Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|4267
Gene name
LocationContig_284:966..4393
Strand-
Gene length (bp)3427
Transcript length (bp)3078
Coding sequence length (bp)3078
Protein length (aa) 1026

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00628 PHD PHD-finger 1.6E-08 594 637

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q09698|YA27_SCHPO Uncharacterized protein C2F7.07c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC2F7.07c PE=3 SV=1 591 850 3.0E-40
sp|Q04779|RCO1_YEAST Transcriptional regulatory protein RCO1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RCO1 PE=1 SV=1 590 810 3.0E-26
sp|Q09819|YAC5_SCHPO Uncharacterized protein C16C9.05 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC16C9.05 PE=1 SV=1 546 749 1.0E-19
sp|Q5SPL2|PHF12_MOUSE PHD finger protein 12 OS=Mus musculus GN=Phf12 PE=1 SV=1 591 668 3.0E-07
sp|Q96QT6|PHF12_HUMAN PHD finger protein 12 OS=Homo sapiens GN=PHF12 PE=1 SV=2 591 668 3.0E-07
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q09698|YA27_SCHPO Uncharacterized protein C2F7.07c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC2F7.07c PE=3 SV=1 591 850 3.0E-40
sp|Q04779|RCO1_YEAST Transcriptional regulatory protein RCO1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RCO1 PE=1 SV=1 590 810 3.0E-26
sp|Q09819|YAC5_SCHPO Uncharacterized protein C16C9.05 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC16C9.05 PE=1 SV=1 546 749 1.0E-19
sp|Q5SPL2|PHF12_MOUSE PHD finger protein 12 OS=Mus musculus GN=Phf12 PE=1 SV=1 591 668 3.0E-07
sp|Q96QT6|PHF12_HUMAN PHD finger protein 12 OS=Homo sapiens GN=PHF12 PE=1 SV=2 591 668 3.0E-07
sp|Q9Z0E3|AIRE_MOUSE Autoimmune regulator OS=Mus musculus GN=Aire PE=1 SV=1 540 641 4.0E-07
sp|F4IXE7|IDM1_ARATH Increased DNA methylation 1 OS=Arabidopsis thaliana GN=IDM1 PE=1 SV=1 591 636 2.0E-06
sp|O43918|AIRE_HUMAN Autoimmune regulator OS=Homo sapiens GN=AIRE PE=1 SV=1 591 637 2.0E-06
sp|Q5SPL2|PHF12_MOUSE PHD finger protein 12 OS=Mus musculus GN=Phf12 PE=1 SV=1 721 784 4.0E-06
sp|Q96QT6|PHF12_HUMAN PHD finger protein 12 OS=Homo sapiens GN=PHF12 PE=1 SV=2 721 775 4.0E-06
sp|O15164|TIF1A_HUMAN Transcription intermediary factor 1-alpha OS=Homo sapiens GN=TRIM24 PE=1 SV=3 591 636 4.0E-06
sp|O15016|TRI66_HUMAN Tripartite motif-containing protein 66 OS=Homo sapiens GN=TRIM66 PE=2 SV=4 590 636 4.0E-06
sp|F4JYC8|PTM_ARATH DDT domain-containing protein PTM OS=Arabidopsis thaliana GN=PTM PE=1 SV=1 591 640 5.0E-06
sp|Q6E2N3|TRI33_DANRE E3 ubiquitin-protein ligase TRIM33 OS=Danio rerio GN=trim33 PE=2 SV=1 564 636 5.0E-06
sp|Q64127|TIF1A_MOUSE Transcription intermediary factor 1-alpha OS=Mus musculus GN=Trim24 PE=1 SV=1 591 636 5.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|4267
MVSTSTRASRAATRYSSPVQAGQEQQQHGVAKTGLVSEGGLEEGKANGGATQGSRALMARWLEPSVQSKASFEEA
GLQRCGVLETMSALGTMPAKGKRAGVGVEGVGGGAPVRKIILRPSGSTGANGGEGVARRLASQEAASGSSDAAAG
WACGSDSGTAAAVEKAGVDKKGRGDDVGEEEDYKGKEEANEMANELGRRRRSKRVSLPGNKTGVKREASPKRTGS
IQEREFVDRVVEVAVDEALQHQRYPTAWALRTLYDDNYEDGEFVAMVEEVFRQTAAESTRLRFLSLIEDKKREGK
REEQVGGQGRAERTSSASESTTTWADEAEESEGAKRGAKRVKTTHVATAAKALAGKGSVVVRTGQSGGTAGHRRH
DSASSMSSLSSAMSLASPSASPRQGAGSSSGSAAPAGHGAGKRQPIKTRGRAKQAGPGGLSVHAPHSDSKEPKSP
TMAGRVAAAADQELPSKKQTPLPECDDEASAVWERRRAARSLTNALVARPSLVRADETRRTTRSASKRPSPAAFA
CPAAQSRAATPTRSTAAALRPAKRARTGLRTKTSPVKKKGGTAAGLPRAMAEATTGQATRDALCDNDEYCSACGN
AGDVVCCDGCPRSFHFECVDMAPSNHLPDEWFCTECLVRRFPLRVPVHKGLFGSALNLLEKSNPRAFSLPPKLQT
YFEGVRAGAHGDYEDTASSKPAPRKRNGYDELPDLYKQREDGRPVLCHACQKPAAQARAMMPCSMCPLFWHLDCL
QPPLAIPPPLKSWRCPAHAHHLLLHAPPLAPAHRFRNIKASQPITPALSRGLKNNGHIEIEWAEPADAPDKSAWP
DAQSFGRTYKLQAKPLVLDFIEQLRLRGAGYASQPHEPRPMAPLSQDSQPLRGSALQRTLDEAQVSLTLAALRQS
PSHKIDLLLSALVSAADPALLALMAKGSAHNMALGQLTDLDRQSLRAMLAQMDAMSSRIRHVLGHDDKPLTAPLP
SLETNARTPISEPPSANEPPEKLDAMDDALAEPTPPSTVDHADEGSMDLD*
Coding >OphauB2|4267
ATGGTGTCTACTAGCACAAGGGCGTCGCGCGCGGCGACTCGCTACTCAAGCCCGGTACAGGCGGGACAAGAGCAG
CAGCAGCATGGAGTGGCCAAGACGGGCCTTGTCTCAGAAGGTGGATTGGAGGAAGGCAAGGCAAATGGCGGGGCG
ACGCAGGGATCGAGGGCTCTAATGGCGCGGTGGCTGGAGCCGTCGGTGCAGAGCAAGGCGAGCTTTGAAGAGGCG
GGCCTGCAGCGATGCGGCGTGCTGGAAACCATGTCAGCGCTGGGGACGATGCCGGCCAAGGGCAAGAGGGCAGGC
GTCGGCGTCGAGGGCGTTGGGGGCGGGGCTCCGGTGCGCAAGATTATCCTGCGGCCCTCGGGCAGCACAGGTGCA
AACGGTGGCGAGGGGGTGGCTCGGCGGCTGGCAAGCCAAGAGGCGGCGAGCGGGTCGTCGGATGCAGCAGCGGGG
TGGGCATGTGGCAGCGACTCGGGCACGGCAGCAGCAGTGGAAAAGGCGGGAGTGGACAAAAAAGGGCGGGGGGAT
GATGTGGGGGAGGAGGAGGACTACAAGGGCAAGGAGGAGGCAAATGAGATGGCAAATGAGCTGGGGCGACGCAGA
CGGTCGAAACGCGTGTCGCTGCCAGGCAACAAGACGGGGGTCAAGAGGGAGGCATCGCCCAAGCGGACAGGATCG
ATTCAGGAGCGAGAGTTTGTGGACCGAGTGGTGGAGGTGGCGGTGGACGAGGCTCTGCAACACCAGCGGTATCCC
ACAGCATGGGCTCTACGGACCTTGTACGACGACAACTACGAGGACGGGGAGTTTGTGGCCATGGTGGAGGAGGTT
TTCCGGCAGACGGCGGCCGAGTCGACGCGGCTGCGCTTCCTCAGCCTCATTGAGGACAAGAAGCGCGAGGGCAAG
AGGGAGGAGCAGGTTGGGGGGCAGGGCAGGGCGGAGCGGACGTCGAGTGCATCCGAGTCGACGACGACGTGGGCA
GACGAGGCGGAGGAGTCGGAGGGGGCAAAACGAGGGGCCAAGAGAGTCAAGACGACGCACGTGGCGACGGCGGCC
AAGGCACTAGCGGGCAAGGGCTCGGTGGTGGTGCGGACGGGTCAGTCGGGCGGGACGGCTGGACACAGGCGGCAC
GACTCGGCATCGAGCATGTCGTCGCTGTCGTCGGCCATGAGCCTGGCATCTCCGTCGGCCAGCCCCAGACAGGGC
GCTGGGAGCAGCAGTGGCAGCGCGGCGCCAGCGGGCCACGGTGCGGGCAAGAGGCAGCCAATCAAGACGCGCGGG
CGGGCCAAGCAGGCAGGGCCTGGTGGCTTGTCTGTGCACGCGCCGCACTCGGACAGCAAGGAGCCCAAGTCGCCC
ACCATGGCGGGCCGTGTGGCAGCAGCAGCGGACCAGGAGCTGCCGAGCAAGAAGCAGACGCCGCTGCCCGAGTGC
GACGACGAGGCCAGTGCCGTTTGGGAGCGTCGCCGCGCCGCCCGCAGCCTCACGAATGCTCTTGTGGCGCGGCCC
AGTCTGGTGCGCGCCGACGAGACGAGACGCACCACGCGCTCTGCCAGCAAGCGCCCGTCGCCCGCAGCCTTTGCC
TGCCCGGCGGCCCAGTCGCGCGCTGCCACGCCAACCAGGTCCACGGCGGCGGCGCTGCGGCCAGCCAAGCGCGCC
CGCACGGGGCTGCGAACAAAGACGTCGCCCGTCAAGAAAAAGGGAGGCACGGCGGCGGGCTTGCCGCGGGCCATG
GCTGAGGCGACGACGGGGCAGGCGACGCGAGATGCGCTGTGCGACAATGACGAGTACTGCTCGGCCTGCGGCAAC
GCCGGCGACGTCGTCTGCTGCGACGGCTGTCCCCGCTCCTTTCACTTTGAATGCGTCGACATGGCGCCCTCGAAT
CACCTGCCCGACGAGTGGTTCTGCACCGAGTGTCTGGTGCGCCGCTTTCCCCTGCGCGTCCCCGTCCACAAGGGC
CTCTTTGGCAGCGCCCTCAACCTGCTGGAAAAGAGCAACCCGCGCGCCTTTAGCCTCCCCCCCAAGCTACAGACG
TACTTTGAGGGCGTCCGCGCTGGCGCCCATGGCGACTACGAGGACACTGCCTCGTCCAAGCCCGCTCCCCGCAAG
CGCAATGGCTACGACGAGCTGCCCGATCTCTACAAGCAGCGCGAAGACGGCCGCCCCGTCCTCTGCCACGCCTGC
CAGAAGCCCGCTGCCCAGGCCCGCGCCATGATGCCCTGCAGCATGTGCCCCTTGTTTTGGCATCTCGACTGTCTG
CAGCCTCCTCTGGCCATTCCCCCGCCCCTCAAGTCGTGGCGCTGCCCAGCACATGCCCACCACCTCCTGCTCCAC
GCTCCGCCCCTGGCCCCCGCCCACCGCTTCCGCAACATCAAGGCCAGCCAGCCCATTACTCCCGCCCTCAGCCGC
GGCCTCAAGAACAATGGCCACATTGAAATCGAATGGGCCGAGCCTGCCGACGCCCCAGACAAGTCGGCCTGGCCC
GATGCCCAGTCGTTTGGCCGCACCTACAAGCTCCAGGCCAAGCCCCTGGTGCTCGACTTTATCGAGCAACTGCGC
CTGCGCGGCGCTGGCTATGCTTCGCAGCCCCACGAGCCCCGCCCCATGGCCCCCCTGTCCCAAGACTCCCAGCCC
TTGCGCGGCTCTGCCCTCCAGCGCACCCTCGACGAGGCTCAAGTCTCTCTCACCCTCGCCGCCCTGCGCCAGAGC
CCCTCGCACAAGATTGACTTGCTGCTCTCCGCCCTTGTCTCTGCTGCCGATCCCGCCCTCTTGGCCCTCATGGCA
AAGGGCAGCGCCCACAACATGGCCCTCGGCCAGCTGACGGACCTGGACCGCCAGAGCCTCCGTGCAATGCTGGCC
CAGATGGACGCCATGAGCAGCCGCATCCGCCATGTCTTGGGCCATGACGATAAGCCCCTGACGGCGCCCCTTCCC
TCTCTTGAGACTAATGCTCGCACTCCCATTTCCGAGCCTCCCAGCGCCAACGAGCCGCCAGAAAAGCTAGACGCC
ATGGATGACGCTCTTGCTGAGCCCACGCCCCCCTCTACTGTCGACCACGCCGATGAAGGTTCCATGGACCTGGAC
TGA
Transcript >OphauB2|4267
ATGGTGTCTACTAGCACAAGGGCGTCGCGCGCGGCGACTCGCTACTCAAGCCCGGTACAGGCGGGACAAGAGCAG
CAGCAGCATGGAGTGGCCAAGACGGGCCTTGTCTCAGAAGGTGGATTGGAGGAAGGCAAGGCAAATGGCGGGGCG
ACGCAGGGATCGAGGGCTCTAATGGCGCGGTGGCTGGAGCCGTCGGTGCAGAGCAAGGCGAGCTTTGAAGAGGCG
GGCCTGCAGCGATGCGGCGTGCTGGAAACCATGTCAGCGCTGGGGACGATGCCGGCCAAGGGCAAGAGGGCAGGC
GTCGGCGTCGAGGGCGTTGGGGGCGGGGCTCCGGTGCGCAAGATTATCCTGCGGCCCTCGGGCAGCACAGGTGCA
AACGGTGGCGAGGGGGTGGCTCGGCGGCTGGCAAGCCAAGAGGCGGCGAGCGGGTCGTCGGATGCAGCAGCGGGG
TGGGCATGTGGCAGCGACTCGGGCACGGCAGCAGCAGTGGAAAAGGCGGGAGTGGACAAAAAAGGGCGGGGGGAT
GATGTGGGGGAGGAGGAGGACTACAAGGGCAAGGAGGAGGCAAATGAGATGGCAAATGAGCTGGGGCGACGCAGA
CGGTCGAAACGCGTGTCGCTGCCAGGCAACAAGACGGGGGTCAAGAGGGAGGCATCGCCCAAGCGGACAGGATCG
ATTCAGGAGCGAGAGTTTGTGGACCGAGTGGTGGAGGTGGCGGTGGACGAGGCTCTGCAACACCAGCGGTATCCC
ACAGCATGGGCTCTACGGACCTTGTACGACGACAACTACGAGGACGGGGAGTTTGTGGCCATGGTGGAGGAGGTT
TTCCGGCAGACGGCGGCCGAGTCGACGCGGCTGCGCTTCCTCAGCCTCATTGAGGACAAGAAGCGCGAGGGCAAG
AGGGAGGAGCAGGTTGGGGGGCAGGGCAGGGCGGAGCGGACGTCGAGTGCATCCGAGTCGACGACGACGTGGGCA
GACGAGGCGGAGGAGTCGGAGGGGGCAAAACGAGGGGCCAAGAGAGTCAAGACGACGCACGTGGCGACGGCGGCC
AAGGCACTAGCGGGCAAGGGCTCGGTGGTGGTGCGGACGGGTCAGTCGGGCGGGACGGCTGGACACAGGCGGCAC
GACTCGGCATCGAGCATGTCGTCGCTGTCGTCGGCCATGAGCCTGGCATCTCCGTCGGCCAGCCCCAGACAGGGC
GCTGGGAGCAGCAGTGGCAGCGCGGCGCCAGCGGGCCACGGTGCGGGCAAGAGGCAGCCAATCAAGACGCGCGGG
CGGGCCAAGCAGGCAGGGCCTGGTGGCTTGTCTGTGCACGCGCCGCACTCGGACAGCAAGGAGCCCAAGTCGCCC
ACCATGGCGGGCCGTGTGGCAGCAGCAGCGGACCAGGAGCTGCCGAGCAAGAAGCAGACGCCGCTGCCCGAGTGC
GACGACGAGGCCAGTGCCGTTTGGGAGCGTCGCCGCGCCGCCCGCAGCCTCACGAATGCTCTTGTGGCGCGGCCC
AGTCTGGTGCGCGCCGACGAGACGAGACGCACCACGCGCTCTGCCAGCAAGCGCCCGTCGCCCGCAGCCTTTGCC
TGCCCGGCGGCCCAGTCGCGCGCTGCCACGCCAACCAGGTCCACGGCGGCGGCGCTGCGGCCAGCCAAGCGCGCC
CGCACGGGGCTGCGAACAAAGACGTCGCCCGTCAAGAAAAAGGGAGGCACGGCGGCGGGCTTGCCGCGGGCCATG
GCTGAGGCGACGACGGGGCAGGCGACGCGAGATGCGCTGTGCGACAATGACGAGTACTGCTCGGCCTGCGGCAAC
GCCGGCGACGTCGTCTGCTGCGACGGCTGTCCCCGCTCCTTTCACTTTGAATGCGTCGACATGGCGCCCTCGAAT
CACCTGCCCGACGAGTGGTTCTGCACCGAGTGTCTGGTGCGCCGCTTTCCCCTGCGCGTCCCCGTCCACAAGGGC
CTCTTTGGCAGCGCCCTCAACCTGCTGGAAAAGAGCAACCCGCGCGCCTTTAGCCTCCCCCCCAAGCTACAGACG
TACTTTGAGGGCGTCCGCGCTGGCGCCCATGGCGACTACGAGGACACTGCCTCGTCCAAGCCCGCTCCCCGCAAG
CGCAATGGCTACGACGAGCTGCCCGATCTCTACAAGCAGCGCGAAGACGGCCGCCCCGTCCTCTGCCACGCCTGC
CAGAAGCCCGCTGCCCAGGCCCGCGCCATGATGCCCTGCAGCATGTGCCCCTTGTTTTGGCATCTCGACTGTCTG
CAGCCTCCTCTGGCCATTCCCCCGCCCCTCAAGTCGTGGCGCTGCCCAGCACATGCCCACCACCTCCTGCTCCAC
GCTCCGCCCCTGGCCCCCGCCCACCGCTTCCGCAACATCAAGGCCAGCCAGCCCATTACTCCCGCCCTCAGCCGC
GGCCTCAAGAACAATGGCCACATTGAAATCGAATGGGCCGAGCCTGCCGACGCCCCAGACAAGTCGGCCTGGCCC
GATGCCCAGTCGTTTGGCCGCACCTACAAGCTCCAGGCCAAGCCCCTGGTGCTCGACTTTATCGAGCAACTGCGC
CTGCGCGGCGCTGGCTATGCTTCGCAGCCCCACGAGCCCCGCCCCATGGCCCCCCTGTCCCAAGACTCCCAGCCC
TTGCGCGGCTCTGCCCTCCAGCGCACCCTCGACGAGGCTCAAGTCTCTCTCACCCTCGCCGCCCTGCGCCAGAGC
CCCTCGCACAAGATTGACTTGCTGCTCTCCGCCCTTGTCTCTGCTGCCGATCCCGCCCTCTTGGCCCTCATGGCA
AAGGGCAGCGCCCACAACATGGCCCTCGGCCAGCTGACGGACCTGGACCGCCAGAGCCTCCGTGCAATGCTGGCC
CAGATGGACGCCATGAGCAGCCGCATCCGCCATGTCTTGGGCCATGACGATAAGCCCCTGACGGCGCCCCTTCCC
TCTCTTGAGACTAATGCTCGCACTCCCATTTCCGAGCCTCCCAGCGCCAACGAGCCGCCAGAAAAGCTAGACGCC
ATGGATGACGCTCTTGCTGAGCCCACGCCCCCCTCTACTGTCGACCACGCCGATGAAGGTTCCATGGACCTGGAC
TGA
Gene >OphauB2|4267
ATGGTGTCTACTAGCACAAGGGCGTCGCGCGCGGCGACTCGCTACTCAAGCCCGGTACAGGCGGGACAAGAGCAG
CAGCAGCATGGAGTGGCCAAGACGGGCCTTGTCTCAGAAGGTGGATTGGAGGAAGGCAAGGCAAATGGCGGGGCG
ACGCAGGGATCGAGGGCTCTAATGGCGCGGTGGCTGGAGCCGTCGGTGCAGAGCAAGGCGAGCTTTGAAGAGGCG
GGCCTGCAGCGATGCGGCGTGCTGGAAACCATGTCAGCGCTGGGGACGATGCCGGCCAAGGGCAAGAGGGCAGGC
GTCGGCGTCGAGGGCGTTGGGGGCGGGGCTCCGGTGCGCAAGATTATCCTGCGGCCCTCGGGCAGCACAGGTGCA
AACGGTGGCGAGGGGGTGGCTCGGCGGCTGGCAAGCCAAGAGGCGGCGAGCGGGTCGTCGGATGCAGCAGCGGGG
TGGGCATGTGGCAGCGACTCGGGCACGGCAGCAGCAGTGGAAAAGGCGGGAGTGGACAAAAAAGGGCGGGGGGAT
GATGTGGGGGAGGAGGAGGACTACAAGGGCAAGGAGGAGGCAAATGAGATGGCAAATGAGCTGGGGCGACGCAGA
CGGTCGAAACGCGTGTCGCTGCCAGGCAACAAGACGGGGGTCAAGAGGGAGGCATCGCCCAAGCGGACAGGATCG
ATTCAGGAGCGAGAGTTTGTGGACCGAGTGGTGGAGGTGGCGGTGGACGAGGCTCTGCAACACCAGCGGTATCCC
ACAGCATGGGCTCTACGGACCTTGTACGACGACAACTACGAGGACGGGGAGTTTGTGGCCATGGTGGAGGAGGTT
TTCCGGCAGACGGCGGCCGAGTCGACGCGGCTGCGCTTCCTCAGCCTCATTGAGGACAAGAAGCGCGAGGGCAAG
AGGGAGGAGCAGGTTGGGGGGCAGGGCAGGGCGGAGCGGACGTCGAGTGCATCCGAGTCGACGACGACGTGGGCA
GACGAGGCGGAGGAGTCGGAGGGGGCAAAACGAGGGGCCAAGAGAGTCAAGACGACGCACGTGGCGACGGCGGCC
AAGGCACTAGCGGGCAAGGGCTCGGTGGTGGTGCGGACGGGTCAGTCGGGCGGGACGGCTGGACACAGGCGGCAC
GACTCGGCATCGAGCATGTCGTCGCTGTCGTCGGCCATGAGCCTGGCATCTCCGTCGGCCAGCCCCAGACAGGGC
GCTGGGAGCAGCAGTGGCAGCGCGGCGCCAGCGGGCCACGGTGCGGGCAAGAGGCAGCCAATCAAGACGCGCGGG
CGGGCCAAGCAGGCAGGGCCTGGTGGCTTGTCTGTGCACGCGCCGCACTCGGACAGCAAGGAGCCCAAGTCGCCC
ACCATGGCGGGCCGTGTGGCAGCAGCAGCGGACCAGGAGCTGCCGAGCAAGAAGCAGACGCCGCTGCCCGAGTGC
GACGACGAGGCCAGTGCCGTTTGGGAGCGTCGCCGCGCCGCCCGCAGCCTCACGAATGCTCTTGTGGCGCGGCCC
AGTCTGGTGCGCGCCGACGAGACGAGACGCACCACGCGCTCTGCCAGCAAGCGCCCGTCGCCCGCAGCCTTTGCC
TGCCCGGCGGCCCAGTCGCGCGCTGCCACGCCAACCAGGTCCACGGCGGCGGCGCTGCGGCCAGCCAAGCGCGCC
CGCACGGGGCTGCGAACAAAGACGTCGTATGTGCCTCAGTCTCAGTCTCAGTCTCCTTTTGTTCTGTATTTTGCT
CTTGGTGGCTTGGGGCTGACCGAGGCGTCTAGGCCCGTCAAGAAAAAGGGAGGCACGGCGGCGGGCTTGCCGCGG
GCCATGGCTGAGGCGACGACGGGGCAGGCGACGCGAGATGCGGTATGTCTATTTGCTCCCCTCTTTTTCCCCCCT
CCGTCTCCTCTTCCTCTCTTTCCCCCCTCTCCTCTTTGTCTCCTCCTCTCCTCTCTTGTCCTCTTGTCCTCTCTG
TCTGGCTCGACTGACGCTGGCGCAGCTGTGCGACAATGACGAGTACTGCTCGGCCTGCGGCAACGCCGGCGACGT
CGTCTGCTGCGACGGCTGTCCCCGCTCCTTTCACTTTGAATGCGTCGACATGGCGCCCTCGAATCACCTGCCCGA
CGAGTGGTTCTGCACCGAGTGTCTGGTGCGCCGCTTTCCCCTGCGCGTCCCCGTCCACAAGGGCCTCTTTGGCAG
CGCCCTCAACCTGCTGGAAAAGAGCAACCCGCGCGCCTTTAGCCTCCCCCCCAAGCTACAGACGTACTTTGAGGG
CGTCCGCGCTGGCGCCCATGGCGACTACGAGGACACTGCCTCGTCCAAGCCCGCTCCCCGCAAGCGCAATGGCTA
CGACGAGCTGCCCGATCTCTACAAGCAGCGCGAAGACGGCCGCCCCGTCCTCTGCCACGCCTGCCAGAAGCCCGC
TGCCCAGGCCCGCGCCATGATGCCCTGCAGCATGTGCCCCTTGTTTTGGCATCTCGACTGTCTGCAGCCTCCTCT
GGCCATTCCCCCGCCCCTCAAGTCGTGGCGCTGCCCAGCACATGCCCACCACCTCCTGCTCCACGCTCCGCCCCT
GGCCCCCGCCCACCGCTTCCGCAACATCAAGGCCAGCCAGCCCATTACTCCCGCCCTCAGCCGCGGCCTCAAGAA
CAATGGCCACATTGAAATCGAATGGGCCGAGCCTGCCGACGCCCCAGACAAGTCGGCCTGGCCCGATGCCCAGTC
GTTTGGCCGCACCTACAAGCTCCAGGCCAAGCCCCTGGTGCTCGACTTTATCGAGCAGTGAGCCCTCGCTTTCCC
CCTTCGCCTTGTCCCCGCTGCTGCTGACCCTTGCTCCAGACTGCGCCTGCGCGGCGCTGGCTATGCTTCGCAGCC
CCACGAGCCCCGCCCCATGGCCCCCCTGTCCCAAGACTCCCAGCCCTTGCGCGGCTCTGCCCTCCAGCGCACCCT
CGACGAGGCTCAAGTCTCTCTCACCCTCGCCGCCCTGCGCCAGAGCCCCTCGCACAAGATTGACTTGCTGCTCTC
CGCCCTTGTCGTAAGCTGCCTGCCCTCCAAGCCCCTCCCCATGACTTTTTGCCTCTGACCCATCTCTCTCTCTCT
CTCTCTCTCGCAGTCTGCTGCCGATCCCGCCCTCTTGGCCCTCATGGCAAAGGGCAGCGCCCACAACATGGCCCT
CGGCCAGCTGACGGACCTGGACCGCCAGAGCCTCCGTGCAATGCTGGCCCAGATGGACGCCATGAGCAGCCGCAT
CCGCCATGTCTTGGGCCATGACGATAAGCCCCTGACGGCGCCCCTTCCCTCTCTTGAGACTAATGCTCGCACTCC
CATTTCCGAGCCTCCCAGCGCCAACGAGCCGCCAGAAAAGCTAGACGCCATGGATGACGCTCTTGCTGAGCCCAC
GCCCCCCTCTACTGTCGACCACGCCGATGAAGGTTCCATGGACCTGGACTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail