Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|4249
Gene name
LocationContig_28:167483..168467
Strand-
Gene length (bp)984
Transcript length (bp)984
Coding sequence length (bp)984
Protein length (aa) 328

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P28349|NIT4_NEUCR Nitrogen assimilation transcription factor nit-4 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=nit-4 PE=3 SV=2 1 177 3.0E-69
sp|P28348|NIRA_EMENI Nitrogen assimilation transcription factor nirA OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=nirA PE=3 SV=1 1 138 2.0E-54

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 24 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|4249
MFFHLQYIHLFRPFLKYRPSASPLPPHVSPRRICTAHAAAISKLMRLYKRCYNLRQICNIAVYMTHSACTIHLLN
LPDKTARRDMIHGVKHLEEIAHDWLCARRTLSILSVLARKWQCSVPDEAAAVLRRTDELYGSYSTSDVPTPRSSA
SPQAGLDEALGKSNANSPREYSPMSHYVRGHVAAAAAASASSCFTSRSMLRPGGLDGTTEMDVYAAPTTTEPILP
AWTTGDATTTTISANANPLLAPGSLAPAPPPLPLDMHVNGQSWIMQDCARWQQNFEAWDLGAGAGVEGVYCFAQE
LKTNEAPEEAALSGPVLNDLQWYAALE*
Coding >OphauB2|4249
ATGTTTTTCCACCTGCAATACATTCACCTCTTTCGCCCCTTTCTCAAATACCGTCCCTCGGCCTCGCCTCTGCCG
CCGCACGTGTCCCCACGACGCATCTGCACGGCGCACGCGGCCGCCATATCCAAGCTGATGCGGCTGTACAAGCGG
TGCTACAATTTGCGGCAAATCTGCAACATTGCCGTCTACATGACGCACAGCGCGTGCACCATTCACCTGCTCAAC
CTGCCCGACAAGACGGCACGGCGCGACATGATTCACGGCGTCAAGCACCTGGAAGAGATTGCGCACGACTGGCTG
TGTGCGCGGCGCACGCTGAGCATTTTGAGCGTGCTGGCGCGCAAGTGGCAGTGCAGCGTGCCCGACGAGGCGGCG
GCGGTGCTGCGGCGCACAGACGAGCTCTATGGCTCGTATAGCACGTCTGACGTGCCGACGCCGCGGTCGAGTGCG
TCGCCGCAAGCAGGGCTGGATGAGGCGCTTGGCAAGTCGAATGCGAATTCGCCGCGCGAGTATAGTCCCATGAGT
CACTATGTGCGCGGACACGTTGCTGCTGCTGCTGCTGCTTCTGCTTCTTCTTGTTTTACGTCACGGTCTATGCTA
CGGCCAGGCGGCCTAGACGGGACTACAGAAATGGACGTGTATGCCGCGCCAACCACGACGGAGCCTATACTACCA
GCCTGGACGACGGGCGACGCCACCACCACCACAATAAGTGCGAATGCGAATCCCCTCCTTGCTCCGGGCTCACTG
GCACCAGCACCGCCGCCGCTGCCGCTTGACATGCACGTCAATGGCCAGTCTTGGATAATGCAAGACTGTGCGCGG
TGGCAGCAAAACTTTGAGGCGTGGGACCTGGGCGCCGGCGCAGGAGTAGAGGGCGTGTATTGCTTTGCACAAGAG
CTCAAGACGAATGAAGCGCCAGAAGAAGCAGCATTATCGGGGCCAGTGCTAAATGATTTGCAGTGGTATGCGGCG
CTCGAGTAG
Transcript >OphauB2|4249
ATGTTTTTCCACCTGCAATACATTCACCTCTTTCGCCCCTTTCTCAAATACCGTCCCTCGGCCTCGCCTCTGCCG
CCGCACGTGTCCCCACGACGCATCTGCACGGCGCACGCGGCCGCCATATCCAAGCTGATGCGGCTGTACAAGCGG
TGCTACAATTTGCGGCAAATCTGCAACATTGCCGTCTACATGACGCACAGCGCGTGCACCATTCACCTGCTCAAC
CTGCCCGACAAGACGGCACGGCGCGACATGATTCACGGCGTCAAGCACCTGGAAGAGATTGCGCACGACTGGCTG
TGTGCGCGGCGCACGCTGAGCATTTTGAGCGTGCTGGCGCGCAAGTGGCAGTGCAGCGTGCCCGACGAGGCGGCG
GCGGTGCTGCGGCGCACAGACGAGCTCTATGGCTCGTATAGCACGTCTGACGTGCCGACGCCGCGGTCGAGTGCG
TCGCCGCAAGCAGGGCTGGATGAGGCGCTTGGCAAGTCGAATGCGAATTCGCCGCGCGAGTATAGTCCCATGAGT
CACTATGTGCGCGGACACGTTGCTGCTGCTGCTGCTGCTTCTGCTTCTTCTTGTTTTACGTCACGGTCTATGCTA
CGGCCAGGCGGCCTAGACGGGACTACAGAAATGGACGTGTATGCCGCGCCAACCACGACGGAGCCTATACTACCA
GCCTGGACGACGGGCGACGCCACCACCACCACAATAAGTGCGAATGCGAATCCCCTCCTTGCTCCGGGCTCACTG
GCACCAGCACCGCCGCCGCTGCCGCTTGACATGCACGTCAATGGCCAGTCTTGGATAATGCAAGACTGTGCGCGG
TGGCAGCAAAACTTTGAGGCGTGGGACCTGGGCGCCGGCGCAGGAGTAGAGGGCGTGTATTGCTTTGCACAAGAG
CTCAAGACGAATGAAGCGCCAGAAGAAGCAGCATTATCGGGGCCAGTGCTAAATGATTTGCAGTGGTATGCGGCG
CTCGAGTAG
Gene >OphauB2|4249
ATGTTTTTCCACCTGCAATACATTCACCTCTTTCGCCCCTTTCTCAAATACCGTCCCTCGGCCTCGCCTCTGCCG
CCGCACGTGTCCCCACGACGCATCTGCACGGCGCACGCGGCCGCCATATCCAAGCTGATGCGGCTGTACAAGCGG
TGCTACAATTTGCGGCAAATCTGCAACATTGCCGTCTACATGACGCACAGCGCGTGCACCATTCACCTGCTCAAC
CTGCCCGACAAGACGGCACGGCGCGACATGATTCACGGCGTCAAGCACCTGGAAGAGATTGCGCACGACTGGCTG
TGTGCGCGGCGCACGCTGAGCATTTTGAGCGTGCTGGCGCGCAAGTGGCAGTGCAGCGTGCCCGACGAGGCGGCG
GCGGTGCTGCGGCGCACAGACGAGCTCTATGGCTCGTATAGCACGTCTGACGTGCCGACGCCGCGGTCGAGTGCG
TCGCCGCAAGCAGGGCTGGATGAGGCGCTTGGCAAGTCGAATGCGAATTCGCCGCGCGAGTATAGTCCCATGAGT
CACTATGTGCGCGGACACGTTGCTGCTGCTGCTGCTGCTTCTGCTTCTTCTTGTTTTACGTCACGGTCTATGCTA
CGGCCAGGCGGCCTAGACGGGACTACAGAAATGGACGTGTATGCCGCGCCAACCACGACGGAGCCTATACTACCA
GCCTGGACGACGGGCGACGCCACCACCACCACAATAAGTGCGAATGCGAATCCCCTCCTTGCTCCGGGCTCACTG
GCACCAGCACCGCCGCCGCTGCCGCTTGACATGCACGTCAATGGCCAGTCTTGGATAATGCAAGACTGTGCGCGG
TGGCAGCAAAACTTTGAGGCGTGGGACCTGGGCGCCGGCGCAGGAGTAGAGGGCGTGTATTGCTTTGCACAAGAG
CTCAAGACGAATGAAGCGCCAGAAGAAGCAGCATTATCGGGGCCAGTGCTAAATGATTTGCAGTGGTATGCGGCG
CTCGAGTAG

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail