Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|4251
Gene name
LocationContig_28:171588..173258
Strand-
Gene length (bp)1670
Transcript length (bp)1527
Coding sequence length (bp)1527
Protein length (aa) 509

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01479 S4 S4 domain 1.5E-12 158 204

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P27929|NAM9_YEAST 37S ribosomal protein NAM9, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NAM9 PE=1 SV=2 2 220 2.0E-35
sp|O60063|NAM9_SCHPO 37S ribosomal protein S4-like, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=nam9 PE=2 SV=1 1 213 7.0E-18
sp|P27929|NAM9_YEAST 37S ribosomal protein NAM9, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NAM9 PE=1 SV=2 439 508 8.0E-13
sp|O66484|RS4_AQUAE 30S ribosomal protein S4 OS=Aquifex aeolicus (strain VF5) GN=rpsD PE=3 SV=1 150 207 3.0E-10
sp|A4YRT2|RS4_BRASO 30S ribosomal protein S4 OS=Bradyrhizobium sp. (strain ORS278) GN=rpsD PE=3 SV=1 152 207 5.0E-10
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P27929|NAM9_YEAST 37S ribosomal protein NAM9, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NAM9 PE=1 SV=2 2 220 2.0E-35
sp|O60063|NAM9_SCHPO 37S ribosomal protein S4-like, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=nam9 PE=2 SV=1 1 213 7.0E-18
sp|P27929|NAM9_YEAST 37S ribosomal protein NAM9, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NAM9 PE=1 SV=2 439 508 8.0E-13
sp|O66484|RS4_AQUAE 30S ribosomal protein S4 OS=Aquifex aeolicus (strain VF5) GN=rpsD PE=3 SV=1 150 207 3.0E-10
sp|A4YRT2|RS4_BRASO 30S ribosomal protein S4 OS=Bradyrhizobium sp. (strain ORS278) GN=rpsD PE=3 SV=1 152 207 5.0E-10
sp|A5EMG8|RS4_BRASB 30S ribosomal protein S4 OS=Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182) GN=rpsD PE=3 SV=1 152 207 6.0E-10
sp|B8IB09|RS4_METNO 30S ribosomal protein S4 OS=Methylobacterium nodulans (strain ORS2060 / LMG 21967) GN=rpsD PE=3 SV=1 152 207 2.0E-09
sp|A7IMS4|RS4_XANP2 30S ribosomal protein S4 OS=Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2) GN=rpsD PE=3 SV=1 152 207 3.0E-09
sp|B0UDI8|RS4_METS4 30S ribosomal protein S4 OS=Methylobacterium sp. (strain 4-46) GN=rpsD PE=3 SV=1 156 207 8.0E-09
sp|Q3ST14|RS4_NITWN 30S ribosomal protein S4 OS=Nitrobacter winogradskyi (strain Nb-255 / ATCC 25391) GN=rpsD PE=3 SV=1 152 207 1.0E-08
sp|C0QQQ0|RS4_PERMH 30S ribosomal protein S4 OS=Persephonella marina (strain DSM 14350 / EX-H1) GN=rpsD PE=3 SV=1 150 239 1.0E-08
sp|B8D0T6|RS4_HALOH 30S ribosomal protein S4 OS=Halothermothrix orenii (strain H 168 / OCM 544 / DSM 9562) GN=rpsD PE=3 SV=1 152 207 1.0E-08
sp|Q97J08|RS4B_CLOAB Putative 30S ribosomal protein S4 B OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=rpsD2 PE=3 SV=1 151 203 1.0E-08
sp|B5YG23|RS4_THEYD 30S ribosomal protein S4 OS=Thermodesulfovibrio yellowstonii (strain ATCC 51303 / DSM 11347 / YP87) GN=rpsD PE=3 SV=1 156 239 2.0E-08
sp|Q28TU1|RS4_JANSC 30S ribosomal protein S4 OS=Jannaschia sp. (strain CCS1) GN=rpsD PE=3 SV=1 150 207 2.0E-08
sp|Q89ID3|RS4_BRADU 30S ribosomal protein S4 OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=rpsD PE=3 SV=1 152 207 2.0E-08
sp|Q1QMT5|RS4_NITHX 30S ribosomal protein S4 OS=Nitrobacter hamburgensis (strain X14 / DSM 10229) GN=rpsD PE=3 SV=1 152 207 3.0E-08
sp|A6TNW5|RS4C_ALKMQ 30S ribosomal protein S4 C OS=Alkaliphilus metalliredigens (strain QYMF) GN=rpsD3 PE=3 SV=1 150 203 3.0E-08
sp|Q8R7Y1|RS4_CALS4 30S ribosomal protein S4 OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=rpsD PE=3 SV=1 152 207 3.0E-08
sp|B3Q7H1|RS4_RHOPT 30S ribosomal protein S4 OS=Rhodopseudomonas palustris (strain TIE-1) GN=rpsD PE=3 SV=1 152 207 3.0E-08
sp|Q6N9G0|RS4_RHOPA 30S ribosomal protein S4 OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=rpsD PE=1 SV=3 152 207 3.0E-08
sp|A8I889|RS4_AZOC5 30S ribosomal protein S4 OS=Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / NBRC 14845 / NCIMB 13405 / ORS 571) GN=rpsD PE=3 SV=1 152 207 3.0E-08
sp|A3PIA3|RS4_RHOS1 30S ribosomal protein S4 OS=Rhodobacter sphaeroides (strain ATCC 17029 / ATH 2.4.9) GN=rpsD PE=3 SV=1 150 216 4.0E-08
sp|B8EL92|RS4_METSB 30S ribosomal protein S4 OS=Methylocella silvestris (strain BL2 / DSM 15510 / NCIMB 13906) GN=rpsD PE=3 SV=1 152 207 4.0E-08
sp|A4WUP0|RS4_RHOS5 30S ribosomal protein S4 OS=Rhodobacter sphaeroides (strain ATCC 17025 / ATH 2.4.3) GN=rpsD PE=3 SV=1 150 207 4.0E-08
sp|Q2ITR6|RS4_RHOP2 30S ribosomal protein S4 OS=Rhodopseudomonas palustris (strain HaA2) GN=rpsD PE=3 SV=1 152 207 4.0E-08
sp|Q218M1|RS4_RHOPB 30S ribosomal protein S4 OS=Rhodopseudomonas palustris (strain BisB18) GN=rpsD PE=3 SV=1 152 207 4.0E-08
sp|Q3J446|RS4_RHOS4 30S ribosomal protein S4 OS=Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) GN=rpsD PE=3 SV=1 150 216 4.0E-08
sp|B9KPH3|RS4_RHOSK 30S ribosomal protein S4 OS=Rhodobacter sphaeroides (strain KD131 / KCTC 12085) GN=rpsD PE=3 SV=1 150 216 4.0E-08
sp|B0KCM7|RS4_THEP3 30S ribosomal protein S4 OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) GN=rpsD PE=3 SV=1 156 207 4.0E-08
sp|B0K5S0|RS4_THEPX 30S ribosomal protein S4 OS=Thermoanaerobacter sp. (strain X514) GN=rpsD PE=3 SV=1 156 207 4.0E-08
sp|C1CXD5|RS4_DEIDV 30S ribosomal protein S4 OS=Deinococcus deserti (strain VCD115 / DSM 17065 / LMG 22923) GN=rpsD PE=3 SV=1 146 207 5.0E-08
sp|Q0AQX8|RS4_MARMM 30S ribosomal protein S4 OS=Maricaulis maris (strain MCS10) GN=rpsD PE=3 SV=1 150 207 5.0E-08
sp|Q05FK4|RS4_CARRP 30S ribosomal protein S4 OS=Carsonella ruddii (strain PV) GN=rpsD PE=3 SV=1 156 208 5.0E-08
sp|B1M7L0|RS4_METRJ 30S ribosomal protein S4 OS=Methylobacterium radiotolerans (strain ATCC 27329 / DSM 1819 / JCM 2831) GN=rpsD PE=3 SV=1 152 216 6.0E-08
sp|A1BJ08|RS4_CHLPD 30S ribosomal protein S4 OS=Chlorobium phaeobacteroides (strain DSM 266) GN=rpsD PE=3 SV=1 156 206 6.0E-08
sp|Q07R54|RS4_RHOP5 30S ribosomal protein S4 OS=Rhodopseudomonas palustris (strain BisA53) GN=rpsD PE=3 SV=2 152 207 6.0E-08
sp|Q1IX98|RS4_DEIGD 30S ribosomal protein S4 OS=Deinococcus geothermalis (strain DSM 11300) GN=rpsD PE=3 SV=1 146 238 8.0E-08
sp|A0B9L2|RS4_METTP 30S ribosomal protein S4 OS=Methanosaeta thermophila (strain DSM 6194 / JCM 14653 / NBRC 101360 / PT) GN=rps4 PE=3 SV=1 156 208 8.0E-08
sp|Q67JX0|RS4A_SYMTH 30S ribosomal protein S4 A OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=rpsD1 PE=3 SV=1 150 230 1.0E-07
sp|Q13A88|RS4_RHOPS 30S ribosomal protein S4 OS=Rhodopseudomonas palustris (strain BisB5) GN=rpsD PE=3 SV=1 152 207 1.0E-07
sp|Q5X835|RS4_LEGPA 30S ribosomal protein S4 OS=Legionella pneumophila (strain Paris) GN=rpsD PE=3 SV=1 152 207 1.0E-07
sp|B8H053|RS4_CAUCN 30S ribosomal protein S4 OS=Caulobacter crescentus (strain NA1000 / CB15N) GN=rpsD PE=3 SV=1 152 207 1.0E-07
sp|Q9A5D9|RS4_CAUCR 30S ribosomal protein S4 OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=rpsD PE=3 SV=1 152 207 1.0E-07
sp|Q9KXP5|RS4_STRCO 30S ribosomal protein S4 OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=rpsD PE=3 SV=1 156 207 1.0E-07
sp|Q11IV9|RS4_CHESB 30S ribosomal protein S4 OS=Chelativorans sp. (strain BNC1) GN=rpsD PE=3 SV=1 152 207 1.0E-07
sp|B9L6T8|RS4_NAUPA 30S ribosomal protein S4 OS=Nautilia profundicola (strain ATCC BAA-1463 / DSM 18972 / AmH) GN=rpsD PE=3 SV=1 156 207 2.0E-07
sp|B8J886|RS4_ANAD2 30S ribosomal protein S4 OS=Anaeromyxobacter dehalogenans (strain 2CP-1 / ATCC BAA-258) GN=rpsD PE=3 SV=1 152 207 2.0E-07
sp|Q2IJ65|RS4_ANADE 30S ribosomal protein S4 OS=Anaeromyxobacter dehalogenans (strain 2CP-C) GN=rpsD PE=3 SV=1 152 207 2.0E-07
sp|B6JDU6|RS4_OLICO 30S ribosomal protein S4 OS=Oligotropha carboxidovorans (strain ATCC 49405 / DSM 1227 / OM5) GN=rpsD PE=3 SV=1 152 207 2.0E-07
sp|B4UBC5|RS4_ANASK 30S ribosomal protein S4 OS=Anaeromyxobacter sp. (strain K) GN=rpsD PE=3 SV=1 152 207 2.0E-07
sp|Q1GES7|RS4_RUEST 30S ribosomal protein S4 OS=Ruegeria sp. (strain TM1040) GN=rpsD PE=3 SV=1 152 207 2.0E-07
sp|Q1IS94|RS4_KORVE 30S ribosomal protein S4 OS=Koribacter versatilis (strain Ellin345) GN=rpsD PE=3 SV=1 150 226 2.0E-07
sp|A7HM25|RS4_FERNB 30S ribosomal protein S4 OS=Fervidobacterium nodosum (strain ATCC 35602 / DSM 5306 / Rt17-B1) GN=rpsD PE=3 SV=1 152 207 2.0E-07
sp|A5IHP2|RS4_LEGPC 30S ribosomal protein S4 OS=Legionella pneumophila (strain Corby) GN=rpsD PE=3 SV=1 152 207 2.0E-07
sp|Q5LNM2|RS4_RUEPO 30S ribosomal protein S4 OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) GN=rpsD PE=3 SV=1 152 207 2.0E-07
sp|A8LK98|RS4_DINSH 30S ribosomal protein S4 OS=Dinoroseobacter shibae (strain DSM 16493 / NCIMB 14021 / DFL 12) GN=rpsD PE=3 SV=1 152 207 2.0E-07
sp|A4SCT5|RS4_CHLPM 30S ribosomal protein S4 OS=Chlorobium phaeovibrioides (strain DSM 265 / 1930) GN=rpsD PE=3 SV=1 156 206 2.0E-07
sp|Q5ZYL9|RS4_LEGPH 30S ribosomal protein S4 OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) GN=rpsD PE=3 SV=1 152 207 2.0E-07
sp|Q5WZI8|RS4_LEGPL 30S ribosomal protein S4 OS=Legionella pneumophila (strain Lens) GN=rpsD PE=3 SV=1 152 207 2.0E-07
sp|O60063|NAM9_SCHPO 37S ribosomal protein S4-like, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=nam9 PE=2 SV=1 450 505 3.0E-07
sp|Q9RSJ7|RS4_DEIRA 30S ribosomal protein S4 OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=rpsD PE=3 SV=1 146 238 3.0E-07
sp|B1ZAP8|RS4_METPB 30S ribosomal protein S4 OS=Methylobacterium populi (strain ATCC BAA-705 / NCIMB 13946 / BJ001) GN=rpsD PE=3 SV=1 152 207 3.0E-07
sp|Q3APJ9|RS4_CHLCH 30S ribosomal protein S4 OS=Chlorobium chlorochromatii (strain CaD3) GN=rpsD PE=3 SV=1 156 206 4.0E-07
sp|B9MKF4|RS4_CALBD 30S ribosomal protein S4 OS=Caldicellulosiruptor bescii (strain ATCC BAA-1888 / DSM 6725 / Z-1320) GN=rpsD PE=3 SV=1 152 208 4.0E-07
sp|Q8XHW7|RS4B_CLOPE Putative 30S ribosomal protein S4 B OS=Clostridium perfringens (strain 13 / Type A) GN=rpsD2 PE=3 SV=1 152 203 4.0E-07
sp|Q0SQI8|RS4B_CLOPS 30S ribosomal protein S4 B OS=Clostridium perfringens (strain SM101 / Type A) GN=rpsD2 PE=3 SV=1 152 203 4.0E-07
sp|Q0TMU2|RS4B_CLOP1 30S ribosomal protein S4 B OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) GN=rpsD2 PE=3 SV=1 152 203 4.0E-07
sp|C5CGH5|RS4_KOSOT 30S ribosomal protein S4 OS=Kosmotoga olearia (strain TBF 19.5.1) GN=rpsD PE=3 SV=1 156 207 4.0E-07
sp|A6TSI5|RS4B_ALKMQ 30S ribosomal protein S4 B OS=Alkaliphilus metalliredigens (strain QYMF) GN=rpsD2 PE=3 SV=1 152 211 4.0E-07
sp|B7KVN1|RS4_METC4 30S ribosomal protein S4 OS=Methylobacterium extorquens (strain CM4 / NCIMB 13688) GN=rpsD PE=3 SV=1 152 207 4.0E-07
sp|A9W966|RS4_METEP 30S ribosomal protein S4 OS=Methylobacterium extorquens (strain PA1) GN=rpsD PE=3 SV=1 152 207 4.0E-07
sp|B3EP35|RS4_CHLPB 30S ribosomal protein S4 OS=Chlorobium phaeobacteroides (strain BS1) GN=rpsD PE=3 SV=1 156 206 5.0E-07
sp|B0RZT8|RS4_FINM2 30S ribosomal protein S4 OS=Finegoldia magna (strain ATCC 29328) GN=rpsD PE=3 SV=1 156 207 5.0E-07
sp|Q5FQ27|RS4_GLUOX 30S ribosomal protein S4 OS=Gluconobacter oxydans (strain 621H) GN=rpsD PE=3 SV=1 152 207 6.0E-07
sp|B1W3H7|RS4_STRGG 30S ribosomal protein S4 OS=Streptomyces griseus subsp. griseus (strain JCM 4626 / NBRC 13350) GN=rpsD PE=3 SV=1 150 207 6.0E-07
sp|Q0W1V5|RS4_METAR 30S ribosomal protein S4 OS=Methanocella arvoryzae (strain DSM 22066 / NBRC 105507 / MRE50) GN=rps4 PE=3 SV=1 156 199 6.0E-07
sp|B3EGW4|RS4_CHLL2 30S ribosomal protein S4 OS=Chlorobium limicola (strain DSM 245 / NBRC 103803) GN=rpsD PE=3 SV=1 156 206 6.0E-07
sp|Q97IP6|RS4C_CLOAB Putative 30S ribosomal protein S4 C OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=rpsD3 PE=3 SV=1 156 204 7.0E-07
sp|Q2S936|RS4_HAHCH 30S ribosomal protein S4 OS=Hahella chejuensis (strain KCTC 2396) GN=rpsD PE=3 SV=1 152 207 7.0E-07
sp|Q827S7|RS4_STRAW 30S ribosomal protein S4 OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=rpsD PE=3 SV=1 156 207 8.0E-07
sp|Q2RFS5|RS4_MOOTA 30S ribosomal protein S4 OS=Moorella thermoacetica (strain ATCC 39073) GN=rpsD PE=3 SV=1 152 207 8.0E-07
sp|Q3A6M1|RS4_PELCD 30S ribosomal protein S4 OS=Pelobacter carbinolicus (strain DSM 2380 / Gra Bd 1) GN=rpsD PE=3 SV=1 152 207 8.0E-07
sp|B4RHE8|RS4_PHEZH 30S ribosomal protein S4 OS=Phenylobacterium zucineum (strain HLK1) GN=rpsD PE=3 SV=1 152 207 8.0E-07
sp|A6U9M8|RS4_SINMW 30S ribosomal protein S4 OS=Sinorhizobium medicae (strain WSM419) GN=rpsD PE=3 SV=1 156 207 1.0E-06
sp|A7HWA8|RS4_PARL1 30S ribosomal protein S4 OS=Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966) GN=rpsD PE=3 SV=1 150 207 1.0E-06
sp|B2IJM5|RS4_BEII9 30S ribosomal protein S4 OS=Beijerinckia indica subsp. indica (strain ATCC 9039 / DSM 1715 / NCIB 8712) GN=rpsD PE=3 SV=1 152 207 1.0E-06
sp|Q92PG9|RS4_RHIME 30S ribosomal protein S4 OS=Rhizobium meliloti (strain 1021) GN=rpsD PE=3 SV=1 156 207 1.0E-06
sp|Q163G0|RS4_ROSDO 30S ribosomal protein S4 OS=Roseobacter denitrificans (strain ATCC 33942 / OCh 114) GN=rpsD PE=3 SV=1 152 207 1.0E-06
sp|Q0P3N2|RR4_OSTTA 30S ribosomal protein S4, chloroplastic OS=Ostreococcus tauri GN=rps4 PE=3 SV=1 147 206 1.0E-06
sp|Q0BUS6|RS4_GRABC 30S ribosomal protein S4 OS=Granulibacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1) GN=rpsD PE=3 SV=2 156 207 1.0E-06
sp|Q2YAX3|RS4_NITMU 30S ribosomal protein S4 OS=Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849) GN=rpsD PE=3 SV=1 156 238 2.0E-06
sp|B4S5A2|RS4_PROA2 30S ribosomal protein S4 OS=Prosthecochloris aestuarii (strain DSM 271 / SK 413) GN=rpsD PE=3 SV=1 156 206 2.0E-06
sp|Q6AP44|RS4_DESPS 30S ribosomal protein S4 OS=Desulfotalea psychrophila (strain LSv54 / DSM 12343) GN=rpsD PE=3 SV=1 152 207 2.0E-06
sp|Q7NFF4|RS4_GLOVI 30S ribosomal protein S4 OS=Gloeobacter violaceus (strain PCC 7421) GN=rpsD PE=3 SV=1 156 207 2.0E-06
sp|A6UW05|RS4_META3 30S ribosomal protein S4 OS=Methanococcus aeolicus (strain Nankai-3 / ATCC BAA-1280) GN=rps4 PE=3 SV=1 156 199 2.0E-06
sp|Q3B6D7|RS4_CHLL7 30S ribosomal protein S4 OS=Chlorobium luteolum (strain DSM 273 / 2530) GN=rpsD PE=3 SV=1 156 206 2.0E-06
sp|Q9X1I3|RS4_THEMA 30S ribosomal protein S4 OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=rpsD PE=3 SV=1 156 207 2.0E-06
sp|B2V7I6|RS4_SULSY 30S ribosomal protein S4 OS=Sulfurihydrogenibium sp. (strain YO3AOP1) GN=rpsD PE=3 SV=1 151 239 3.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0003723 RNA binding Yes
GO:0003674 molecular_function No
GO:0005488 binding No
GO:1901363 heterocyclic compound binding No
GO:0097159 organic cyclic compound binding No
GO:0003676 nucleic acid binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 13 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|4251
MRKPQRFHNLFRPKVRQSWNKHNLYNIWNRAAREPLVRTPRTFFQQKWAAKSKGRGYHGEHVPEKMWMRLFSPRL
RSVVDMPPQYLAAYDGSEQAAGRGSGLTTLDVSAATYTKTPPLTFSARPSATSLSNSNVNMLLADQHCKMTPYMQ
MIFAPLERRLDTAIFRALFASSVREARQFVIRGAVKVNGQKMRHPTYMLNPGDMFQVDIDLVMWATGEQKSGDSH
TRLKENLVAREKRSQRFLAKTRDEAPPAAEASPAAEAPADKEAASPETAPEPPSAEELKKKERGTLKYLLKNVKK
ILEHSRKEFSAKEKKQLRLFRSDLKHFLPRASGQEATALGLVKGLSERLQSHELLRESVETAKSMAQDQEGSDET
DADKAKQQEKDKPIDKLAMEKDLAGLSESQKKRAVRIMSDAHLSRQEIRELARILQDDERNPVDESKPYATPWRP
RQYMAPFAFIPRYLEVNPNICAAVYLRHPVARQTMAEVPTPFNYLTNQLTHSWYTERG*
Coding >OphauB2|4251
ATGCGCAAACCCCAAAGATTTCACAATCTTTTCCGGCCGAAAGTACGGCAATCGTGGAACAAGCACAATCTCTAC
AACATATGGAACCGTGCGGCCCGCGAACCTCTAGTCCGCACCCCTCGCACCTTTTTCCAGCAGAAATGGGCAGCC
AAGTCCAAGGGTCGAGGATACCATGGCGAACACGTGCCCGAAAAGATGTGGATGCGTCTCTTTTCCCCGCGGCTG
AGGTCTGTTGTCGACATGCCTCCGCAGTATCTTGCTGCCTATGACGGCTCTGAGCAGGCTGCTGGTCGTGGCTCT
GGCTTGACGACGCTCGACGTTTCCGCCGCAACCTACACCAAGACGCCCCCCTTGACCTTTTCCGCCAGACCGTCT
GCTACCTCGCTGTCCAATAGCAATGTCAACATGTTGCTAGCAGACCAACACTGCAAAATGACTCCCTATATGCAA
ATGATTTTTGCGCCCCTTGAGCGCAGACTGGACACGGCCATTTTCCGAGCTCTGTTTGCCAGCAGCGTCCGCGAG
GCGCGTCAGTTTGTTATCCGTGGTGCCGTCAAGGTCAATGGCCAAAAAATGCGCCATCCGACATATATGCTCAAT
CCAGGCGACATGTTCCAGGTGGATATCGACTTGGTAATGTGGGCGACGGGCGAGCAAAAGTCGGGAGACTCTCAC
ACGAGACTCAAGGAAAACCTTGTGGCTCGGGAAAAGAGAAGCCAACGTTTTCTCGCCAAGACTAGAGACGAGGCG
CCGCCAGCCGCAGAGGCATCGCCAGCCGCAGAGGCGCCGGCCGACAAGGAAGCTGCCAGCCCAGAGACTGCCCCC
GAGCCTCCGAGTGCCGAGGAGCTCAAGAAAAAGGAGCGAGGCACGCTCAAGTATCTGTTGAAAAATGTCAAGAAG
ATTTTGGAGCATAGCCGCAAAGAGTTTTCGGCCAAGGAAAAGAAGCAGCTGCGTCTGTTTAGATCAGATCTTAAG
CACTTTTTGCCGCGCGCCAGCGGACAAGAGGCAACGGCCCTTGGCCTGGTCAAGGGGCTTTCGGAGCGACTGCAG
AGCCATGAGCTTCTACGCGAAAGCGTCGAGACGGCCAAGAGCATGGCGCAGGACCAAGAGGGATCCGACGAGACG
GATGCCGACAAGGCCAAGCAACAAGAAAAAGACAAGCCGATTGACAAGCTCGCCATGGAAAAGGATTTGGCAGGA
TTGTCCGAGTCGCAAAAGAAGCGGGCGGTGCGCATCATGAGCGACGCACACTTGTCACGGCAAGAGATTCGCGAG
CTTGCCAGGATTTTGCAAGACGACGAGCGAAACCCAGTGGACGAAAGCAAGCCGTATGCGACGCCATGGAGGCCG
CGGCAATACATGGCGCCCTTTGCCTTTATCCCGCGCTATCTCGAAGTCAACCCCAATATCTGTGCGGCCGTCTAT
CTCCGACACCCAGTGGCACGACAAACCATGGCAGAGGTTCCGACGCCATTCAACTACCTGACGAACCAGCTTACA
CATAGTTGGTACACGGAGCGAGGATGA
Transcript >OphauB2|4251
ATGCGCAAACCCCAAAGATTTCACAATCTTTTCCGGCCGAAAGTACGGCAATCGTGGAACAAGCACAATCTCTAC
AACATATGGAACCGTGCGGCCCGCGAACCTCTAGTCCGCACCCCTCGCACCTTTTTCCAGCAGAAATGGGCAGCC
AAGTCCAAGGGTCGAGGATACCATGGCGAACACGTGCCCGAAAAGATGTGGATGCGTCTCTTTTCCCCGCGGCTG
AGGTCTGTTGTCGACATGCCTCCGCAGTATCTTGCTGCCTATGACGGCTCTGAGCAGGCTGCTGGTCGTGGCTCT
GGCTTGACGACGCTCGACGTTTCCGCCGCAACCTACACCAAGACGCCCCCCTTGACCTTTTCCGCCAGACCGTCT
GCTACCTCGCTGTCCAATAGCAATGTCAACATGTTGCTAGCAGACCAACACTGCAAAATGACTCCCTATATGCAA
ATGATTTTTGCGCCCCTTGAGCGCAGACTGGACACGGCCATTTTCCGAGCTCTGTTTGCCAGCAGCGTCCGCGAG
GCGCGTCAGTTTGTTATCCGTGGTGCCGTCAAGGTCAATGGCCAAAAAATGCGCCATCCGACATATATGCTCAAT
CCAGGCGACATGTTCCAGGTGGATATCGACTTGGTAATGTGGGCGACGGGCGAGCAAAAGTCGGGAGACTCTCAC
ACGAGACTCAAGGAAAACCTTGTGGCTCGGGAAAAGAGAAGCCAACGTTTTCTCGCCAAGACTAGAGACGAGGCG
CCGCCAGCCGCAGAGGCATCGCCAGCCGCAGAGGCGCCGGCCGACAAGGAAGCTGCCAGCCCAGAGACTGCCCCC
GAGCCTCCGAGTGCCGAGGAGCTCAAGAAAAAGGAGCGAGGCACGCTCAAGTATCTGTTGAAAAATGTCAAGAAG
ATTTTGGAGCATAGCCGCAAAGAGTTTTCGGCCAAGGAAAAGAAGCAGCTGCGTCTGTTTAGATCAGATCTTAAG
CACTTTTTGCCGCGCGCCAGCGGACAAGAGGCAACGGCCCTTGGCCTGGTCAAGGGGCTTTCGGAGCGACTGCAG
AGCCATGAGCTTCTACGCGAAAGCGTCGAGACGGCCAAGAGCATGGCGCAGGACCAAGAGGGATCCGACGAGACG
GATGCCGACAAGGCCAAGCAACAAGAAAAAGACAAGCCGATTGACAAGCTCGCCATGGAAAAGGATTTGGCAGGA
TTGTCCGAGTCGCAAAAGAAGCGGGCGGTGCGCATCATGAGCGACGCACACTTGTCACGGCAAGAGATTCGCGAG
CTTGCCAGGATTTTGCAAGACGACGAGCGAAACCCAGTGGACGAAAGCAAGCCGTATGCGACGCCATGGAGGCCG
CGGCAATACATGGCGCCCTTTGCCTTTATCCCGCGCTATCTCGAAGTCAACCCCAATATCTGTGCGGCCGTCTAT
CTCCGACACCCAGTGGCACGACAAACCATGGCAGAGGTTCCGACGCCATTCAACTACCTGACGAACCAGCTTACA
CATAGTTGGTACACGGAGCGAGGATGA
Gene >OphauB2|4251
ATGCGCAAACCCCAAAGATTTCACAATCTTTTCCGGCCGGTAAGTCTAGCCTCGCAATGCCGACAATGTTCAACG
GCCGATTTGGGCGCTGACGCAAGCAACGACGCGGCAAAGAAAGTACGGCAATCGTGGAACAAGCACAATCTCTAC
AACATATGGAACCGTGCGGCCCGCGAACCTCTAGTCCGCACCCCTCGCACCTTTTTCCAGCAGAAATGGGCAGCC
AAGTCCAAGGGTCGAGGATACCATGGCGAACACGTGCCCGAAAAGATGTGGATGCGTCTCTTTTCCCCGCGGCTG
AGGTCTGTTGTCGACATGCCTCCGCAGTATCTTGCTGCCTATGACGGCTCTGAGCAGGCTGCTGGTCGTGGCTCT
GGCTTGACGACGCTCGACGTTTCCGCCGCAACCTACACCAAGACGCCCCCCTTGACCTTTTCCGCCAGACCGTCT
GCTACCTCGCTGTCCAATAGCAATGTCAACATGTTGCTAGCAGACCAACACTGCAAAATGACTCCCTATATGCAA
ATGATTTTTGCGCCCCTTGAGCGCAGACTGGACACGGCCATTTTCCGAGCTCTGTTTGCCAGCAGCGTCCGCGAG
GCGCGTCAGTTTGTTATCCGTGGTGCCGTCAAGGTCAATGGCCAAAAAGTGAGCATCATTGGCCTTCTCTTGGCT
CCTCGTGGGCCATTTATTCTTACTCACCCGTCCATGTACAGATGCGCCATCCGACATATATGCTCAATCCAGGCG
ACATGTTCCAGGTGGATATCGACTTGGTAATGTGGGCGACGGGCGAGCAAAAGTCGGGAGACTCTCACACGAGAC
TCAAGGAAAACCTTGTGGCTCGGGAAAAGAGAAGCCAACGTTTTCTCGCCAAGACTAGAGACGAGGCGCCGCCAG
CCGCAGAGGCATCGCCAGCCGCAGAGGCGCCGGCCGACAAGGAAGCTGCCAGCCCAGAGACTGCCCCCGAGCCTC
CGAGTGCCGAGGAGCTCAAGAAAAAGGAGCGAGGCACGCTCAAGTATCTGTTGAAAAATGTCAAGAAGATTTTGG
AGCATAGCCGCAAAGAGTTTTCGGCCAAGGAAAAGAAGCAGCTGCGTCTGTTTAGATCAGATCTTAAGCACTTTT
TGCCGCGCGCCAGCGGACAAGAGGCAACGGCCCTTGGCCTGGTCAAGGGGCTTTCGGAGCGACTGCAGAGCCATG
AGCTTCTACGCGAAAGCGTCGAGACGGCCAAGAGCATGGCGCAGGACCAAGAGGGATCCGACGAGACGGATGCCG
ACAAGGCCAAGCAACAAGAAAAAGACAAGCCGATTGACAAGCTCGCCATGGAAAAGGATTTGGCAGGATTGTCCG
AGTCGCAAAAGAAGCGGGCGGTGCGCATCATGAGCGACGCACACTTGTCACGGCAAGAGATTCGCGAGCTTGCCA
GGATTTTGCAAGACGACGAGCGAAACCCAGTGGACGAAAGCAAGCCGTATGCGACGCCATGGAGGCCGCGGCAAT
ACATGGCGCCCTTTGCCTTTATCCCGCGCTATCTCGAAGTCAACCCCAATATCTGTGCGGCCGTCTATCTCCGAC
ACCCAGTGGCACGACAAACCATGGCAGAGGTTCCGACGCCATTCAACTACCTGACGAACCAGCTTACACATAGTT
GGTACACGGAGCGAGGATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail