Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|4245
Gene name
LocationContig_28:160779..162273
Strand+
Gene length (bp)1494
Transcript length (bp)1443
Coding sequence length (bp)1443
Protein length (aa) 481

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01979 Amidohydro_1 Amidohydrolase family 6.0E-70 84 471

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q07729|GUAD_YEAST Probable guanine deaminase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GUD1 PE=1 SV=1 9 472 1.0E-129
sp|O14057|GUAD_SCHPO Probable guanine deaminase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1672.03c PE=3 SV=1 12 480 3.0E-111
sp|Q86AW9|GUAD_DICDI Guanine deaminase OS=Dictyostelium discoideum GN=guaD PE=1 SV=1 12 471 5.0E-98
sp|Q9Y2T3|GUAD_HUMAN Guanine deaminase OS=Homo sapiens GN=GDA PE=1 SV=1 12 471 3.0E-96
sp|Q5RAV9|GUAD_PONAB Guanine deaminase OS=Pongo abelii GN=GDA PE=2 SV=1 12 471 9.0E-95
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q07729|GUAD_YEAST Probable guanine deaminase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GUD1 PE=1 SV=1 9 472 1.0E-129
sp|O14057|GUAD_SCHPO Probable guanine deaminase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1672.03c PE=3 SV=1 12 480 3.0E-111
sp|Q86AW9|GUAD_DICDI Guanine deaminase OS=Dictyostelium discoideum GN=guaD PE=1 SV=1 12 471 5.0E-98
sp|Q9Y2T3|GUAD_HUMAN Guanine deaminase OS=Homo sapiens GN=GDA PE=1 SV=1 12 471 3.0E-96
sp|Q5RAV9|GUAD_PONAB Guanine deaminase OS=Pongo abelii GN=GDA PE=2 SV=1 12 471 9.0E-95
sp|Q9WTT6|GUAD_RAT Guanine deaminase OS=Rattus norvegicus GN=Gda PE=1 SV=1 1 471 3.0E-93
sp|Q9R111|GUAD_MOUSE Guanine deaminase OS=Mus musculus GN=Gda PE=1 SV=1 11 471 9.0E-93
sp|Q9RYX4|GUAD_DEIRA Probable guanine deaminase OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=guaD PE=3 SV=1 82 474 2.0E-50
sp|P76641|GUAD_ECOLI Guanine deaminase OS=Escherichia coli (strain K12) GN=guaD PE=1 SV=1 86 474 3.0E-49
sp|A6UUG9|DADD_META3 5'-deoxyadenosine deaminase OS=Methanococcus aeolicus (strain Nankai-3 / ATCC BAA-1280) GN=dadD PE=3 SV=1 79 427 8.0E-28
sp|Q58936|DADD_METJA 5'-deoxyadenosine deaminase OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=dadD PE=1 SV=1 53 437 1.0E-26
sp|Q67NQ5|MTAD_SYMTH 5-methylthioadenosine/S-adenosylhomocysteine deaminase OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=mtaD PE=3 SV=1 83 433 2.0E-26
sp|Q72B14|MTAD_DESVH 5-methylthioadenosine/S-adenosylhomocysteine deaminase OS=Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / NCIMB 8303) GN=mtaD PE=3 SV=1 26 428 9.0E-26
sp|A1VD37|MTAD_DESVV 5-methylthioadenosine/S-adenosylhomocysteine deaminase OS=Desulfovibrio vulgaris subsp. vulgaris (strain DP4) GN=mtaD PE=3 SV=1 26 428 3.0E-25
sp|Q8TYD4|DADD_METKA 5'-deoxyadenosine deaminase OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) GN=dadD PE=3 SV=1 10 434 4.0E-25
sp|B7HIQ2|MTAD_BACC4 5-methylthioadenosine/S-adenosylhomocysteine deaminase OS=Bacillus cereus (strain B4264) GN=mtaD PE=3 SV=1 73 414 2.0E-24
sp|C1EPN0|MTAD_BACC3 5-methylthioadenosine/S-adenosylhomocysteine deaminase OS=Bacillus cereus (strain 03BB102) GN=mtaD PE=3 SV=1 73 414 3.0E-24
sp|B7HMN9|MTAD_BACC7 5-methylthioadenosine/S-adenosylhomocysteine deaminase OS=Bacillus cereus (strain AH187) GN=mtaD PE=3 SV=1 73 414 4.0E-24
sp|A0RCM7|MTAD_BACAH 5-methylthioadenosine/S-adenosylhomocysteine deaminase OS=Bacillus thuringiensis (strain Al Hakam) GN=mtaD PE=3 SV=2 73 414 5.0E-24
sp|Q6HK87|MTAD_BACHK 5-methylthioadenosine/S-adenosylhomocysteine deaminase OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=mtaD PE=3 SV=1 73 414 5.0E-24
sp|Q63CU1|MTAD_BACCZ 5-methylthioadenosine/S-adenosylhomocysteine deaminase OS=Bacillus cereus (strain ZK / E33L) GN=mtaD PE=3 SV=2 73 414 5.0E-24
sp|Q2NHL6|DADD_METST 5'-deoxyadenosine deaminase OS=Methanosphaera stadtmanae (strain ATCC 43021 / DSM 3091 / JCM 11832 / MCB-3) GN=dadD PE=3 SV=1 79 427 6.0E-24
sp|Q2LTB7|MTAD1_SYNAS 5-methylthioadenosine/S-adenosylhomocysteine deaminase 1 OS=Syntrophus aciditrophicus (strain SB) GN=mtaD1 PE=3 SV=1 79 471 1.0E-23
sp|Q2FRU6|DADD_METHJ 5'-deoxyadenosine deaminase OS=Methanospirillum hungatei JF-1 (strain ATCC 27890 / DSM 864 / NBRC 100397 / JF-1) GN=dadD PE=3 SV=1 82 427 2.0E-23
sp|B7JJI0|MTAD_BACC0 5-methylthioadenosine/S-adenosylhomocysteine deaminase OS=Bacillus cereus (strain AH820) GN=mtaD PE=3 SV=1 73 414 2.0E-23
sp|Q81S14|MTAD_BACAN 5-methylthioadenosine/S-adenosylhomocysteine deaminase OS=Bacillus anthracis GN=mtaD PE=3 SV=1 73 414 2.0E-23
sp|C3L6N3|MTAD_BACAC 5-methylthioadenosine/S-adenosylhomocysteine deaminase OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=mtaD PE=3 SV=1 73 414 2.0E-23
sp|C3P768|MTAD_BACAA 5-methylthioadenosine/S-adenosylhomocysteine deaminase OS=Bacillus anthracis (strain A0248) GN=mtaD PE=3 SV=1 73 414 2.0E-23
sp|Q81F14|MTAD_BACCR 5-methylthioadenosine/S-adenosylhomocysteine deaminase OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=mtaD PE=3 SV=1 73 414 3.0E-23
sp|Q8U0P7|MTAD_PYRFU 5-methylthioadenosine/S-adenosylhomocysteine deaminase OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=mtaD PE=3 SV=1 83 427 3.0E-23
sp|B8CX03|MTAD_HALOH 5-methylthioadenosine/S-adenosylhomocysteine deaminase OS=Halothermothrix orenii (strain H 168 / OCM 544 / DSM 9562) GN=mtaD PE=3 SV=1 63 464 4.0E-23
sp|Q9V0Y5|MTAD_PYRAB 5-methylthioadenosine/S-adenosylhomocysteine deaminase OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=mtaD PE=3 SV=1 74 424 5.0E-23
sp|A7GNR9|MTAD_BACCN 5-methylthioadenosine/S-adenosylhomocysteine deaminase OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=mtaD PE=3 SV=1 68 414 2.0E-22
sp|B7IS56|MTAD_BACC2 5-methylthioadenosine/S-adenosylhomocysteine deaminase OS=Bacillus cereus (strain G9842) GN=mtaD PE=3 SV=1 73 414 2.0E-22
sp|O31352|MTAD_BACC1 5-methylthioadenosine/S-adenosylhomocysteine deaminase OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=mtaD PE=3 SV=3 73 414 2.0E-22
sp|Q5UYR3|MTAD_HALMA 5-methylthioadenosine/S-adenosylhomocysteine deaminase OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=mtaD PE=3 SV=1 74 427 8.0E-22
sp|Q2LUH4|MTAD2_SYNAS 5-methylthioadenosine/S-adenosylhomocysteine deaminase 2 OS=Syntrophus aciditrophicus (strain SB) GN=mtaD2 PE=3 SV=1 83 433 9.0E-22
sp|Q8PUQ3|DADD_METMA 5'-deoxyadenosine deaminase OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=dadD PE=3 SV=2 71 439 1.0E-21
sp|A9A9H3|DADD_METM6 5'-deoxyadenosine deaminase OS=Methanococcus maripaludis (strain C6 / ATCC BAA-1332) GN=dadD PE=3 SV=1 61 427 2.0E-21
sp|A4FW32|DADD_METM5 5'-deoxyadenosine deaminase OS=Methanococcus maripaludis (strain C5 / ATCC BAA-1333) GN=dadD PE=3 SV=1 61 427 3.0E-21
sp|B6YUF8|MTAD_THEON 5-methylthioadenosine/S-adenosylhomocysteine deaminase OS=Thermococcus onnurineus (strain NA1) GN=mtaD PE=3 SV=1 86 427 6.0E-21
sp|A6UQD4|DADD_METVS 5'-deoxyadenosine deaminase OS=Methanococcus vannielii (strain SB / ATCC 35089 / DSM 1224) GN=dadD PE=3 SV=1 75 427 6.0E-21
sp|A6VH76|DADD_METM7 5'-deoxyadenosine deaminase OS=Methanococcus maripaludis (strain C7 / ATCC BAA-1331) GN=dadD PE=3 SV=1 61 427 6.0E-21
sp|Q6LX61|DADD_METMP 5'-deoxyadenosine deaminase OS=Methanococcus maripaludis (strain S2 / LL) GN=dadD PE=3 SV=1 61 427 7.0E-21
sp|A7I6C5|DADD_METB6 5'-deoxyadenosine deaminase OS=Methanoregula boonei (strain 6A8) GN=dadD PE=3 SV=1 79 427 8.0E-21
sp|B1I2P4|MTAD_DESAP 5-methylthioadenosine/S-adenosylhomocysteine deaminase OS=Desulforudis audaxviator (strain MP104C) GN=mtaD PE=3 SV=1 86 439 2.0E-20
sp|B8DKS6|MTAD_DESVM 5-methylthioadenosine/S-adenosylhomocysteine deaminase OS=Desulfovibrio vulgaris (strain Miyazaki F / DSM 19637) GN=mtaD PE=3 SV=1 81 428 2.0E-20
sp|B0K2W0|MTAD_THEPX 5-methylthioadenosine/S-adenosylhomocysteine deaminase OS=Thermoanaerobacter sp. (strain X514) GN=mtaD PE=3 SV=1 46 432 4.0E-20
sp|B0K8R8|MTAD_THEP3 5-methylthioadenosine/S-adenosylhomocysteine deaminase OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) GN=mtaD PE=3 SV=1 46 432 4.0E-20
sp|Q0AYV2|MTAD_SYNWW 5-methylthioadenosine/S-adenosylhomocysteine deaminase OS=Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen) GN=mtaD PE=3 SV=1 74 477 5.0E-20
sp|Q5WGA8|MTAD_BACSK 5-methylthioadenosine/S-adenosylhomocysteine deaminase OS=Bacillus clausii (strain KSM-K16) GN=mtaD PE=3 SV=1 27 468 1.0E-19
sp|O59184|MTAD_PYRHO 5-methylthioadenosine/S-adenosylhomocysteine deaminase OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=mtaD PE=3 SV=2 71 433 2.0E-19
sp|A0LMI3|MTAD_SYNFM 5-methylthioadenosine/S-adenosylhomocysteine deaminase OS=Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB) GN=mtaD PE=3 SV=2 85 427 2.0E-19
sp|A5D1G6|MTAD_PELTS 5-methylthioadenosine/S-adenosylhomocysteine deaminase OS=Pelotomaculum thermopropionicum (strain DSM 13744 / JCM 10971 / SI) GN=mtaD PE=3 SV=1 72 427 2.0E-19
sp|Q5JER0|MTAD_THEKO 5-methylthioadenosine/S-adenosylhomocysteine deaminase OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=mtaD PE=3 SV=1 86 427 2.0E-19
sp|B5YDN9|MTAD_DICT6 5-methylthioadenosine/S-adenosylhomocysteine deaminase OS=Dictyoglomus thermophilum (strain ATCC 35947 / DSM 3960 / H-6-12) GN=mtaD PE=3 SV=1 71 474 3.0E-19
sp|Q8R9L4|MTAD_CALS4 5-methylthioadenosine/S-adenosylhomocysteine deaminase OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=mtaD PE=3 SV=1 51 430 3.0E-19
sp|O29265|MTAD2_ARCFU 5-methylthioadenosine/S-adenosylhomocysteine deaminase 2 OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=mtaD2 PE=3 SV=1 83 363 5.0E-19
sp|Q2RJW1|MTAD_MOOTA 5-methylthioadenosine/S-adenosylhomocysteine deaminase OS=Moorella thermoacetica (strain ATCC 39073) GN=mtaD PE=3 SV=1 67 427 5.0E-19
sp|A5UMN6|DADD_METS3 5'-deoxyadenosine deaminase OS=Methanobrevibacter smithii (strain PS / ATCC 35061 / DSM 861) GN=dadD PE=3 SV=1 72 426 6.0E-19
sp|Q466Q9|DADD_METBF 5'-deoxyadenosine deaminase OS=Methanosarcina barkeri (strain Fusaro / DSM 804) GN=dadD PE=3 SV=1 70 439 6.0E-19
sp|O29701|MTAD1_ARCFU 5-methylthioadenosine/S-adenosylhomocysteine deaminase 1 OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=mtaD1 PE=3 SV=1 61 427 1.0E-18
sp|B8E183|MTAD_DICTD 5-methylthioadenosine/S-adenosylhomocysteine deaminase OS=Dictyoglomus turgidum (strain Z-1310 / DSM 6724) GN=mtaD PE=3 SV=1 71 437 2.0E-18
sp|C6A048|MTAD_THESM 5-methylthioadenosine/S-adenosylhomocysteine deaminase OS=Thermococcus sibiricus (strain MM 739 / DSM 12597) GN=mtaD PE=3 SV=1 86 427 2.0E-18
sp|Q24UA2|MTAD_DESHY 5-methylthioadenosine/S-adenosylhomocysteine deaminase OS=Desulfitobacterium hafniense (strain Y51) GN=mtaD PE=3 SV=1 62 437 5.0E-18
sp|B8FRL9|MTAD_DESHD 5-methylthioadenosine/S-adenosylhomocysteine deaminase OS=Desulfitobacterium hafniense (strain DCB-2 / DSM 10664) GN=mtaD PE=3 SV=1 62 437 1.0E-17
sp|B5YLB7|MTAD_THEYD 5-methylthioadenosine/S-adenosylhomocysteine deaminase OS=Thermodesulfovibrio yellowstonii (strain ATCC 51303 / DSM 11347 / YP87) GN=mtaD PE=3 SV=1 84 427 1.0E-17
sp|Q1MR44|MTAD_LAWIP 5-methylthioadenosine/S-adenosylhomocysteine deaminase OS=Lawsonia intracellularis (strain PHE/MN1-00) GN=mtaD PE=3 SV=2 68 425 2.0E-17
sp|A0B7V2|DADD_METTP 5'-deoxyadenosine deaminase OS=Methanosaeta thermophila (strain DSM 6194 / JCM 14653 / NBRC 101360 / PT) GN=dadD PE=3 SV=1 74 365 5.0E-17
sp|Q8TRA4|DADD_METAC 5'-deoxyadenosine deaminase OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=dadD PE=3 SV=2 71 439 5.0E-17
sp|Q3ITF7|MTAD_NATPD 5-methylthioadenosine/S-adenosylhomocysteine deaminase OS=Natronomonas pharaonis (strain ATCC 35678 / DSM 2160) GN=mtaD PE=3 SV=1 83 427 5.0E-17
sp|Q3AC64|MTAD_CARHZ 5-methylthioadenosine/S-adenosylhomocysteine deaminase OS=Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901) GN=mtaD PE=3 SV=1 79 437 5.0E-17
sp|O27549|DADD_METTH 5'-deoxyadenosine deaminase OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=dadD PE=3 SV=1 74 405 6.0E-17
sp|O66851|MTAD_AQUAE 5-methylthioadenosine/S-adenosylhomocysteine deaminase OS=Aquifex aeolicus (strain VF5) GN=mtaD PE=3 SV=1 85 432 8.0E-17
sp|Q9I6Z0|OXODE_PSEAE 8-oxoguanine deaminase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=PA0142 PE=1 SV=1 61 425 9.0E-17
sp|Q891Y7|MTAD_CLOTE 5-methylthioadenosine/S-adenosylhomocysteine deaminase OS=Clostridium tetani (strain Massachusetts / E88) GN=mtaD PE=3 SV=2 85 427 4.0E-16
sp|A4J675|MTAD_DESRM 5-methylthioadenosine/S-adenosylhomocysteine deaminase OS=Desulfotomaculum reducens (strain MI-1) GN=mtaD PE=3 SV=1 73 471 5.0E-16
sp|Q92342|YDI4_SCHPO Uncharacterized protein C1F8.04c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1F8.04c PE=3 SV=1 83 425 7.0E-16
sp|B8J2Q8|MTAD_DESDA 5-methylthioadenosine/S-adenosylhomocysteine deaminase OS=Desulfovibrio desulfuricans (strain ATCC 27774 / DSM 6949) GN=mtaD PE=3 SV=1 83 428 7.0E-16
sp|C5BSJ0|MTAD_TERTT 5-methylthioadenosine/S-adenosylhomocysteine deaminase OS=Teredinibacter turnerae (strain ATCC 39867 / T7901) GN=mtaD PE=3 SV=1 72 474 7.0E-16
sp|Q9KC82|MTAD_BACHD 5-methylthioadenosine/S-adenosylhomocysteine deaminase OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=mtaD PE=3 SV=2 71 429 3.0E-15
sp|Q18EV7|MTAD_HALWD 5-methylthioadenosine/S-adenosylhomocysteine deaminase OS=Haloquadratum walsbyi (strain DSM 16790 / HBSQ001) GN=mtaD PE=3 SV=1 83 344 5.0E-15
sp|Q9HN51|MTAD_HALSA 5-methylthioadenosine/S-adenosylhomocysteine deaminase OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=mtaD PE=3 SV=1 74 344 7.0E-15
sp|Q9EYU0|TRIA_ACIAI Melamine deaminase OS=Acidovorax citrulli GN=triA PE=1 SV=1 29 443 1.0E-14
sp|Q12WS1|DADD_METBU 5'-deoxyadenosine deaminase OS=Methanococcoides burtonii (strain DSM 6242 / NBRC 107633 / OCM 468 / ACE-M) GN=dadD PE=3 SV=1 82 430 2.0E-14
sp|P72156|ATZA_PSESD Atrazine chlorohydrolase OS=Pseudomonas sp. (strain ADP) GN=atzA PE=1 SV=2 66 443 2.0E-13
sp|A3DEQ2|MTAD_CLOTH 5-methylthioadenosine/S-adenosylhomocysteine deaminase OS=Clostridium thermocellum (strain ATCC 27405 / DSM 1237 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) GN=mtaD PE=3 SV=1 83 425 5.0E-13
sp|Q21IS0|MTAD_SACD2 5-methylthioadenosine/S-adenosylhomocysteine deaminase OS=Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024) GN=mtaD PE=3 SV=1 80 418 7.0E-13
sp|A4XJI3|MTAD_CALS8 5-methylthioadenosine/S-adenosylhomocysteine deaminase OS=Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331) GN=mtaD PE=3 SV=1 85 472 2.0E-12
sp|Q9X034|MTAD_THEMA 5-methylthioadenosine/S-adenosylhomocysteine deaminase OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=mtaD PE=1 SV=1 86 454 5.0E-09
sp|P0CI72|IXPDE_UNKP Isoxanthopterin deaminase OS=Unknown prokaryotic organism PE=1 SV=1 84 468 7.0E-08
sp|Q52725|TRZA_GORRU S-triazine hydrolase OS=Gordonia rubripertincta GN=trzA PE=1 SV=2 288 456 9.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0016787 hydrolase activity Yes
GO:0003674 molecular_function No
GO:0003824 catalytic activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 23 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|4245
MEAAGRERRRLLLLGTFVQTKADRQLQVMQETAIAVDEQGVIVGIERAQQEGQDAHSAGQRLLGQLGWEAESVDE
CSSGPEGFFFPGLIDTHVHAAQYANVGLFGKTTLLDWLERYTFPLEASLCDVAKARRMWRACVDRTLAHGTTTAA
YYGVVDVEATNALMDECVARGQRALVGRVCMDAKEVNPAWYRDETAAEALEATLRTVEHARRVDAAGALVEPVLT
PRFAPSCSMALMEALGKLQREEGLAVQTHLSETREELALVRRLFPDAASYTAVYDAARLLTPRTILAHGIHLGDD
EARLIAQRGSSVAHCPCSNTALASGRARVGWLWRHGIAVGLGTDMSGGYSPSVLEAARQALLVSRNLAMDAAANP
DAADDFDCNLSVDDVLFLATRGGAIALGLDHKIGAFDLGLQWDAQLIHLDTPEHHSFARGNVDVFGWESCQERVA
KWLFNGDDRNTLKVWVQGRLVHSRPVKHDM*
Coding >OphauB2|4245
ATGGAGGCGGCAGGGCGTGAGAGACGGCGGCTGCTCCTCCTTGGGACGTTTGTGCAGACCAAGGCTGACCGACAG
CTGCAAGTGATGCAAGAGACGGCAATTGCAGTGGACGAGCAAGGAGTAATTGTGGGCATTGAGAGGGCGCAGCAA
GAGGGCCAAGACGCACACAGTGCTGGGCAGCGGCTGCTGGGACAGTTGGGATGGGAGGCAGAGAGCGTGGACGAG
TGCAGCAGCGGGCCCGAGGGCTTCTTCTTCCCCGGCTTGATTGACACGCATGTGCACGCGGCGCAGTATGCCAAC
GTGGGCCTGTTTGGCAAGACGACGCTGCTCGACTGGCTGGAGCGCTACACTTTTCCCCTCGAGGCGAGCCTCTGC
GACGTGGCCAAGGCGCGACGCATGTGGCGCGCGTGCGTGGACCGGACGCTGGCGCACGGCACCACAACGGCGGCG
TATTACGGCGTGGTGGACGTGGAGGCGACGAATGCGCTGATGGATGAGTGTGTGGCGCGCGGGCAGCGAGCACTA
GTGGGCCGGGTGTGCATGGACGCCAAAGAGGTGAATCCAGCATGGTACCGCGACGAGACGGCCGCCGAGGCACTC
GAGGCGACGCTGCGCACCGTGGAGCATGCGCGGCGCGTAGATGCGGCGGGTGCGCTGGTTGAGCCGGTGCTGACG
CCGCGCTTTGCACCCTCGTGCTCAATGGCGCTAATGGAGGCGCTGGGCAAATTGCAGCGTGAAGAGGGCCTGGCT
GTGCAGACGCATCTTTCGGAAACGCGTGAGGAGCTGGCGCTGGTGCGGCGGCTGTTTCCCGACGCGGCGTCGTAT
ACGGCCGTGTACGATGCTGCGCGGCTGCTCACGCCGCGAACTATTCTCGCACATGGGATTCATCTTGGCGACGAC
GAGGCGCGCCTCATTGCCCAGCGCGGGAGCAGCGTCGCCCACTGTCCGTGTAGCAACACGGCGCTTGCCAGTGGA
CGCGCCCGTGTTGGCTGGCTCTGGCGCCACGGCATCGCCGTTGGTCTCGGCACAGACATGAGCGGCGGCTACAGC
CCCTCGGTCCTCGAGGCCGCGCGGCAGGCCCTCCTCGTGAGCCGTAACCTCGCCATGGATGCCGCCGCTAATCCC
GACGCCGCCGACGACTTTGACTGCAATCTCTCAGTCGACGATGTCCTCTTCCTCGCCACCCGCGGCGGCGCCATA
GCCCTTGGCCTCGACCACAAAATCGGCGCCTTTGACCTTGGCCTGCAGTGGGACGCCCAGCTCATCCACCTCGAC
ACGCCAGAACACCACTCTTTTGCGCGCGGCAACGTGGACGTTTTTGGCTGGGAATCGTGCCAGGAGCGCGTCGCC
AAGTGGCTCTTCAACGGCGACGACCGCAATACCCTCAAGGTTTGGGTCCAGGGCAGACTGGTGCACTCGCGCCCC
GTCAAACACGACATGTAA
Transcript >OphauB2|4245
ATGGAGGCGGCAGGGCGTGAGAGACGGCGGCTGCTCCTCCTTGGGACGTTTGTGCAGACCAAGGCTGACCGACAG
CTGCAAGTGATGCAAGAGACGGCAATTGCAGTGGACGAGCAAGGAGTAATTGTGGGCATTGAGAGGGCGCAGCAA
GAGGGCCAAGACGCACACAGTGCTGGGCAGCGGCTGCTGGGACAGTTGGGATGGGAGGCAGAGAGCGTGGACGAG
TGCAGCAGCGGGCCCGAGGGCTTCTTCTTCCCCGGCTTGATTGACACGCATGTGCACGCGGCGCAGTATGCCAAC
GTGGGCCTGTTTGGCAAGACGACGCTGCTCGACTGGCTGGAGCGCTACACTTTTCCCCTCGAGGCGAGCCTCTGC
GACGTGGCCAAGGCGCGACGCATGTGGCGCGCGTGCGTGGACCGGACGCTGGCGCACGGCACCACAACGGCGGCG
TATTACGGCGTGGTGGACGTGGAGGCGACGAATGCGCTGATGGATGAGTGTGTGGCGCGCGGGCAGCGAGCACTA
GTGGGCCGGGTGTGCATGGACGCCAAAGAGGTGAATCCAGCATGGTACCGCGACGAGACGGCCGCCGAGGCACTC
GAGGCGACGCTGCGCACCGTGGAGCATGCGCGGCGCGTAGATGCGGCGGGTGCGCTGGTTGAGCCGGTGCTGACG
CCGCGCTTTGCACCCTCGTGCTCAATGGCGCTAATGGAGGCGCTGGGCAAATTGCAGCGTGAAGAGGGCCTGGCT
GTGCAGACGCATCTTTCGGAAACGCGTGAGGAGCTGGCGCTGGTGCGGCGGCTGTTTCCCGACGCGGCGTCGTAT
ACGGCCGTGTACGATGCTGCGCGGCTGCTCACGCCGCGAACTATTCTCGCACATGGGATTCATCTTGGCGACGAC
GAGGCGCGCCTCATTGCCCAGCGCGGGAGCAGCGTCGCCCACTGTCCGTGTAGCAACACGGCGCTTGCCAGTGGA
CGCGCCCGTGTTGGCTGGCTCTGGCGCCACGGCATCGCCGTTGGTCTCGGCACAGACATGAGCGGCGGCTACAGC
CCCTCGGTCCTCGAGGCCGCGCGGCAGGCCCTCCTCGTGAGCCGTAACCTCGCCATGGATGCCGCCGCTAATCCC
GACGCCGCCGACGACTTTGACTGCAATCTCTCAGTCGACGATGTCCTCTTCCTCGCCACCCGCGGCGGCGCCATA
GCCCTTGGCCTCGACCACAAAATCGGCGCCTTTGACCTTGGCCTGCAGTGGGACGCCCAGCTCATCCACCTCGAC
ACGCCAGAACACCACTCTTTTGCGCGCGGCAACGTGGACGTTTTTGGCTGGGAATCGTGCCAGGAGCGCGTCGCC
AAGTGGCTCTTCAACGGCGACGACCGCAATACCCTCAAGGTTTGGGTCCAGGGCAGACTGGTGCACTCGCGCCCC
GTCAAACACGACATGTAA
Gene >OphauB2|4245
ATGGAGGCGGCAGGGCGTGAGAGACGGCGGCTGCTCCTCCTTGGGACGTTTGTGCAGACCAAGGCTGACCGACAG
CTGCAAGTGATGCAAGAGACGGCAATTGCAGTGGACGAGCAAGGAGTAATTGTGGGCATTGAGAGGGCGCAGCAA
GAGGGCCAAGACGCACACAGTGCTGGGCAGCGGCTGCTGGGACAGTTGGGATGGGAGGCAGAGAGCGTGGACGAG
TGCAGCAGCGGGCCCGAGGGCTTCTTCTTCCCCGGCTTGATTGGTGTGTAAAGGAAGCCTTTGAGGGAAGAGGGC
GAGATGCTGACTAGTGCAGACACGCATGTGCACGCGGCGCAGTATGCCAACGTGGGCCTGTTTGGCAAGACGACG
CTGCTCGACTGGCTGGAGCGCTACACTTTTCCCCTCGAGGCGAGCCTCTGCGACGTGGCCAAGGCGCGACGCATG
TGGCGCGCGTGCGTGGACCGGACGCTGGCGCACGGCACCACAACGGCGGCGTATTACGGCGTGGTGGACGTGGAG
GCGACGAATGCGCTGATGGATGAGTGTGTGGCGCGCGGGCAGCGAGCACTAGTGGGCCGGGTGTGCATGGACGCC
AAAGAGGTGAATCCAGCATGGTACCGCGACGAGACGGCCGCCGAGGCACTCGAGGCGACGCTGCGCACCGTGGAG
CATGCGCGGCGCGTAGATGCGGCGGGTGCGCTGGTTGAGCCGGTGCTGACGCCGCGCTTTGCACCCTCGTGCTCA
ATGGCGCTAATGGAGGCGCTGGGCAAATTGCAGCGTGAAGAGGGCCTGGCTGTGCAGACGCATCTTTCGGAAACG
CGTGAGGAGCTGGCGCTGGTGCGGCGGCTGTTTCCCGACGCGGCGTCGTATACGGCCGTGTACGATGCTGCGCGG
CTGCTCACGCCGCGAACTATTCTCGCACATGGGATTCATCTTGGCGACGACGAGGCGCGCCTCATTGCCCAGCGC
GGGAGCAGCGTCGCCCACTGTCCGTGTAGCAACACGGCGCTTGCCAGTGGACGCGCCCGTGTTGGCTGGCTCTGG
CGCCACGGCATCGCCGTTGGTCTCGGCACAGACATGAGCGGCGGCTACAGCCCCTCGGTCCTCGAGGCCGCGCGG
CAGGCCCTCCTCGTGAGCCGTAACCTCGCCATGGATGCCGCCGCTAATCCCGACGCCGCCGACGACTTTGACTGC
AATCTCTCAGTCGACGATGTCCTCTTCCTCGCCACCCGCGGCGGCGCCATAGCCCTTGGCCTCGACCACAAAATC
GGCGCCTTTGACCTTGGCCTGCAGTGGGACGCCCAGCTCATCCACCTCGACACGCCAGAACACCACTCTTTTGCG
CGCGGCAACGTGGACGTTTTTGGCTGGGAATCGTGCCAGGAGCGCGTCGCCAAGTGGCTCTTCAACGGCGACGAC
CGCAATACCCTCAAGGTTTGGGTCCAGGGCAGACTGGTGCACTCGCGCCCCGTCAAACACGACATGTAA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail