS=Oryza sativa subsp. japonica GN=PHOT2 PE=1 SV=1 435 546 5.0E-19
sp|P93025|PHOT2_ARATH Phototropin-2 OS=Arabidopsis thaliana GN=PHOT2 PE=1 SV=2 435 546 2.0E-18
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9ST27|PHOT2_ORYSJ Phototropin-2 OS=Oryza sativa subsp. japonica GN=PHOT2 PE=1 SV=1 435 559 3.0E-21
sp|P93025|PHOT2_ARATH Phototropin-2 OS=Arabidopsis thaliana GN=PHOT2 PE=1 SV=2 435 559 9.0E-20
sp|Q2NB77|LVHK2_ERYLH Blue-light-activated histidine kinase 2 OS=Erythrobacter litoralis (strain HTCC2594) GN=ELI_04860 PE=1 SV=1 434 560 1.0E-19
sp|Q9ST27|PHOT2_ORYSJ Phototropin-2 OS=Oryza sativa subsp. japonica GN=PHOT2 PE=1 SV=1 435 546 5.0E-19
sp|P93025|PHOT2_ARATH Phototropin-2 OS=Arabidopsis thaliana GN=PHOT2 PE=1 SV=2 435 546 2.0E-18
sp|Q94BT6|ADO1_ARATH Adagio protein 1 OS=Arabidopsis thaliana GN=ADO1 PE=1 SV=2 433 545 4.0E-18
sp|Q8W420|ADO2_ARATH Adagio protein 2 OS=Arabidopsis thaliana GN=ADO2 PE=1 SV=1 433 559 7.0E-18
sp|Q5Z8K3|ADO1_ORYSJ Adagio-like protein 1 OS=Oryza sativa subsp. japonica GN=Os06g0694000 PE=2 SV=1 433 545 2.0E-17
sp|O48963|PHOT1_ARATH Phototropin-1 OS=Arabidopsis thaliana GN=PHOT1 PE=1 SV=1 435 546 2.0E-17
sp|Q2QYY8|PHT1A_ORYSJ Phototropin-1A OS=Oryza sativa subsp. japonica GN=PHOT1A PE=1 SV=2 435 549 3.0E-17
sp|Q2RBR1|PHT1B_ORYSJ Phototropin-1B OS=Oryza sativa subsp. japonica GN=PHOT1B PE=1 SV=2 435 549 3.0E-17
sp|Q67UX0|ADO2_ORYSJ Putative adagio-like protein 2 OS=Oryza sativa subsp. japonica GN=Os02g0150800 PE=3 SV=1 432 545 2.0E-16
sp|Q9C9W9|ADO3_ARATH Adagio protein 3 OS=Arabidopsis thaliana GN=ADO3 PE=1 SV=1 434 545 3.0E-16
sp|Q2NCA3|LVHK1_ERYLH Blue-light-activated histidine kinase 1 OS=Erythrobacter litoralis (strain HTCC2594) GN=ELI_02980 PE=1 SV=1 433 550 7.0E-16
sp|O64511|TLOV1_ARATH Protein TWIN LOV 1 OS=Arabidopsis thaliana GN=TLP1 PE=1 SV=2 424 546 1.0E-15
sp|Q2R2W1|ADO3_ORYSJ Adagio-like protein 3 OS=Oryza sativa subsp. japonica GN=Os11g0547000 PE=2 SV=2 435 545 3.0E-15
sp|O48963|PHOT1_ARATH Phototropin-1 OS=Arabidopsis thaliana GN=PHOT1 PE=1 SV=1 435 547 2.0E-14
sp|P58724|PHOT_LISMO Blue-light photoreceptor OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=lmo0799 PE=3 SV=1 432 547 2.0E-14
sp|Q2QYY8|PHT1A_ORYSJ Phototropin-1A OS=Oryza sativa subsp. japonica GN=PHOT1A PE=1 SV=2 435 547 3.0E-14
sp|Q92DM1|PHOT_LISIN Blue-light photoreceptor OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=lin0792 PE=3 SV=1 432 547 3.0E-14
sp|Q2RBR1|PHT1B_ORYSJ Phototropin-1B OS=Oryza sativa subsp. japonica GN=PHOT1B PE=1 SV=2 435 547 4.0E-14
sp|Q4ZSY3|LOVHK_PSEU2 Blue-light-activated protein OS=Pseudomonas syringae pv. syringae (strain B728a) GN=Psyr_2700 PE=3 SV=1 424 553 5.0E-14
sp|A6X554|LOVHK_OCHA4 Blue-light-activated histidine kinase OS=Ochrobactrum anthropi (strain ATCC 49188 / DSM 6882 / NCTC 12168) GN=Oant_3652 PE=3 SV=1 427 547 6.0E-14
sp|Q48IV1|LOVHK_PSE14 Blue-light-activated protein OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=PSPPH_2483 PE=3 SV=2 424 553 1.0E-13
sp|Q881J7|LOVHK_PSESM Blue-light-activated protein OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=PSPTO_2896 PE=1 SV=1 424 553 3.0E-13
sp|Q1M667|LOVHK_RHIL3 Blue-light-activated histidine kinase OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=lov PE=1 SV=1 436 549 1.0E-12
sp|Q2NB98|LVHTH_ERYLH Light-activated DNA-binding protein EL222 OS=Erythrobacter litoralis (strain HTCC2594) GN=ELI_04755 PE=1 SV=1 434 547 2.0E-12
sp|O34627|PHOT_BACSU Blue-light photoreceptor OS=Bacillus subtilis (strain 168) GN=pfyP PE=1 SV=1 436 549 3.0E-12
sp|Q9HPU8|BAT_HALSA Bacterioopsin transcriptional activator OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=bat PE=1 SV=1 435 549 8.0E-12
sp|O64511|TLOV1_ARATH Protein TWIN LOV 1 OS=Arabidopsis thaliana GN=TLP1 PE=1 SV=2 435 558 2.0E-10
sp|O89047|KCNH3_RAT Potassium voltage-gated channel subfamily H member 3 OS=Rattus norvegicus GN=Kcnh3 PE=2 SV=1 446 549 3.0E-10
sp|Q9WVJ0|KCNH3_MOUSE Potassium voltage-gated channel subfamily H member 3 OS=Mus musculus GN=Kcnh3 PE=2 SV=2 446 549 3.0E-10
sp|Q9ULD8|KCNH3_HUMAN Potassium voltage-gated channel subfamily H member 3 OS=Homo sapiens GN=KCNH3 PE=1 SV=2 446 549 3.0E-10
sp|Q55C49|GTAG_DICDI GATA zinc finger domain-containing protein 7 OS=Dictyostelium discoideum GN=gtaG PE=3 SV=1 945 993 1.0E-09
sp|B0G188|GTAP_DICDI GATA zinc finger domain-containing protein 16 OS=Dictyostelium discoideum GN=gtaP PE=3 SV=1 945 992 2.0E-09
sp|Q75JZ0|GTAH_DICDI GATA zinc finger domain-containing protein 8 OS=Dictyostelium discoideum GN=gtaH PE=3 SV=1 944 996 2.0E-09
sp|Q54NM5|GTAL_DICDI GATA zinc finger domain-containing protein 12 OS=Dictyostelium discoideum GN=gtaL PE=3 SV=1 940 1002 6.0E-09
sp|Q6QPM2|GAT19_ARATH GATA transcription factor 19 OS=Arabidopsis thaliana GN=GATA19 PE=2 SV=2 957 1006 7.0E-09
sp|Q00858|CGPB_FUSSO Cutinase gene palindrome-binding protein OS=Fusarium solani subsp. pisi PE=2 SV=1 947 1003 1.0E-08
sp|Q55GK0|GTAE_DICDI GATA zinc finger domain-containing protein 5 OS=Dictyostelium discoideum GN=gtaE PE=3 SV=1 947 993 2.0E-08
sp|A9MBM8|LOVHK_BRUC2 Blue-light-activated histidine kinase OS=Brucella canis (strain ATCC 23365 / NCTC 10854) GN=BCAN_B0589 PE=3 SV=2 444 547 3.0E-08
sp|Q9ZPX0|GAT20_ARATH GATA transcription factor 20 OS=Arabidopsis thaliana GN=GATA20 PE=2 SV=2 944 1001 3.0E-08
sp|A5VUS1|LOVHK_BRUO2 Blue-light-activated histidine kinase OS=Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512) GN=BOV_A0554 PE=3 SV=2 444 547 3.0E-08
sp|B2SB67|LOVHK_BRUA1 Blue-light-activated histidine kinase OS=Brucella abortus (strain S19) GN=BAbS19_II06090 PE=3 SV=1 444 547 3.0E-08
sp|Q2YKK7|LOVHK_BRUA2 Blue-light-activated histidine kinase OS=Brucella abortus (strain 2308) GN=BAB2_0652 PE=1 SV=2 444 547 3.0E-08
sp|Q577Y7|LOVHK_BRUAB Blue-light-activated histidine kinase OS=Brucella abortus biovar 1 (strain 9-941) GN=BruAb2_0636 PE=3 SV=2 444 547 3.0E-08
sp|Q8YC53|LOVHK_BRUME Blue-light-activated histidine kinase OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=BMEII0679 PE=1 SV=1 444 547 3.0E-08
sp|A9WYQ7|LOVHK_BRUSI Blue-light-activated histidine kinase OS=Brucella suis (strain ATCC 23445 / NCTC 10510) GN=BSUIS_B0585 PE=3 SV=2 444 547 3.0E-08
sp|Q8FW73|LOVHK_BRUSU Blue-light-activated histidine kinase OS=Brucella suis biovar 1 (strain 1330) GN=BRA0588 PE=3 SV=2 444 547 3.0E-08
sp|P78714|WC2_NEUCR White collar 2 protein OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=wc-2 PE=1 SV=1 615 752 4.0E-08
sp|Q9R1T9|KCNH4_RAT Potassium voltage-gated channel subfamily H member 4 OS=Rattus norvegicus GN=Kcnh4 PE=2 SV=1 446 541 6.0E-08
sp|P78714|WC2_NEUCR White collar 2 protein OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=wc-2 PE=1 SV=1 946 991 7.0E-08
sp|Q9UQ05|KCNH4_HUMAN Potassium voltage-gated channel subfamily H member 4 OS=Homo sapiens GN=KCNH4 PE=2 SV=1 446 541 7.0E-08
sp|Q54TE3|GTAJ_DICDI GATA zinc finger domain-containing protein 10 OS=Dictyostelium discoideum GN=gtaJ PE=3 SV=1 933 998 1.0E-07
sp|Q6DBP8|GAT11_ARATH GATA transcription factor 11 OS=Arabidopsis thaliana GN=GATA11 PE=2 SV=1 957 999 2.0E-07
sp|Q8VZP4|GAT10_ARATH GATA transcription factor 10 OS=Arabidopsis thaliana GN=GATA10 PE=2 SV=1 957 999 3.0E-07
sp|Q54TM6|GTAI_DICDI GATA zinc finger domain-containing protein 9 OS=Dictyostelium discoideum GN=gtaI PE=3 SV=1 949 996 4.0E-07
sp|Q8L4M6|GATA3_ARATH GATA transcription factor 3 OS=Arabidopsis thaliana GN=GATA3 PE=2 SV=2 947 1031 5.0E-07
sp|Q5KSV0|GTAK_DICDI GATA zinc finger domain-containing protein 11 OS=Dictyostelium discoideum GN=gtaK PE=2 SV=1 951 996 1.0E-06
sp|Q9M1U2|GAT14_ARATH GATA transcription factor 14 OS=Arabidopsis thaliana GN=GATA14 PE=2 SV=1 959 1040 1.0E-06
sp|Q8LC79|GAT18_ARATH GATA transcription factor 18 OS=Arabidopsis thaliana GN=GATA18 PE=2 SV=2 957 998 2.0E-06
sp|Q75JZ1|GTAC_DICDI GATA zinc finger domain-containing protein 3 OS=Dictyostelium discoideum GN=gtaC PE=3 SV=1 961 1006 2.0E-06
sp|Q9SZI6|GAT22_ARATH Putative GATA transcription factor 22 OS=Arabidopsis thaliana GN=GATA22 PE=3 SV=1 943 989 2.0E-06
sp|Q9LT45|GAT29_ARATH GATA transcription factor 29 OS=Arabidopsis thaliana GN=GATA29 PE=2 SV=1 963 1001 2.0E-06
sp|Q10280|GAF1_SCHPO Transcription factor gaf1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gaf1 PE=1 SV=2 950 999 6.0E-06
sp|Q8LAU9|GATA1_ARATH GATA transcription factor 1 OS=Arabidopsis thaliana GN=GATA1 PE=2 SV=2 937 1045 6.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0043565 sequence-specific DNA binding Yes
GO:0006355 regulation of transcription, DNA-templated Yes
GO:0097159 organic cyclic compound binding No
GO:0010468 regulation of gene expression No
GO:0008150 biological_process No
GO:0005488 binding No
GO:0003674 molecular_function No
GO:0009889 regulation of biosynthetic process No
GO:0010556 regulation of macromolecule biosynthetic process No
GO:0060255 regulation of macromolecule metabolic process No
GO:0050789 regulation of biological process No
GO:0031323 regulation of cellular metabolic process No
GO:0003677 DNA binding No
GO:0065007 biological regulation No
GO:0051171 regulation of nitrogen compound metabolic process No
GO:2001141 regulation of RNA biosynthetic process No
GO:1901363 heterocyclic compound binding No
GO:0050794 regulation of cellular process No
GO:0051252 regulation of RNA metabolic process No
GO:0031326 regulation of cellular biosynthetic process No
GO:0019222 regulation of metabolic process No
GO:0003676 nucleic acid binding No
GO:0080090 regulation of primary metabolic process No
GO:0019219 regulation of nucleobase-containing compound metabolic process No
GO:1903506 regulation of nucleic acid-templated transcription No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 49 0.45

Transmembrane Domains

(None)

Transcription Factor Class

Transcription Factor Class
(based on PFAM domains)
GATA type zinc finger

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|4276
MESYYPQQQLPQEPQHQFNSQQPQEHQQQQQQQQQQQQQQQQELQQRQRQQQQHQQKGEEEQSQRRRRQEPQQKQ
QAEPQQQQASISDAFGVNNRLPAQSQAAASQSTTDRPMMAGDTLDDIIRNNQSEIQRRRSMPQATFGNPTTTTQA
QSPRRVSSIGAADMMSFGSHNADIGSYQFGPAANSGLSNINTTGMDMTDQVGSYMTEAGDYSAISPDLMGSMIPA
SFANMDMGHMSNDSSTMSMFATPAAASSSTASGAGSTPIGNGFSPSQIPSVNTEYPLGATTDAGSMETTPGNVSG
AIATVDDQDDDMMALQPAQFSSMRTTPNSNSTISGSGANLDTNFSRNIQPSLSRRVSSPRCNPSSQHGASSAGLG
QTTSGASNATTPMTTSTPREPKEKTIYSKSGFDMIKALWLVATRKDPRIHLGAVDMSCAFVVCDVTMNDCPIVYV
SDNFQNLTGYSRHEIVGQNCRFLQAPDGKVEAGCKREFVDDGAVYNLKKMIQEGQEVQQSLINYRKGGKPFLNLL
TMIPIPWDTDEIRYFIGFQIDLVECPDAISGQELDGVKVNYKHSEMEQYIWNPPPSSQWEPGDGQTLGVDDVSTL
LQQFNPKGHASDWHKQSWDKMLLENTDDLVHVLSLKGIFLYLSPSCRRVLECDAREMTGTSLSTVCHPSDIVPVT
RELKEATTGNQVNVVFRIRRKQSGYTWFESHGSLFVEQGKGRKCIILVGRKRPVFALSRHHLETNGGIGDSELWT
KLSTSGMFLFVSSNVRSLLDLQPETLVGTSIQELMRKESRPEFGRSIEKARRGKIVTCKHEVQNRRGQGLQAQTI
LYPGDACEGQKPSFLLAQTKLLKASSRNLSTSSAAGSNKSVTATPRGNPQSQTSQGNGQISQPAGGALVPGTQDA
ALASDDNIFDELRTTKCSSWQFELRQMEKVNRILAEELGGLLSNKKKRKRRKGVGNLVRDCANCHTRNTPEWRRG
PSGQRDLCNSCGLRWAKQTGRVSPRNSSRGGNNGNGDSQSKKSASPIHSSPLHREVSSETPNAYGTDGDGAADTV
AMACQGADMGPSTVSNSSLGPKPLSTMPPPSQPSLSGGAPGSAMTSIREESENSQP*
Coding >OphauB2|4276
ATGGAGAGCTACTATCCACAACAGCAGCTACCCCAAGAACCGCAGCATCAATTTAATAGTCAGCAGCCGCAAGAA
CACCAACAACAACAACAACAACAGCAGCAGCAGCAGCAGCAGCAGCAGCAAGAACTACAACAACGACAACGACAA
CAGCAGCAACATCAACAAAAGGGCGAAGAAGAACAAAGCCAGCGGCGTCGACGGCAGGAGCCGCAGCAGAAACAA
CAAGCTGAGCCGCAGCAACAGCAGGCATCAATATCCGACGCCTTTGGTGTAAATAACCGGCTACCGGCTCAATCA
CAAGCTGCCGCCTCACAATCGACTACTGACCGACCCATGATGGCTGGAGACACGCTTGACGATATTATTCGAAAC
AACCAAAGCGAGATTCAGCGTCGGCGCAGTATGCCACAGGCAACTTTCGGAAATCCAACCACTACAACACAGGCA
CAGAGTCCAAGACGCGTATCTTCAATTGGCGCGGCGGACATGATGTCGTTTGGGTCCCACAATGCTGATATTGGA
TCATATCAATTCGGTCCCGCTGCCAACTCTGGCCTTTCCAACATTAATACCACGGGTATGGATATGACGGATCAA
GTAGGGAGTTATATGACGGAAGCGGGAGACTACTCGGCTATTTCACCTGATCTCATGGGCTCCATGATACCAGCC
TCCTTTGCCAACATGGACATGGGGCACATGAGCAACGACTCATCGACCATGAGTATGTTTGCCACTCCTGCAGCC
GCGTCTTCGAGTACTGCATCCGGAGCAGGATCCACGCCAATTGGAAACGGCTTCAGTCCAAGTCAGATTCCTTCA
GTTAATACCGAATATCCCTTGGGGGCTACTACAGATGCTGGTTCAATGGAGACTACTCCCGGCAATGTCTCAGGT
GCCATCGCGACTGTAGATGACCAAGACGACGATATGATGGCGCTGCAGCCAGCGCAATTCAGTTCAATGAGGACT
ACGCCAAATTCTAATTCTACTATTAGTGGCAGCGGTGCAAACTTGGACACCAACTTCAGTCGCAATATACAACCT
TCGCTCTCTCGTCGCGTATCTTCACCCAGATGCAACCCATCTAGCCAGCATGGTGCGTCATCTGCGGGTCTTGGC
CAAACGACCTCGGGCGCCTCCAATGCTACGACACCCATGACGACGTCGACACCTCGGGAGCCCAAGGAAAAGACC
ATCTATTCCAAAAGCGGCTTTGACATGATCAAGGCCCTCTGGCTAGTTGCTACTCGCAAGGATCCTAGAATTCAT
CTTGGTGCTGTCGACATGTCGTGCGCATTCGTCGTTTGCGACGTCACAATGAATGACTGTCCCATCGTCTATGTC
TCGGACAACTTTCAAAACCTGACGGGTTACAGCCGCCACGAAATTGTTGGTCAGAACTGCCGCTTTTTACAAGCC
CCAGACGGCAAGGTCGAGGCGGGTTGTAAGCGCGAATTTGTTGATGATGGTGCCGTCTATAATCTCAAAAAGATG
ATACAAGAAGGACAAGAAGTGCAACAGAGTCTGATCAACTATCGTAAAGGAGGCAAGCCATTTCTGAACCTTCTC
ACCATGATACCGATTCCCTGGGACACGGATGAAATTCGATACTTTATAGGTTTTCAGATAGATCTTGTTGAGTGT
CCTGATGCCATTTCTGGGCAGGAACTTGACGGCGTCAAGGTCAATTACAAGCACAGCGAAATGGAACAGTACATC
TGGAACCCTCCGCCATCAAGCCAGTGGGAGCCTGGAGATGGCCAGACTCTGGGTGTCGATGACGTGTCAACGTTA
CTGCAGCAGTTCAATCCCAAAGGGCATGCCTCGGACTGGCACAAGCAATCTTGGGACAAGATGCTGCTCGAGAAT
ACTGATGATCTTGTCCATGTCTTGTCTTTGAAAGGCATTTTCCTCTATCTCTCTCCCTCTTGCAGGCGAGTGCTC
GAATGCGACGCTCGTGAGATGACAGGAACTTCTCTCTCGACCGTCTGCCATCCTTCAGATATTGTGCCAGTCACT
CGGGAGCTCAAGGAAGCAACGACTGGAAACCAGGTCAATGTGGTTTTCCGAATACGCCGCAAGCAGAGCGGCTAC
ACGTGGTTTGAGAGCCACGGCTCTCTGTTTGTCGAGCAGGGCAAAGGCCGCAAGTGCATTATACTTGTCGGGCGC
AAACGACCCGTCTTTGCACTCAGCAGGCACCACCTTGAAACAAATGGAGGGATAGGTGACAGCGAGCTCTGGACA
AAGCTATCTACATCGGGCATGTTTCTCTTCGTTTCCTCAAATGTCAGGTCGCTCCTGGATCTACAGCCCGAAACC
CTAGTGGGAACGAGCATCCAAGAGCTTATGCGCAAAGAGTCGCGGCCCGAGTTTGGGAGGTCGATTGAAAAAGCG
AGACGAGGCAAAATTGTTACCTGCAAACACGAGGTCCAGAACCGACGCGGCCAGGGATTACAGGCCCAGACGATA
CTATATCCTGGAGATGCCTGTGAAGGACAAAAACCATCGTTTCTATTGGCCCAGACGAAGCTTCTCAAGGCCTCG
TCGCGTAATTTATCAACGTCGAGCGCGGCTGGCAGCAACAAGTCGGTGACTGCAACGCCTAGAGGTAACCCACAA
TCGCAAACGAGCCAGGGTAATGGGCAGATATCACAGCCGGCGGGCGGGGCGCTGGTGCCGGGGACACAAGACGCC
GCTTTGGCCTCGGATGACAACATTTTTGACGAGTTGCGAACGACAAAATGCTCGAGCTGGCAGTTTGAACTGAGG
CAGATGGAGAAGGTGAACCGCATCCTCGCTGAAGAACTGGGAGGATTATTATCCAATAAGAAGAAGAGAAAGCGG
AGAAAGGGAGTGGGCAATTTGGTGAGGGACTGTGCCAACTGTCACACACGCAATACTCCAGAGTGGCGCCGAGGA
CCCAGCGGCCAGAGAGATCTTTGCAATAGCTGCGGCCTTCGGTGGGCGAAGCAGACTGGCCGGGTTTCGCCTCGC
AACTCTTCGCGAGGAGGCAATAATGGTAACGGAGATTCGCAGAGTAAAAAGTCGGCGTCGCCCATTCACTCTTCG
CCGCTTCACAGAGAAGTCTCGTCGGAAACCCCAAATGCGTATGGGACCGATGGCGATGGCGCTGCTGACACAGTG
GCAATGGCGTGCCAGGGTGCCGACATGGGTCCAAGTACTGTGTCCAACAGCAGCCTTGGACCCAAGCCGCTGTCA
ACCATGCCGCCACCCAGCCAGCCCTCGCTTTCAGGTGGTGCCCCTGGGTCGGCAATGACGTCTATCCGGGAGGAG
AGCGAAAACAGTCAGCCTTGA
Transcript >OphauB2|4276
ATGGAGAGCTACTATCCACAACAGCAGCTACCCCAAGAACCGCAGCATCAATTTAATAGTCAGCAGCCGCAAGAA
CACCAACAACAACAACAACAACAGCAGCAGCAGCAGCAGCAGCAGCAGCAAGAACTACAACAACGACAACGACAA
CAGCAGCAACATCAACAAAAGGGCGAAGAAGAACAAAGCCAGCGGCGTCGACGGCAGGAGCCGCAGCAGAAACAA
CAAGCTGAGCCGCAGCAACAGCAGGCATCAATATCCGACGCCTTTGGTGTAAATAACCGGCTACCGGCTCAATCA
CAAGCTGCCGCCTCACAATCGACTACTGACCGACCCATGATGGCTGGAGACACGCTTGACGATATTATTCGAAAC
AACCAAAGCGAGATTCAGCGTCGGCGCAGTATGCCACAGGCAACTTTCGGAAATCCAACCACTACAACACAGGCA
CAGAGTCCAAGACGCGTATCTTCAATTGGCGCGGCGGACATGATGTCGTTTGGGTCCCACAATGCTGATATTGGA
TCATATCAATTCGGTCCCGCTGCCAACTCTGGCCTTTCCAACATTAATACCACGGGTATGGATATGACGGATCAA
GTAGGGAGTTATATGACGGAAGCGGGAGACTACTCGGCTATTTCACCTGATCTCATGGGCTCCATGATACCAGCC
TCCTTTGCCAACATGGACATGGGGCACATGAGCAACGACTCATCGACCATGAGTATGTTTGCCACTCCTGCAGCC
GCGTCTTCGAGTACTGCATCCGGAGCAGGATCCACGCCAATTGGAAACGGCTTCAGTCCAAGTCAGATTCCTTCA
GTTAATACCGAATATCCCTTGGGGGCTACTACAGATGCTGGTTCAATGGAGACTACTCCCGGCAATGTCTCAGGT
GCCATCGCGACTGTAGATGACCAAGACGACGATATGATGGCGCTGCAGCCAGCGCAATTCAGTTCAATGAGGACT
ACGCCAAATTCTAATTCTACTATTAGTGGCAGCGGTGCAAACTTGGACACCAACTTCAGTCGCAATATACAACCT
TCGCTCTCTCGTCGCGTATCTTCACCCAGATGCAACCCATCTAGCCAGCATGGTGCGTCATCTGCGGGTCTTGGC
CAAACGACCTCGGGCGCCTCCAATGCTACGACACCCATGACGACGTCGACACCTCGGGAGCCCAAGGAAAAGACC
ATCTATTCCAAAAGCGGCTTTGACATGATCAAGGCCCTCTGGCTAGTTGCTACTCGCAAGGATCCTAGAATTCAT
CTTGGTGCTGTCGACATGTCGTGCGCATTCGTCGTTTGCGACGTCACAATGAATGACTGTCCCATCGTCTATGTC
TCGGACAACTTTCAAAACCTGACGGGTTACAGCCGCCACGAAATTGTTGGTCAGAACTGCCGCTTTTTACAAGCC
CCAGACGGCAAGGTCGAGGCGGGTTGTAAGCGCGAATTTGTTGATGATGGTGCCGTCTATAATCTCAAAAAGATG
ATACAAGAAGGACAAGAAGTGCAACAGAGTCTGATCAACTATCGTAAAGGAGGCAAGCCATTTCTGAACCTTCTC
ACCATGATACCGATTCCCTGGGACACGGATGAAATTCGATACTTTATAGGTTTTCAGATAGATCTTGTTGAGTGT
CCTGATGCCATTTCTGGGCAGGAACTTGACGGCGTCAAGGTCAATTACAAGCACAGCGAAATGGAACAGTACATC
TGGAACCCTCCGCCATCAAGCCAGTGGGAGCCTGGAGATGGCCAGACTCTGGGTGTCGATGACGTGTCAACGTTA
CTGCAGCAGTTCAATCCCAAAGGGCATGCCTCGGACTGGCACAAGCAATCTTGGGACAAGATGCTGCTCGAGAAT
ACTGATGATCTTGTCCATGTCTTGTCTTTGAAAGGCATTTTCCTCTATCTCTCTCCCTCTTGCAGGCGAGTGCTC
GAATGCGACGCTCGTGAGATGACAGGAACTTCTCTCTCGACCGTCTGCCATCCTTCAGATATTGTGCCAGTCACT
CGGGAGCTCAAGGAAGCAACGACTGGAAACCAGGTCAATGTGGTTTTCCGAATACGCCGCAAGCAGAGCGGCTAC
ACGTGGTTTGAGAGCCACGGCTCTCTGTTTGTCGAGCAGGGCAAAGGCCGCAAGTGCATTATACTTGTCGGGCGC
AAACGACCCGTCTTTGCACTCAGCAGGCACCACCTTGAAACAAATGGAGGGATAGGTGACAGCGAGCTCTGGACA
AAGCTATCTACATCGGGCATGTTTCTCTTCGTTTCCTCAAATGTCAGGTCGCTCCTGGATCTACAGCCCGAAACC
CTAGTGGGAACGAGCATCCAAGAGCTTATGCGCAAAGAGTCGCGGCCCGAGTTTGGGAGGTCGATTGAAAAAGCG
AGACGAGGCAAAATTGTTACCTGCAAACACGAGGTCCAGAACCGACGCGGCCAGGGATTACAGGCCCAGACGATA
CTATATCCTGGAGATGCCTGTGAAGGACAAAAACCATCGTTTCTATTGGCCCAGACGAAGCTTCTCAAGGCCTCG
TCGCGTAATTTATCAACGTCGAGCGCGGCTGGCAGCAACAAGTCGGTGACTGCAACGCCTAGAGGTAACCCACAA
TCGCAAACGAGCCAGGGTAATGGGCAGATATCACAGCCGGCGGGCGGGGCGCTGGTGCCGGGGACACAAGACGCC
GCTTTGGCCTCGGATGACAACATTTTTGACGAGTTGCGAACGACAAAATGCTCGAGCTGGCAGTTTGAACTGAGG
CAGATGGAGAAGGTGAACCGCATCCTCGCTGAAGAACTGGGAGGATTATTATCCAATAAGAAGAAGAGAAAGCGG
AGAAAGGGAGTGGGCAATTTGGTGAGGGACTGTGCCAACTGTCACACACGCAATACTCCAGAGTGGCGCCGAGGA
CCCAGCGGCCAGAGAGATCTTTGCAATAGCTGCGGCCTTCGGTGGGCGAAGCAGACTGGCCGGGTTTCGCCTCGC
AACTCTTCGCGAGGAGGCAATAATGGTAACGGAGATTCGCAGAGTAAAAAGTCGGCGTCGCCCATTCACTCTTCG
CCGCTTCACAGAGAAGTCTCGTCGGAAACCCCAAATGCGTATGGGACCGATGGCGATGGCGCTGCTGACACAGTG
GCAATGGCGTGCCAGGGTGCCGACATGGGTCCAAGTACTGTGTCCAACAGCAGCCTTGGACCCAAGCCGCTGTCA
ACCATGCCGCCACCCAGCCAGCCCTCGCTTTCAGGTGGTGCCCCTGGGTCGGCAATGACGTCTATCCGGGAGGAG
AGCGAAAACAGTCAGCCTTGA
Gene >OphauB2|4276
ATGGAGAGCTACTATCCACAACAGCAGCTACCCCAAGAACCGCAGCATCAATTTAATAGTCAGCAGCCGCAAGAA
CACCAACAACAACAACAACAACAGCAGCAGCAGCAGCAGCAGCAGCAGCAAGAACTACAACAACGACAACGACAA
CAGCAGCAACATCAACAAAAGGGCGAAGAAGAACAAAGCCAGCGGCGTCGACGGCAGGAGCCGCAGCAGAAACAA
CAAGCTGAGCCGCAGCAACAGCAGGCATCAATATCCGACGCCTTTGGTGTAAATAACCGGCTACCGGCTCAATCA
CAAGCTGCCGCCTCACAATCGACTACTGACCGACCCATGATGGCTGGAGACACGCTTGACGATATTATTCGAAAC
AACCAAAGCGAGATTCAGCGTCGGCGCAGTATGCCACAGGCAACTTTCGGAAATCCAACCACTACAACACAGGCA
CAGAGTCCAAGACGCGTATCTTCAATTGGCGCGGCGGACATGATGTCGTTTGGGTCCCACAATGCTGATATTGGA
TCATATCAATTCGGTCCCGCTGCCAACTCTGGCCTTTCCAACATTAATACCACGGGTATGGATATGACGGATCAA
GTAGGGAGTTATATGACGGAAGCGGGAGACTACTCGGCTATTTCACCTGATCTCATGGGCTCCATGATACCAGCC
TCCTTTGCCAACATGGACATGGGGCACATGAGCAACGACTCATCGACCATGAGTATGTTTGCCACTCCTGCAGCC
GCGTCTTCGAGTACTGCATCCGGAGCAGGATCCACGCCAATTGGAAACGGCTTCAGTCCAAGTCAGATTCCTTCA
GTTAATACCGAATATCCCTTGGGGGCTACTACAGATGCTGGTTCAATGGAGACTACTCCCGGCAATGTCTCAGGT
GCCATCGCGACTGTAGATGACCAAGACGACGATATGATGGCGCTGCAGCCAGCGCAATTCAGTTCAATGAGGACT
ACGCCAAATTCTAATTCTACTATTAGTGGCAGCGGTGCAAACTTGGACACCAACTTCAGTCGCAATATACAACCT
TCGCTCTCTCGTCGCGTATCTTCACCCAGATGCAACCCATCTAGCCAGCATGGTGCGTCATCTGCGGGTCTTGGC
CAAACGACCTCGGGCGCCTCCAATGCTACGACACCCATGACGACGTCGACACCTCGGGAGCCCAAGGAAAAGACC
ATCTATTCCAAAAGCGGCTTTGACATGATCAAGGCCCTCTGGCTAGTTGCTACTCGCAAGGATCCTAGAATTCAT
CTTGGTGCTGTCGACATGTCGTGCGCATTCGTCGTTTGCGACGTCACAATGAATGACTGTCCCATCGTCTATGTC
TCGGACAACTTTCAAAACCTGACGGGTTACAGCCGCCACGAAATTGTTGGTCAGAACTGCCGCTTTTTACAAGCC
CCAGACGGCAAGGTCGAGGCGGGTTGTAAGCGCGAATTTGTTGATGATGGTGCCGTCTATAATCTCAAAAAGATG
ATACAAGAAGGACAAGAAGTGCAACAGAGTCTGATCAACTATCGTAAAGGAGGCAAGCCATTTCTGAACCTTCTC
ACCATGATACCGATTCCCTGGGACACGGATGAAATTCGATACTTTATAGGTTTTCAGATAGATCTTGTTGAGTGT
CCTGATGCCATTTCTGGGCAGGAACTTGACGGCGTCAAGGTCAATTACAAGCACAGCGAAATGGAACAGTACATC
TGGAACCCTCCGCCATCAAGCCAGTGGGAGCCTGGAGATGGCCAGACTCTGGGTGTCGATGACGTGTCAACGTTA
CTGCAGCAGTTCAATCCCAAAGGGCATGCCTCGGACTGGCACAAGCAATCTTGGGACAAGATGCTGCTCGAGAAT
ACTGATGATCTTGTCCATGTCTTGTCTTTGAAAGGCATTTTCCTCTATCTCTCTCCCTCTTGCAGGCGAGTGCTC
GAATGCGACGCTCGTGAGATGACAGGAACTTCTCTCTCGACCGTCTGCCATCCTTCAGATATTGTGCCAGTCACT
CGGGAGCTCAAGGAAGCAACGACTGGAAACCAGGTCAATGTGGTTTTCCGAATACGCCGCAAGCAGAGCGGCTAC
ACGTGGTTTGAGAGCCACGGCTCTCTGTTTGTCGAGCAGGGCAAAGGCCGCAAGTGCATTATACTTGTCGGGCGC
AAACGACCCGTCTTTGCACTCAGCAGGCACCACCTTGAAACAAATGGAGGGATAGGTGACAGCGAGCTCTGGACA
AAGCTATCTACATCGGGCATGTTTCTCTTCGTTTCCTCAAATGTCAGGTCGCTCCTGGATCTACAGCCCGAAACC
CTAGTGGGAACGAGCATCCAAGAGCTTATGCGCAAAGAGTCGCGGCCCGAGTTTGGGAGGTCGATTGAAAAAGCG
AGACGAGGCAAAATTGTTACCTGCAAACACGAGGTCCAGAACCGACGCGGCCAGGGATTACAGGCCCAGACGATA
CTATATCCTGGAGATGCCTGTGAAGGACAAAAACCATCGTTTCTATTGGCCCAGACGAAGCTTCTCAAGGCCTCG
TCGCGTAATTTATCAACGTCGAGCGCGGCTGGCAGCAACAAGTCGGTGACTGCAACGCCTAGAGGTAACCCACAA
TCGCAAACGAGCCAGGGTAATGGGCAGATATCACAGCCGGCGGGCGGGGCGCTGGTGCCGGGGACACAAGACGCC
GCTTTGGCCTCGGATGACAACATTTTTGACGAGTTGCGAACGACAAAATGCTCGAGCTGGCAGTTTGAACTGAGG
CAGATGGAGAAGGTGAACCGCATCCTCGCTGAAGAACTGGGAGGATTATTATCCAATAAGAAGAAGAGAAAGCGG
AGAAAGGGAGTGGGCAATTTGGTGAGGGACTGTGCCAACTGTCACACACGCAATACTCCAGAGTGGCGCCGAGGA
CCCAGCGGCCAGAGAGATCTTTGCAATAGCTGCGGCCTTCGGTGGGCGAAGCAGGCAAGTGACTCCCTTCGCCTA
CCGGTTGCAGCGCCATCGGACCATGCTTCACTGACTGACTGACTTGGTGCCATCAGACTGGCCGGGTTTCGCCTC
GCAACTCTTCGCGAGGAGGCAATAATGGTAACGGAGATTCGCAGAGTAAAAAGTCGGCGTCGCCCATTCACTCTT
CGCCGCTTCACAGAGAAGTCTCGTCGGAAACCCCAAATGCGTATGGGACCGATGGCGATGGCGCTGCTGACACAG
TGGCAATGGCGTGCCAGGGTGCCGACATGGGTCCAAGTACTGTGTCCAACAGCAGCCTTGGACCCAAGCCGCTGT
CAACCATGCCGCCACCCAGCCAGCCCTCGCTTTCAGGTGGTGCCCCTGGGTCGGCAATGACGTCTATCCGGGAGG
AGAGCGAAAACAGTCAGCCTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail