Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|4264
Gene name
LocationContig_282:8693..10646
Strand+
Gene length (bp)1953
Transcript length (bp)1770
Coding sequence length (bp)1770
Protein length (aa) 590

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00149 Metallophos Calcineurin-like phosphoesterase 1.6E-16 217 465

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q05924|DCR2_YEAST Phosphatase DCR2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DCR2 PE=1 SV=1 153 550 1.0E-64
sp|O59759|YJM5_SCHPO Uncharacterized protein C1020.05 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1020.05 PE=3 SV=1 3 531 5.0E-52
sp|Q9FMK9|PPA29_ARATH Probable inactive purple acid phosphatase 29 OS=Arabidopsis thaliana GN=PAP29 PE=2 SV=1 205 531 5.0E-51
sp|Q9LU72|PPA28_ARATH Probable inactive purple acid phosphatase 28 OS=Arabidopsis thaliana GN=PAP28 PE=2 SV=1 188 531 1.0E-41
sp|Q84LR6|PPA14_ARATH Probable inactive purple acid phosphatase 14 OS=Arabidopsis thaliana GN=PAP14 PE=2 SV=1 188 531 3.0E-40
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q05924|DCR2_YEAST Phosphatase DCR2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DCR2 PE=1 SV=1 153 550 1.0E-64
sp|O59759|YJM5_SCHPO Uncharacterized protein C1020.05 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1020.05 PE=3 SV=1 3 531 5.0E-52
sp|Q9FMK9|PPA29_ARATH Probable inactive purple acid phosphatase 29 OS=Arabidopsis thaliana GN=PAP29 PE=2 SV=1 205 531 5.0E-51
sp|Q9LU72|PPA28_ARATH Probable inactive purple acid phosphatase 28 OS=Arabidopsis thaliana GN=PAP28 PE=2 SV=1 188 531 1.0E-41
sp|Q84LR6|PPA14_ARATH Probable inactive purple acid phosphatase 14 OS=Arabidopsis thaliana GN=PAP14 PE=2 SV=1 188 531 3.0E-40
sp|Q6CPQ2|SIA1_KLULA Protein SIA1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=SIA1 PE=3 SV=1 2 529 1.0E-20
sp|Q9SR79|PPA16_ARATH Probable inactive purple acid phosphatase 16 OS=Arabidopsis thaliana GN=PAP16 PE=2 SV=1 210 542 1.0E-19
sp|Q12212|SIA1_YEAST Protein SIA1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SIA1 PE=2 SV=1 117 549 1.0E-18
[Show less]

GO

GO Term Description Terminal node
GO:0016787 hydrolase activity Yes
GO:0003824 catalytic activity No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.5

Transmembrane Domains

Domain # Start End Length
1 5 27 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|4264
MTRRIVRTLTQLAAVVSFTLVVIFLLDRNYRVLPNAIHGYMPTHHPGLVVTDITIATCSSVNVFSSCDLDPTIWH
RIDKELYLGRAWTSRAFLHVSRKHEEDLKADESVVMDVSVGRLDPGIHNDPDDHGKWESRPGGLWIKRSKNKKAS
DSKSAVTNVDVLFGDDAVEARQGWAITGTPLLLNTGGSLLSVHLSIHRGKHKEPKKPKPRIPDNGRFKIMQIADL
HLSNGVGECREPIPNGYAGGKCEADPRTLDFVTKMLDQEKPDFVVLSGDQVNGDTAPDAPTAIFKYASLLSKRKI
PHVGIFGNHDDEKTMSRDRQMALMETLPYSLSSAGPPDVDGIGNYYVEILARGGSDHSALTIYLLDTHAYSPDER
NYPGYDWVKPNQIEWFKRTAASLKKNHAEYTHRHMDIAFIHIPLTEYANPELPRVGTWREGVTAPVFNSGFRDAL
VEEGVVMVSAGHDHCNDYCSLSLQGDPDPAKKQPLTPALWMCYAGGVGFGGYAGYGDYVRRVRLFEVDTNNARIT
TWKRLEHGDVGARIDYSIIVDGGRPVPPPPPPPPPPDAQQQPPPPPPPAAAQAQAQPQQQPPVV*
Coding >OphauB2|4264
ATGACGCGACGAATTGTTCGCACACTTACCCAGCTCGCCGCAGTTGTCTCATTTACGCTCGTCGTCATTTTCCTC
CTCGATCGCAACTACAGAGTGCTTCCCAATGCCATCCACGGCTACATGCCAACGCATCATCCTGGCCTCGTCGTT
ACTGATATCACCATTGCCACGTGCTCGAGCGTAAACGTCTTTTCTTCCTGTGACCTCGACCCTACCATATGGCAT
CGCATTGATAAAGAGCTCTATCTAGGCAGGGCTTGGACCAGTCGCGCATTTCTCCATGTCAGCCGCAAGCATGAA
GAGGACCTCAAGGCCGACGAAAGTGTTGTCATGGACGTGTCGGTTGGTCGGCTCGACCCCGGCATTCACAATGAC
CCTGACGACCACGGCAAGTGGGAGTCACGGCCCGGCGGGCTTTGGATCAAGCGGTCCAAGAATAAAAAGGCAAGC
GACTCCAAGTCGGCCGTCACCAATGTCGACGTCCTTTTTGGCGACGACGCTGTCGAGGCCCGCCAGGGCTGGGCC
ATTACTGGCACGCCTTTGCTGCTGAACACGGGCGGGTCGCTGCTGAGTGTTCATCTAAGCATCCACCGCGGCAAG
CACAAGGAGCCAAAGAAGCCCAAGCCTCGAATCCCAGACAATGGTCGCTTCAAGATTATGCAAATCGCCGACTTG
CATCTCAGCAACGGTGTTGGTGAGTGTCGGGAGCCTATACCAAACGGCTATGCCGGCGGCAAGTGCGAGGCGGAT
CCACGAACACTCGACTTTGTCACCAAGATGCTTGACCAAGAGAAGCCCGACTTTGTCGTTTTGAGTGGAGACCAG
GTCAATGGCGACACTGCTCCAGACGCGCCAACGGCAATCTTCAAGTACGCGTCACTGCTCAGCAAGCGCAAGATA
CCCCACGTTGGCATCTTTGGCAACCATGACGACGAAAAGACCATGTCGCGCGACCGGCAAATGGCCCTCATGGAG
ACGCTTCCCTACTCGCTCTCGTCGGCCGGCCCACCAGACGTTGACGGGATTGGCAACTACTACGTTGAGATTTTG
GCGCGCGGAGGCTCGGACCACTCGGCTCTCACCATTTACCTTTTGGACACGCATGCCTACTCGCCAGACGAGAGA
AACTATCCGGGCTACGACTGGGTCAAGCCCAACCAGATTGAATGGTTTAAGCGCACAGCTGCAAGTCTCAAGAAG
AATCACGCCGAGTACACACACCGGCACATGGATATTGCCTTTATCCACATTCCGCTGACCGAGTACGCCAACCCG
GAGCTGCCGCGCGTCGGCACCTGGCGCGAGGGCGTCACGGCGCCCGTCTTCAACTCGGGATTCCGTGACGCCTTG
GTGGAAGAGGGCGTCGTCATGGTTAGCGCCGGACATGACCATTGCAACGACTATTGCTCTCTGTCTCTCCAAGGG
GACCCAGATCCTGCAAAGAAGCAGCCGCTGACGCCTGCGCTCTGGATGTGCTACGCTGGCGGTGTTGGCTTTGGT
GGCTATGCAGGCTACGGTGACTATGTACGCCGTGTGCGACTGTTCGAGGTGGACACCAACAATGCGCGTATCACG
ACGTGGAAGAGACTGGAACATGGCGACGTTGGGGCGCGCATTGATTATTCAATCATTGTCGATGGTGGCAGACCG
GTGCCGCCGCCGCCACCACCGCCGCCACCGCCAGACGCACAGCAGCAGCCTCCACCGCCTCCTCCTCCTGCTGCT
GCCCAGGCACAGGCACAGCCTCAGCAGCAGCCACCGGTAGTCTAA
Transcript >OphauB2|4264
ATGACGCGACGAATTGTTCGCACACTTACCCAGCTCGCCGCAGTTGTCTCATTTACGCTCGTCGTCATTTTCCTC
CTCGATCGCAACTACAGAGTGCTTCCCAATGCCATCCACGGCTACATGCCAACGCATCATCCTGGCCTCGTCGTT
ACTGATATCACCATTGCCACGTGCTCGAGCGTAAACGTCTTTTCTTCCTGTGACCTCGACCCTACCATATGGCAT
CGCATTGATAAAGAGCTCTATCTAGGCAGGGCTTGGACCAGTCGCGCATTTCTCCATGTCAGCCGCAAGCATGAA
GAGGACCTCAAGGCCGACGAAAGTGTTGTCATGGACGTGTCGGTTGGTCGGCTCGACCCCGGCATTCACAATGAC
CCTGACGACCACGGCAAGTGGGAGTCACGGCCCGGCGGGCTTTGGATCAAGCGGTCCAAGAATAAAAAGGCAAGC
GACTCCAAGTCGGCCGTCACCAATGTCGACGTCCTTTTTGGCGACGACGCTGTCGAGGCCCGCCAGGGCTGGGCC
ATTACTGGCACGCCTTTGCTGCTGAACACGGGCGGGTCGCTGCTGAGTGTTCATCTAAGCATCCACCGCGGCAAG
CACAAGGAGCCAAAGAAGCCCAAGCCTCGAATCCCAGACAATGGTCGCTTCAAGATTATGCAAATCGCCGACTTG
CATCTCAGCAACGGTGTTGGTGAGTGTCGGGAGCCTATACCAAACGGCTATGCCGGCGGCAAGTGCGAGGCGGAT
CCACGAACACTCGACTTTGTCACCAAGATGCTTGACCAAGAGAAGCCCGACTTTGTCGTTTTGAGTGGAGACCAG
GTCAATGGCGACACTGCTCCAGACGCGCCAACGGCAATCTTCAAGTACGCGTCACTGCTCAGCAAGCGCAAGATA
CCCCACGTTGGCATCTTTGGCAACCATGACGACGAAAAGACCATGTCGCGCGACCGGCAAATGGCCCTCATGGAG
ACGCTTCCCTACTCGCTCTCGTCGGCCGGCCCACCAGACGTTGACGGGATTGGCAACTACTACGTTGAGATTTTG
GCGCGCGGAGGCTCGGACCACTCGGCTCTCACCATTTACCTTTTGGACACGCATGCCTACTCGCCAGACGAGAGA
AACTATCCGGGCTACGACTGGGTCAAGCCCAACCAGATTGAATGGTTTAAGCGCACAGCTGCAAGTCTCAAGAAG
AATCACGCCGAGTACACACACCGGCACATGGATATTGCCTTTATCCACATTCCGCTGACCGAGTACGCCAACCCG
GAGCTGCCGCGCGTCGGCACCTGGCGCGAGGGCGTCACGGCGCCCGTCTTCAACTCGGGATTCCGTGACGCCTTG
GTGGAAGAGGGCGTCGTCATGGTTAGCGCCGGACATGACCATTGCAACGACTATTGCTCTCTGTCTCTCCAAGGG
GACCCAGATCCTGCAAAGAAGCAGCCGCTGACGCCTGCGCTCTGGATGTGCTACGCTGGCGGTGTTGGCTTTGGT
GGCTATGCAGGCTACGGTGACTATGTACGCCGTGTGCGACTGTTCGAGGTGGACACCAACAATGCGCGTATCACG
ACGTGGAAGAGACTGGAACATGGCGACGTTGGGGCGCGCATTGATTATTCAATCATTGTCGATGGTGGCAGACCG
GTGCCGCCGCCGCCACCACCGCCGCCACCGCCAGACGCACAGCAGCAGCCTCCACCGCCTCCTCCTCCTGCTGCT
GCCCAGGCACAGGCACAGCCTCAGCAGCAGCCACCGGTAGTCTAA
Gene >OphauB2|4264
ATGACGCGACGAATTGTGAGTCTGGCGCAGGAGAGTGTCTGTTGAAGCATGCTTGTTTTGCTCACGTTGAAATGA
CAGGTTCGCACACTTACCCAGCTCGCCGCAGTTGTCTCATTTACGCTCGTCGTCATTTTCCTCCTCGATCGCAAC
TACAGAGTGCTTCCCAATGCCATCCACGGCTACATGCCAACGCATCATCCTGGCCTCGTCGTTACTGATATCACC
ATTGCCACGTGCTCGAGCGTAAACGTCTTTTCTTCCTGTGACCTCGACCCTACCATATGGCATCGCATTGATAAA
GAGCTCTATCTAGGCAGGGCTTGGACCAGTCGCGCATTTCTCCATGTCAGCCGCAAGCATGAAGAGGACCTCAAG
GCCGACGAAAGTGTTGTCATGGACGTGTCGGTTGGTCGGCTCGACCCCGGCATTCACAATGACCCTGACGACCAC
GGCAAGTGGGAGTCACGGCCCGGCGGGCTTTGGATCAAGCGGTCCAAGAATAAAAAGGCAAGCGACTCCAAGTCG
GCCGTCACCAATGTCGACGTCCTTTTTGGCGACGACGCTGTCGAGGCCCGCCAGGGCTGGGCCATTACTGGCACG
CCTTTGCTGCTGAACACGGGCGGGTCGCTGCTGAGTGTTCATCTAAGCATCCACCGCGGCAAGCACAAGGAGCCA
AAGAAGCCCAAGCCTCGAATCCCAGACAATGGTCGCTTCAAGATTATGCAAATCGCCGACTTGCATCTCAGCAAC
GGTGTTGGTGAGTGTCGGGAGCCTATACCAAACGGCTATGCCGGCGGCAAGTGCGAGGCGGATCCACGAACACTC
GACTTTGTCACCAAGATGCTTGACCAAGAGAAGCCCGACTTTGTCGTTTTGAGTGGAGACCAGGTCAATGGCGAC
ACTGCTCCAGACGCGCCAACGGTGCGACACTCCCAACACTCCCAGCCGCCTGTGGCTACCGCGACTGACTCTTGT
CTAGGCAATCTTCAAGTACGCGTCACTGCTCAGCAAGCGCAAGATACCCCACGTTGGCATCTTTGGCAACCATGA
CGACGAAAAGACCATGTCGCGCGACCGGCAAATGGCCCTCATGGAGACGCTTCCCTACTCGCTCTCGTCGGCCGG
CCCACCAGACGTTGACGGGATTGGCAACTACTACGTTGAGATTTTGGCGCGCGGAGGCTCGGACCACTCGGCTCT
CACCATTTACCTTTTGGACACGCATGCCTACTCGCCAGACGAGAGAAACTATCCGGGCTACGACTGGGTCAAGCC
CAACCAGATTGAATGGTTTAAGCGCACAGCTGCAAGTCTCAAGAAGAATCACGCCGAGTACACACACCGGCACAT
GGATATTGCCTTTATCCACATTCCGCTGACCGAGTACGCCAACCCGGAGCTGCCGCGCGTCGGCACCTGGCGCGA
GGGCGTCACGGCGCCCGTCTTCAACTCGGGATTCCGTGACGCCTTGGTGGAAGAGGGCGTCGTCATGGTTAGCGC
CGGACAGTATGCTTGCCCCCTTGCCCCTTTTGCCCACGTTGCAACAGAATTGGCTGACACGACAGCAGTGACCAT
TGCAACGACTATTGCTCTCTGTCTCTCCAAGGGGACCCAGATCCTGCAAAGAAGCAGCCGCTGACGCCTGCGCTC
TGGATGTGCTACGCTGGCGGTGTTGGCTTTGGTGGCTATGCAGGCTACGGTGACTATGTACGCCGTGTGCGACTG
TTCGAGGTGGACACCAACAATGCGCGTATCACGACGTGGAAGAGACTGGAACATGGCGACGTTGGGGCGCGCATT
GATTATTCAATCATTGTCGATGGTGGCAGACCGGTGCCGCCGCCGCCACCACCGCCGCCACCGCCAGACGCACAG
CAGCAGCCTCCACCGCCTCCTCCTCCTGCTGCTGCCCAGGCACAGGCACAGCCTCAGCAGCAGCCACCGGTAGTC
TAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail