Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|4228
Gene name
LocationContig_28:105400..110142
Strand-
Gene length (bp)4742
Transcript length (bp)4686
Coding sequence length (bp)4686
Protein length (aa) 1562

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00069 Pkinase Protein kinase domain 2.4E-22 28 286
PF00400 WD40 WD domain, G-beta repeat 1.2E-03 1105 1141
PF07714 PK_Tyr_Ser-Thr Protein tyrosine and serine/threonine kinase 2.1E-06 26 165

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9UVG6|VPS15_PICPA Putative serine/threonine-protein kinase VPS15 OS=Komagataella pastoris GN=VPS15 PE=3 SV=3 1 876 7.0E-170
sp|P22219|VPS15_YEAST Serine/threonine-protein kinase VPS15 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VPS15 PE=1 SV=4 1 877 1.0E-156
sp|Q99570|PI3R4_HUMAN Phosphoinositide 3-kinase regulatory subunit 4 OS=Homo sapiens GN=PIK3R4 PE=1 SV=3 19 874 2.0E-145
sp|Q5R9I3|PI3R4_PONAB Phosphoinositide 3-kinase regulatory subunit 4 OS=Pongo abelii GN=PIK3R4 PE=2 SV=3 19 874 8.0E-142
sp|Q8VD65|PI3R4_MOUSE Phosphoinositide 3-kinase regulatory subunit 4 OS=Mus musculus GN=Pik3r4 PE=1 SV=3 19 874 5.0E-141
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9UVG6|VPS15_PICPA Putative serine/threonine-protein kinase VPS15 OS=Komagataella pastoris GN=VPS15 PE=3 SV=3 1 876 7.0E-170
sp|P22219|VPS15_YEAST Serine/threonine-protein kinase VPS15 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VPS15 PE=1 SV=4 1 877 1.0E-156
sp|Q99570|PI3R4_HUMAN Phosphoinositide 3-kinase regulatory subunit 4 OS=Homo sapiens GN=PIK3R4 PE=1 SV=3 19 874 2.0E-145
sp|Q5R9I3|PI3R4_PONAB Phosphoinositide 3-kinase regulatory subunit 4 OS=Pongo abelii GN=PIK3R4 PE=2 SV=3 19 874 8.0E-142
sp|Q8VD65|PI3R4_MOUSE Phosphoinositide 3-kinase regulatory subunit 4 OS=Mus musculus GN=Pik3r4 PE=1 SV=3 19 874 5.0E-141
sp|O42900|PPK19_SCHPO Serine/threonine-protein kinase ppk19 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ppk19 PE=1 SV=1 21 877 3.0E-140
sp|P0C0R5|PI3R4_RAT Phosphoinositide 3-kinase regulatory subunit 4 OS=Rattus norvegicus GN=Pik3r4 PE=3 SV=2 19 874 5.0E-139
sp|Q54S77|VPS15_DICDI Probable serine/threonine-protein kinase vps15 OS=Dictyostelium discoideum GN=vps15 PE=3 SV=1 25 343 2.0E-78
sp|Q54S77|VPS15_DICDI Probable serine/threonine-protein kinase vps15 OS=Dictyostelium discoideum GN=vps15 PE=3 SV=1 393 770 5.0E-45
sp|Q9UVG6|VPS15_PICPA Putative serine/threonine-protein kinase VPS15 OS=Komagataella pastoris GN=VPS15 PE=3 SV=3 1036 1561 8.0E-38
sp|Q54S77|VPS15_DICDI Probable serine/threonine-protein kinase vps15 OS=Dictyostelium discoideum GN=vps15 PE=3 SV=1 1091 1349 2.0E-36
sp|Q8VD65|PI3R4_MOUSE Phosphoinositide 3-kinase regulatory subunit 4 OS=Mus musculus GN=Pik3r4 PE=1 SV=3 1099 1469 5.0E-35
sp|P0C0R5|PI3R4_RAT Phosphoinositide 3-kinase regulatory subunit 4 OS=Rattus norvegicus GN=Pik3r4 PE=3 SV=2 1099 1469 6.0E-35
sp|Q99570|PI3R4_HUMAN Phosphoinositide 3-kinase regulatory subunit 4 OS=Homo sapiens GN=PIK3R4 PE=1 SV=3 1099 1469 7.0E-35
sp|Q5R9I3|PI3R4_PONAB Phosphoinositide 3-kinase regulatory subunit 4 OS=Pongo abelii GN=PIK3R4 PE=2 SV=3 1099 1469 3.0E-33
sp|P22219|VPS15_YEAST Serine/threonine-protein kinase VPS15 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VPS15 PE=1 SV=4 999 1345 2.0E-31
sp|O42900|PPK19_SCHPO Serine/threonine-protein kinase ppk19 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ppk19 PE=1 SV=1 1038 1555 2.0E-23
sp|P0C8M8|CCR1_MAIZE Probable serine/threonine-protein kinase CCRP1 OS=Zea mays GN=CCRP1 PE=1 SV=1 45 286 1.0E-13
sp|Q9Y2K2|SIK3_HUMAN Serine/threonine-protein kinase SIK3 OS=Homo sapiens GN=SIK3 PE=1 SV=3 26 284 2.0E-11
sp|Q6P4S6|SIK3_MOUSE Serine/threonine-protein kinase SIK3 OS=Mus musculus GN=Sik3 PE=1 SV=3 26 284 4.0E-11
sp|Q8BWQ5|DCLK3_MOUSE Serine/threonine-protein kinase DCLK3 OS=Mus musculus GN=Dclk3 PE=2 SV=2 13 286 6.0E-11
sp|Q8BRK8|AAPK2_MOUSE 5'-AMP-activated protein kinase catalytic subunit alpha-2 OS=Mus musculus GN=Prkaa2 PE=1 SV=3 30 299 9.0E-11
sp|Q8CIP4|MARK4_MOUSE MAP/microtubule affinity-regulating kinase 4 OS=Mus musculus GN=Mark4 PE=1 SV=1 29 289 9.0E-11
sp|Q96L34|MARK4_HUMAN MAP/microtubule affinity-regulating kinase 4 OS=Homo sapiens GN=MARK4 PE=1 SV=1 29 289 9.0E-11
sp|O08679|MARK2_RAT Serine/threonine-protein kinase MARK2 OS=Rattus norvegicus GN=Mark2 PE=1 SV=1 29 289 1.0E-10
sp|Q7KZI7|MARK2_HUMAN Serine/threonine-protein kinase MARK2 OS=Homo sapiens GN=MARK2 PE=1 SV=2 29 289 1.0E-10
sp|Q05512|MARK2_MOUSE Serine/threonine-protein kinase MARK2 OS=Mus musculus GN=Mark2 PE=1 SV=3 29 289 2.0E-10
sp|Q54YF2|AMPKA_DICDI 5'-AMP-activated serine/threonine-protein kinase catalytic subunit alpha OS=Dictyostelium discoideum GN=snfA PE=2 SV=1 13 311 2.0E-10
sp|Q94CG0|CIPKL_ARATH CBL-interacting serine/threonine-protein kinase 21 OS=Arabidopsis thaliana GN=CIPK21 PE=1 SV=1 26 230 2.0E-10
sp|Q60670|SIK1_MOUSE Serine/threonine-protein kinase SIK1 OS=Mus musculus GN=Sik1 PE=1 SV=3 28 284 4.0E-10
sp|Q626B1|PMY13_CAEBR Membrane-associated tyrosine- and threonine-specific cdc2-inhibitory kinase wee-1.3 OS=Caenorhabditis briggsae GN=wee-1.3 PE=3 SV=1 7 283 4.0E-10
sp|Q09137|AAPK2_RAT 5'-AMP-activated protein kinase catalytic subunit alpha-2 OS=Rattus norvegicus GN=Prkaa2 PE=1 SV=1 30 299 4.0E-10
sp|P50528|PLO1_SCHPO Serine/threonine-protein kinase plo1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=plo1 PE=1 SV=1 31 287 5.0E-10
sp|Q5RD00|AAPK2_PONAB 5'-AMP-activated protein kinase catalytic subunit alpha-2 OS=Pongo abelii GN=PRKAA2 PE=2 SV=1 30 299 5.0E-10
sp|Q8CFH6|SIK2_MOUSE Serine/threonine-protein kinase SIK2 OS=Mus musculus GN=Sik2 PE=1 SV=1 28 340 6.0E-10
sp|P54646|AAPK2_HUMAN 5'-AMP-activated protein kinase catalytic subunit alpha-2 OS=Homo sapiens GN=PRKAA2 PE=1 SV=2 30 299 6.0E-10
sp|Q8VHF0|MARK3_RAT MAP/microtubule affinity-regulating kinase 3 OS=Rattus norvegicus GN=Mark3 PE=1 SV=1 29 289 7.0E-10
sp|Q28948|AAPK2_PIG 5'-AMP-activated protein kinase catalytic subunit alpha-2 OS=Sus scrofa GN=PRKAA2 PE=2 SV=2 30 299 8.0E-10
sp|Q9R1U5|SIK1_RAT Serine/threonine-protein kinase SIK1 OS=Rattus norvegicus GN=Sik1 PE=1 SV=1 28 333 9.0E-10
sp|Q38997|KIN10_ARATH SNF1-related protein kinase catalytic subunit alpha KIN10 OS=Arabidopsis thaliana GN=KIN10 PE=1 SV=2 49 281 1.0E-09
sp|P92958|KIN11_ARATH SNF1-related protein kinase catalytic subunit alpha KIN11 OS=Arabidopsis thaliana GN=KIN11 PE=1 SV=1 13 281 1.0E-09
sp|Q5REX1|SIK2_PONAB Serine/threonine-protein kinase SIK2 OS=Pongo abelii GN=SIK2 PE=2 SV=1 28 340 1.0E-09
sp|Q19469|SAD1_CAEEL Serine/threonine kinase SAD-1 OS=Caenorhabditis elegans GN=sad-1 PE=1 SV=2 49 289 2.0E-09
sp|Q9C098|DCLK3_HUMAN Serine/threonine-protein kinase DCLK3 OS=Homo sapiens GN=DCLK3 PE=2 SV=2 32 286 3.0E-09
sp|P27448|MARK3_HUMAN MAP/microtubule affinity-regulating kinase 3 OS=Homo sapiens GN=MARK3 PE=1 SV=4 29 289 3.0E-09
sp|Q9TW45|PAR1_CAEEL Serine/threonine-protein kinase par-1 OS=Caenorhabditis elegans GN=par-1 PE=1 SV=1 29 289 3.0E-09
sp|B2DD29|BRSK1_RAT Serine/threonine-protein kinase BRSK1 OS=Rattus norvegicus GN=Brsk1 PE=1 SV=1 31 284 4.0E-09
sp|A8WYE4|PAR1_CAEBR Serine/threonine-protein kinase par-1 OS=Caenorhabditis briggsae GN=par-1 PE=3 SV=1 29 289 4.0E-09
sp|O76039|CDKL5_HUMAN Cyclin-dependent kinase-like 5 OS=Homo sapiens GN=CDKL5 PE=1 SV=1 31 287 4.0E-09
sp|Q5RJI5|BRSK1_MOUSE Serine/threonine-protein kinase BRSK1 OS=Mus musculus GN=Brsk1 PE=1 SV=1 31 284 4.0E-09
sp|Q9H0K1|SIK2_HUMAN Serine/threonine-protein kinase SIK2 OS=Homo sapiens GN=SIK2 PE=1 SV=1 28 340 4.0E-09
sp|Q3UTQ8|CDKL5_MOUSE Cyclin-dependent kinase-like 5 OS=Mus musculus GN=Cdkl5 PE=1 SV=1 31 287 5.0E-09
sp|Q8TDC3|BRSK1_HUMAN Serine/threonine-protein kinase BRSK1 OS=Homo sapiens GN=BRSK1 PE=1 SV=2 31 284 5.0E-09
sp|Q03141|MARK3_MOUSE MAP/microtubule affinity-regulating kinase 3 OS=Mus musculus GN=Mark3 PE=1 SV=2 29 289 5.0E-09
sp|Q755C4|IPL1_ASHGO Spindle assembly checkpoint kinase OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=IPL1 PE=3 SV=1 9 279 6.0E-09
sp|Q93VD3|CIPKN_ARATH CBL-interacting serine/threonine-protein kinase 23 OS=Arabidopsis thaliana GN=CIPK23 PE=1 SV=1 26 243 9.0E-09
sp|Q9IA88|SIK2_CHICK Serine/threonine-protein kinase SIK2 OS=Gallus gallus GN=SIK2 PE=2 SV=1 1 284 9.0E-09
sp|Q59W62|GIN4_CANAL Serine/threonine-protein kinase GIN4 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=GIN4 PE=1 SV=1 81 286 1.0E-08
sp|P50873|MRK1_YEAST Serine/threonine-protein kinase MRK1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MRK1 PE=1 SV=2 40 237 1.0E-08
sp|F1QGZ6|MELK_DANRE Maternal embryonic leucine zipper kinase OS=Danio rerio GN=melk PE=2 SV=1 22 287 1.0E-08
sp|A0AUV4|SMKY_MOUSE Sperm motility kinase Y OS=Mus musculus GN=Gm7168 PE=2 SV=1 26 183 1.0E-08
sp|P16892|FUS3_YEAST Mitogen-activated protein kinase FUS3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FUS3 PE=1 SV=2 90 236 1.0E-08
sp|Q0D4B2|CIPKL_ORYSJ CBL-interacting protein kinase 21 OS=Oryza sativa subsp. japonica GN=CIPK21 PE=2 SV=2 26 204 2.0E-08
sp|P15735|PHKG2_HUMAN Phosphorylase b kinase gamma catalytic chain, liver/testis isoform OS=Homo sapiens GN=PHKG2 PE=1 SV=1 44 286 2.0E-08
sp|Q6C7U8|PHO85_YARLI Negative regulator of the PHO system OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=PHO85 PE=3 SV=1 26 236 2.0E-08
sp|P57059|SIK1_HUMAN Serine/threonine-protein kinase SIK1 OS=Homo sapiens GN=SIK1 PE=1 SV=2 28 284 2.0E-08
sp|Q86I06|NEK3_DICDI Probable serine/threonine-protein kinase nek3 OS=Dictyostelium discoideum GN=nek3 PE=3 SV=1 124 306 2.0E-08
sp|Q91YS8|KCC1A_MOUSE Calcium/calmodulin-dependent protein kinase type 1 OS=Mus musculus GN=Camk1 PE=1 SV=1 18 286 2.0E-08
sp|Q63450|KCC1A_RAT Calcium/calmodulin-dependent protein kinase type 1 OS=Rattus norvegicus GN=Camk1 PE=1 SV=2 18 286 2.0E-08
sp|P38615|RIM11_YEAST Serine/threonine-protein kinase RIM11/MSD1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RIM11 PE=1 SV=1 86 236 2.0E-08
sp|Q14012|KCC1A_HUMAN Calcium/calmodulin-dependent protein kinase type 1 OS=Homo sapiens GN=CAMK1 PE=1 SV=1 18 286 2.0E-08
sp|Q3TZA2|CDKL4_MOUSE Cyclin-dependent kinase-like 4 OS=Mus musculus GN=Cdkl4 PE=2 SV=1 26 230 3.0E-08
sp|Q9C562|CIPKA_ARATH CBL-interacting serine/threonine-protein kinase 10 OS=Arabidopsis thaliana GN=CIPK10 PE=1 SV=1 10 281 3.0E-08
sp|Q6NSM8|SIK3_DANRE Serine/threonine-protein kinase SIK3 homolog OS=Danio rerio GN=zgc:66101 PE=2 SV=1 19 284 3.0E-08
sp|Q9NRH2|SNRK_HUMAN SNF-related serine/threonine-protein kinase OS=Homo sapiens GN=SNRK PE=1 SV=2 19 284 3.0E-08
sp|Q2RAX3|CIPKX_ORYSJ CBL-interacting protein kinase 33 OS=Oryza sativa subsp. japonica GN=CIPK33 PE=2 SV=1 26 243 3.0E-08
sp|Q5JLS2|CIPKC_ORYSJ CBL-interacting protein kinase 12 OS=Oryza sativa subsp. japonica GN=CIPK12 PE=1 SV=1 26 299 4.0E-08
sp|Q5W736|CIPKI_ORYSJ CBL-interacting protein kinase 18 OS=Oryza sativa subsp. japonica GN=CIPK18 PE=2 SV=1 29 164 4.0E-08
sp|Q7X996|CIPK2_ORYSJ CBL-interacting protein kinase 2 OS=Oryza sativa subsp. japonica GN=CIPK2 PE=2 SV=1 63 291 4.0E-08
sp|Q9LGV5|CIPK1_ORYSJ CBL-interacting protein kinase 1 OS=Oryza sativa subsp. japonica GN=CIPK1 PE=2 SV=1 64 279 4.0E-08
sp|Q6ERS0|CIPKR_ORYSJ Putative CBL-interacting protein kinase 27 OS=Oryza sativa subsp. japonica GN=CIPK27 PE=3 SV=1 64 359 5.0E-08
sp|Q75L42|CIPKH_ORYSJ CBL-interacting protein kinase 17 OS=Oryza sativa subsp. japonica GN=CIPK17 PE=2 SV=1 29 231 5.0E-08
sp|Q9URT9|GSK31_SCHPO Protein kinase gsk31 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gsk31 PE=1 SV=1 66 246 5.0E-08
sp|Q8C1R0|TSSK5_MOUSE Testis-specific serine/threonine-protein kinase 5 OS=Mus musculus GN=Tssk5 PE=2 SV=2 1 284 5.0E-08
sp|Q92241|PHO85_KLULA Negative regulator of the PHO system OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=PHO85 PE=3 SV=2 19 287 5.0E-08
sp|O08678|MARK1_RAT Serine/threonine-protein kinase MARK1 OS=Rattus norvegicus GN=Mark1 PE=1 SV=1 11 289 6.0E-08
sp|Q9FJ54|CIPKK_ARATH CBL-interacting serine/threonine-protein kinase 20 OS=Arabidopsis thaliana GN=CIPK20 PE=1 SV=1 19 320 6.0E-08
sp|Q0E459|MPK13_ORYSJ Mitogen-activated protein kinase 13 OS=Oryza sativa subsp. japonica GN=MPK13 PE=2 SV=1 70 236 6.0E-08
sp|A2X0M1|MPK13_ORYSI Mitogen-activated protein kinase 13 OS=Oryza sativa subsp. indica GN=MPK13 PE=2 SV=2 70 236 6.0E-08
sp|Q8VHJ5|MARK1_MOUSE Serine/threonine-protein kinase MARK1 OS=Mus musculus GN=Mark1 PE=1 SV=2 11 289 1.0E-07
sp|Q63553|SNRK_RAT SNF-related serine/threonine-protein kinase OS=Rattus norvegicus GN=Snrk PE=1 SV=1 19 284 1.0E-07
sp|Q68UT7|HUNK_PANTR Hormonally up-regulated neu tumor-associated kinase OS=Pan troglodytes GN=HUNK PE=3 SV=1 15 293 1.0E-07
sp|Q8VDU5|SNRK_MOUSE SNF-related serine/threonine-protein kinase OS=Mus musculus GN=Snrk PE=1 SV=1 19 284 1.0E-07
sp|Q10SC8|CIPK9_ORYSJ CBL-interacting protein kinase 9 OS=Oryza sativa subsp. japonica GN=CIPK9 PE=2 SV=1 26 242 1.0E-07
sp|P57058|HUNK_HUMAN Hormonally up-regulated neu tumor-associated kinase OS=Homo sapiens GN=HUNK PE=1 SV=1 15 293 1.0E-07
sp|Q6FKD4|PHO85_CANGA Negative regulator of the PHO system OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=PHO85 PE=3 SV=1 26 286 1.0E-07
sp|O22932|CIPKB_ARATH CBL-interacting serine/threonine-protein kinase 11 OS=Arabidopsis thaliana GN=CIPK11 PE=1 SV=1 11 289 1.0E-07
sp|Q9SN43|CIPKC_ARATH CBL-interacting serine/threonine-protein kinase 12 OS=Arabidopsis thaliana GN=CIPK12 PE=1 SV=1 81 291 2.0E-07
sp|Q9P0L2|MARK1_HUMAN Serine/threonine-protein kinase MARK1 OS=Homo sapiens GN=MARK1 PE=1 SV=2 11 289 2.0E-07
sp|O88866|HUNK_MOUSE Hormonally up-regulated neu tumor-associated kinase OS=Mus musculus GN=Hunk PE=2 SV=1 15 293 2.0E-07
sp|Q54QB1|ERK2_DICDI Extracellular signal-regulated kinase 2 OS=Dictyostelium discoideum GN=erkB PE=1 SV=1 82 236 2.0E-07
sp|Q2QY53|CIPKW_ORYSJ CBL-interacting protein kinase 32 OS=Oryza sativa subsp. japonica GN=CIPK32 PE=2 SV=2 26 243 2.0E-07
sp|Q75GK4|CIPK7_ORYSJ CBL-interacting protein kinase 7 OS=Oryza sativa subsp. japonica GN=CIPK7 PE=2 SV=1 49 177 2.0E-07
sp|O18209|PMY13_CAEEL Membrane-associated tyrosine- and threonine-specific cdc2-inhibitory kinase wee-1.3 OS=Caenorhabditis elegans GN=wee-1.3 PE=1 SV=1 23 287 2.0E-07
sp|A8XA58|CDK1_CAEBR Cyclin-dependent kinase 1 OS=Caenorhabditis briggsae GN=cdk-1 PE=3 SV=1 81 246 2.0E-07
sp|Q5MAI5|CDKL4_HUMAN Cyclin-dependent kinase-like 4 OS=Homo sapiens GN=CDKL4 PE=2 SV=2 53 230 3.0E-07
sp|Q9LWM4|CIPK5_ORYSJ CBL-interacting protein kinase 5 OS=Oryza sativa subsp. japonica GN=CIPK5 PE=2 SV=1 31 291 3.0E-07
sp|Q5R754|CDKL2_PONAB Cyclin-dependent kinase-like 2 OS=Pongo abelii GN=CDKL2 PE=2 SV=1 53 236 3.0E-07
sp|Q02723|RKIN1_SECCE Carbon catabolite-derepressing protein kinase OS=Secale cereale GN=RKIN1 PE=2 SV=1 22 281 3.0E-07
sp|Q6ZLP5|CIPKN_ORYSJ CBL-interacting protein kinase 23 OS=Oryza sativa subsp. japonica GN=CIPK23 PE=2 SV=1 26 243 4.0E-07
sp|Q8LIG4|CIPK3_ORYSJ CBL-interacting protein kinase 3 OS=Oryza sativa subsp. japonica GN=CIPK3 PE=2 SV=1 30 353 4.0E-07
sp|Q92772|CDKL2_HUMAN Cyclin-dependent kinase-like 2 OS=Homo sapiens GN=CDKL2 PE=1 SV=1 53 236 4.0E-07
sp|Q4R7T5|CDKL2_MACFA Cyclin-dependent kinase-like 2 OS=Macaca fascicularis GN=CDKL2 PE=2 SV=1 53 236 4.0E-07
sp|Q6ERS4|CIPKG_ORYSJ CBL-interacting protein kinase 16 OS=Oryza sativa subsp. japonica GN=CIPK16 PE=2 SV=1 26 281 4.0E-07
sp|Q9LDI3|CIPKO_ARATH CBL-interacting serine/threonine-protein kinase 24 OS=Arabidopsis thaliana GN=CIPK24 PE=1 SV=1 26 226 5.0E-07
sp|Q8W1D5|CIPKP_ARATH CBL-interacting serine/threonine-protein kinase 25 OS=Arabidopsis thaliana GN=CIPK25 PE=2 SV=1 60 281 5.0E-07
sp|Q10452|GSK3_SCHPO Protein kinase gsk3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gsk3 PE=1 SV=3 98 236 5.0E-07
sp|Q41639|CDC2_VIGAC Cell division control protein 2 homolog OS=Vigna aconitifolia GN=CDC2 PE=2 SV=1 82 246 5.0E-07
sp|Q2V452|CIPK3_ARATH CBL-interacting serine/threonine-protein kinase 3 OS=Arabidopsis thaliana GN=CIPK3 PE=1 SV=2 26 250 5.0E-07
sp|Q9LEU7|CIPK5_ARATH CBL-interacting serine/threonine-protein kinase 5 OS=Arabidopsis thaliana GN=CIPK5 PE=2 SV=1 31 281 5.0E-07
sp|Q14680|MELK_HUMAN Maternal embryonic leucine zipper kinase OS=Homo sapiens GN=MELK PE=1 SV=3 89 287 5.0E-07
sp|P24100|CDKA1_ARATH Cyclin-dependent kinase A-1 OS=Arabidopsis thaliana GN=CDKA-1 PE=1 SV=1 82 282 5.0E-07
sp|Q8IY84|NIM1_HUMAN Serine/threonine-protein kinase NIM1 OS=Homo sapiens GN=NIM1K PE=1 SV=1 31 301 6.0E-07
sp|Q8BHI9|NIM1_MOUSE Serine/threonine-protein kinase NIM1 OS=Mus musculus GN=Nim1k PE=2 SV=1 31 164 7.0E-07
sp|P52389|CDC2_VIGUN Cell division control protein 2 homolog OS=Vigna unguiculata GN=CDC2 PE=2 SV=1 82 246 7.0E-07
sp|Q05006|CDC22_MEDSA Cell division control protein 2 homolog 2 OS=Medicago sativa GN=CDC2B PE=2 SV=1 82 246 7.0E-07
sp|Q61846|MELK_MOUSE Maternal embryonic leucine zipper kinase OS=Mus musculus GN=Melk PE=1 SV=2 89 287 8.0E-07
sp|Q11179|YPC2_CAEEL Putative serine/threonine-protein kinase C05D10.2 OS=Caenorhabditis elegans GN=C05D10.2 PE=3 SV=2 81 286 8.0E-07
sp|Q6L5D4|MPK9_ORYSJ Mitogen-activated protein kinase 9 OS=Oryza sativa subsp. japonica GN=MPK9 PE=3 SV=2 97 276 8.0E-07
sp|Q8K1Y2|KPCD3_MOUSE Serine/threonine-protein kinase D3 OS=Mus musculus GN=Prkd3 PE=1 SV=1 2 286 8.0E-07
sp|A8WIP6|CDK20_DANRE Cyclin-dependent kinase 20 OS=Danio rerio GN=cdk20 PE=2 SV=1 64 236 1.0E-06
sp|Q2KJ16|PHKG2_BOVIN Phosphorylase b kinase gamma catalytic chain, liver/testis isoform OS=Bos taurus GN=PHKG2 PE=2 SV=1 44 286 1.0E-06
sp|P54645|AAPK1_RAT 5'-AMP-activated protein kinase catalytic subunit alpha-1 OS=Rattus norvegicus GN=Prkaa1 PE=1 SV=2 30 299 1.0E-06
sp|Q13131|AAPK1_HUMAN 5'-AMP-activated protein kinase catalytic subunit alpha-1 OS=Homo sapiens GN=PRKAA1 PE=1 SV=4 30 299 1.0E-06
sp|Q5AAG6|MKC1_CANAL Mitogen-activated protein kinase MKC1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=MKC1 PE=1 SV=1 77 314 1.0E-06
sp|O80902|CIPKM_ARATH CBL-interacting serine/threonine-protein kinase 22 OS=Arabidopsis thaliana GN=CIPK22 PE=2 SV=1 81 229 1.0E-06
sp|P43068|MKC1_CANAX Mitogen-activated protein kinase MKC1 OS=Candida albicans GN=MKC1 PE=3 SV=1 77 314 1.0E-06
sp|Q5EG47|AAPK1_MOUSE 5'-AMP-activated protein kinase catalytic subunit alpha-1 OS=Mus musculus GN=Prkaa1 PE=1 SV=2 30 299 1.0E-06
sp|P54644|KRAC_DICDI RAC family serine/threonine-protein kinase homolog OS=Dictyostelium discoideum GN=pkbA PE=1 SV=1 24 281 1.0E-06
sp|Q5RDH5|AAPK1_PONAB 5'-AMP-activated protein kinase catalytic subunit alpha-1 (Fragment) OS=Pongo abelii GN=PRKAA1 PE=2 SV=2 30 299 1.0E-06
sp|Q9SCS2|CAMK5_ARATH CDPK-related kinase 5 OS=Arabidopsis thaliana GN=CRK5 PE=2 SV=1 34 286 2.0E-06
sp|Q66HE5|NUAK2_RAT NUAK family SNF1-like kinase 2 OS=Rattus norvegicus GN=Nuak2 PE=1 SV=1 26 164 2.0E-06
sp|P00518|PHKG1_RABIT Phosphorylase b kinase gamma catalytic chain, skeletal muscle/heart isoform OS=Oryctolagus cuniculus GN=PHKG1 PE=1 SV=2 58 286 2.0E-06
sp|P92937|CIPKF_ARATH CBL-interacting serine/threonine-protein kinase 15 OS=Arabidopsis thaliana GN=CIPK15 PE=1 SV=2 25 164 2.0E-06
sp|P26696|MK01_XENLA Mitogen-activated protein kinase 1 OS=Xenopus laevis GN=mapk1 PE=1 SV=3 44 236 2.0E-06
sp|O65554|CIPK6_ARATH CBL-interacting serine/threonine-protein kinase 6 OS=Arabidopsis thaliana GN=CIPK6 PE=1 SV=1 63 287 3.0E-06
sp|P54666|CC2H3_TRYBB Cell division control protein 2 homolog 3 OS=Trypanosoma brucei brucei GN=CRK3 PE=3 SV=1 55 282 3.0E-06
sp|Q06226|SGK1_RAT Serine/threonine-protein kinase Sgk1 OS=Rattus norvegicus GN=Sgk1 PE=1 SV=1 20 294 4.0E-06
sp|Q6H7U5|CIPKQ_ORYSJ CBL-interacting protein kinase 26 OS=Oryza sativa subsp. japonica GN=CIPK26 PE=2 SV=1 65 281 4.0E-06
sp|C4YGK0|ERK1_CANAW Extracellular signal-regulated kinase 1 OS=Candida albicans (strain WO-1) GN=CEK1 PE=3 SV=1 84 236 4.0E-06
sp|P63086|MK01_RAT Mitogen-activated protein kinase 1 OS=Rattus norvegicus GN=Mapk1 PE=1 SV=3 51 322 4.0E-06
sp|P63085|MK01_MOUSE Mitogen-activated protein kinase 1 OS=Mus musculus GN=Mapk1 PE=1 SV=3 51 322 4.0E-06
sp|Q5A1D3|ERK1_CANAL Extracellular signal-regulated kinase 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CEK1 PE=1 SV=2 84 236 4.0E-06
sp|P28482|MK01_HUMAN Mitogen-activated protein kinase 1 OS=Homo sapiens GN=MAPK1 PE=1 SV=3 51 322 4.0E-06
sp|Q9FJ55|CIPKJ_ARATH CBL-interacting serine/threonine-protein kinase 19 OS=Arabidopsis thaliana GN=CIPK19 PE=2 SV=1 81 341 5.0E-06
sp|Q54XJ4|Y8901_DICDI Probable serine/threonine-protein kinase DDB_G0278901 OS=Dictyostelium discoideum GN=DDB_G0278901 PE=3 SV=1 82 286 5.0E-06
sp|Q6U1I9|SGK1_CHICK Serine/threonine-protein kinase Sgk1 OS=Gallus gallus GN=SGK1 PE=2 SV=1 20 294 5.0E-06
sp|P46196|MK01_BOVIN Mitogen-activated protein kinase 1 OS=Bos taurus GN=MAPK1 PE=2 SV=3 51 322 5.0E-06
sp|Q28GW8|MELK_XENTR Maternal embryonic leucine zipper kinase OS=Xenopus tropicalis GN=melk PE=2 SV=1 89 286 6.0E-06
sp|Q91821|MELK_XENLA Maternal embryonic leucine zipper kinase OS=Xenopus laevis GN=melk PE=1 SV=2 89 287 9.0E-06
sp|B1WAS2|HUNK_XENTR Hormonally up-regulated neu tumor-associated kinase homolog OS=Xenopus tropicalis GN=hunk PE=2 SV=1 73 297 9.0E-06
sp|A7MB74|SGK1_BOVIN Serine/threonine-protein kinase Sgk1 OS=Bos taurus GN=SGK1 PE=2 SV=1 20 294 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0005524 ATP binding Yes
GO:0004672 protein kinase activity Yes
GO:0005515 protein binding Yes
GO:0006468 protein phosphorylation Yes
GO:0000166 nucleotide binding No
GO:0097367 carbohydrate derivative binding No
GO:0006807 nitrogen compound metabolic process No
GO:0036211 protein modification process No
GO:0006796 phosphate-containing compound metabolic process No
GO:0032553 ribonucleotide binding No
GO:0016301 kinase activity No
GO:0140096 catalytic activity, acting on a protein No
GO:0043167 ion binding No
GO:0016310 phosphorylation No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0006793 phosphorus metabolic process No
GO:0003674 molecular_function No
GO:0005488 binding No
GO:0008150 biological_process No
GO:0016772 transferase activity, transferring phosphorus-containing groups No
GO:0043170 macromolecule metabolic process No
GO:0016773 phosphotransferase activity, alcohol group as acceptor No
GO:0008152 metabolic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0016740 transferase activity No
GO:0030554 adenyl nucleotide binding No
GO:0019538 protein metabolic process No
GO:0044238 primary metabolic process No
GO:0009987 cellular process No
GO:0043412 macromolecule modification No
GO:0036094 small molecule binding No
GO:0032559 adenyl ribonucleotide binding No
GO:0003824 catalytic activity No
GO:0044237 cellular metabolic process No
GO:0071704 organic substance metabolic process No
GO:1901363 heterocyclic compound binding No
GO:0032555 purine ribonucleotide binding No
GO:1901265 nucleoside phosphate binding No
GO:0097159 organic cyclic compound binding No
GO:0043168 anion binding No
GO:0017076 purine nucleotide binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 17 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|4228
MGQGFSLATPSAGSAGIDIAQLQDIQYEKSIGNARFMKSIRGRHENGVVLVKVLVKPFAEVKLDEYKREILKQTK
ALSAVPNALAFERVIETETNGYLVRQYMYSSLYDRLSTRPFLEDIEKKWLAFQLLCALRDCHARDVYHGDIKAQN
VLVTSWNWLYLTDFSSCYKPVVLPDDNPGDFSYFFDTSGRRTCYLAPERFHGAGESCQPEAKMTWAMDIFSAGCV
IAQLFLESELFSLAQLFKYRRGEYDAVGDHVSLLADADVRDMIAHMIQLDPEKRYSADQYLDFWKGKVFPAYFYT
FLHQYMELITDPSSGMSPMSSAQRNLGESDDRIDRVFHDFDKISFFLGYQPDQHPPASPMPASRLHLGHFPLRLS
MANHEHFACAQLEPPQDDGTLIFLNLIVSSIRTTARASSRVRACDILLAFAERLTDEAKLDRVLPYVMTLLRRDE
VDIVLVSAIRTITQLLQLVRTPTPINSHVLVEYVLPRMEVALVSGSQPSNPLVRATYASCLGSLASSGQRFLEVA
STLGADGSMPLNDPEVEPGANMEANFDSLFDTAGRDLAEMLESHAKQLVEDADVQVRRAFLTSVPELCMFFREQS
NDILLTHLNTYLNDRDWTLKCAFFDTVVAIAVFIGSTSLEEFMLPLMVQALADAEEFVVQAALHALAQLAGLGLL
SRPKIWELADLAARFTMHPSIWIRESAAEFLAMSAKYLDASDVQCVLMPSIKAYLRVATLPDLDELTILDALKAP
LSRAVFEQAVAWATQAERGLFWKPLQEAPSLSLGSCPGPAGRPSRDLHQDCLSKVGRNDEDNQWLEKLRNLGLKA
DDEVKLVALAEYIWRTSRARLRDSAVSSQGAMTSGLVSLKAIGITPQTVFFNDAPVLDPSIKPQLDPLPGPYTIA
EALLDASMALDDGHGNKKRVALRQRVQSIGPGPVHSSRQPASSPIRSASRLSERLPRTSQTRGPLEAEGLTPEGP
GGRRGMRHQPSVLSLLDGRDKNIKSAAETGTSDAEAFGQVEGGFAATSPASTGFAGRREDEERQAGPRQCKHSYE
GRDPHIQKMLDRMYTDNFPRDVVEFGPMVQPVGSSGKVRVVDGSVGGEWRPLGHLVATFAEHKGAINRVVASPDD
VFFITAGSDGAVKVWDTARLERNITQRSRQTHRHGAGARVLSVCFVENSHCFISCGSDGSIQAVKVDTWHSSGVV
KYGKLRVVRDYELPKGEHGVWCEHFRHDSMSVLVVATNRSRVVGLDLRTMARLFALENPVQHGTPTCLCVDRKRN
WLCVGTSHGIVSLWDLRFKMRLKSWGLPGKRWIHRMSIHPTKGRGKWICVAGGTAPGEMTVWDVERTKCREIYRI
SGKRDGAKTYSGCEVDGAVGMLASFATDVERGDAADGGVRAMAMGMALGGDGSGDVRHAYFATGGSDCKLRFWDM
THIDDSRVYSGLEPDEPQPTYSTVYPAAGVSLSTEKKSRHAGPASLSSTSSTSTLSSSAAATAAAAAAAAAAASN
GGRPKSSAGGSGRPARSTVISMQQQHLLQSHQDAVLDMAIIEYPYTMSVSVDRSGVVFVFQ*
Coding >OphauB2|4228
ATGGGCCAAGGCTTTTCGCTCGCGACACCGTCGGCTGGCTCAGCCGGCATCGACATTGCGCAGCTACAAGACATT
CAGTACGAAAAGAGCATTGGCAATGCACGCTTCATGAAGAGCATCCGCGGGCGGCACGAAAACGGCGTGGTGCTG
GTCAAGGTGCTGGTCAAGCCCTTTGCCGAGGTCAAGCTGGACGAGTACAAGCGCGAAATCCTCAAGCAAACAAAG
GCCCTGAGCGCAGTTCCCAATGCTCTCGCTTTTGAACGCGTGATTGAGACGGAAACAAATGGCTATCTGGTACGG
CAGTACATGTACAGCTCCCTCTACGACAGACTCAGCACTCGGCCCTTTCTCGAAGACATTGAAAAGAAGTGGCTG
GCCTTTCAGCTGCTGTGCGCCTTGCGAGACTGCCATGCCCGCGATGTCTACCACGGCGACATCAAGGCACAAAAC
GTGCTTGTCACGTCGTGGAACTGGCTCTACCTGACAGACTTTTCCTCGTGCTACAAGCCTGTCGTGCTGCCCGAC
GACAACCCAGGCGACTTTTCCTACTTTTTCGACACGTCTGGCCGCCGCACCTGCTACCTGGCCCCTGAGCGCTTC
CATGGCGCAGGCGAGAGCTGCCAGCCCGAGGCCAAGATGACGTGGGCCATGGACATTTTTAGCGCTGGCTGCGTC
ATTGCTCAGCTCTTTCTCGAGTCGGAGCTTTTTAGCCTTGCCCAGCTCTTCAAGTATCGTCGCGGCGAGTATGAT
GCGGTGGGGGACCATGTCAGCCTGCTGGCCGACGCCGATGTGCGCGACATGATTGCACACATGATTCAGCTGGAT
CCTGAGAAGCGCTACTCGGCCGATCAATACCTTGACTTTTGGAAGGGCAAGGTGTTTCCGGCCTACTTTTACACC
TTTTTGCACCAGTACATGGAGCTCATTACCGATCCATCGTCGGGCATGAGCCCCATGTCGAGCGCGCAGAGGAAC
CTGGGCGAGTCGGACGACCGTATCGACCGAGTATTTCACGACTTTGACAAGATTTCCTTCTTTCTTGGCTACCAG
CCCGACCAGCACCCGCCCGCATCTCCCATGCCTGCCTCTCGCCTTCATCTTGGACATTTTCCTCTTCGCCTGAGC
ATGGCCAACCACGAGCATTTTGCGTGCGCCCAGCTGGAGCCGCCACAAGACGACGGCACCCTCATCTTTCTCAAC
CTCATTGTTTCTTCCATTCGCACAACAGCGCGGGCCTCGTCTCGAGTTCGCGCCTGTGACATCTTGCTGGCCTTT
GCTGAGAGACTGACGGACGAGGCCAAGCTGGACCGAGTCTTGCCCTATGTCATGACTCTACTGCGCAGAGACGAA
GTCGACATTGTCTTGGTGTCTGCCATTCGCACCATTACGCAGCTGCTACAACTGGTGCGCACTCCAACGCCCATC
AACTCTCACGTCTTGGTTGAGTATGTGCTGCCGCGCATGGAGGTGGCGCTGGTGTCGGGCTCTCAGCCTTCGAAC
CCTCTGGTCCGAGCCACGTATGCCTCGTGCCTGGGGAGCCTGGCCTCGTCGGGCCAGCGCTTTCTCGAGGTGGCG
TCGACGCTGGGGGCTGATGGCTCCATGCCGCTCAACGACCCCGAGGTGGAGCCTGGAGCCAACATGGAGGCCAAT
TTTGACAGCCTCTTTGACACGGCTGGCAGAGATCTTGCCGAGATGCTGGAAAGCCACGCCAAGCAATTGGTTGAA
GATGCAGACGTGCAGGTCCGCCGGGCCTTTTTGACCTCGGTGCCAGAGCTGTGCATGTTTTTCCGCGAGCAGTCA
AACGACATTTTGCTCACCCACCTCAATACATATCTCAACGACCGAGACTGGACTCTCAAGTGCGCCTTTTTTGAC
ACGGTGGTGGCAATAGCCGTCTTTATCGGAAGCACAAGCCTCGAGGAGTTTATGCTGCCGCTAATGGTGCAGGCG
CTGGCCGACGCTGAAGAGTTTGTGGTGCAAGCTGCCCTACATGCCTTGGCCCAGCTTGCCGGCCTGGGCCTCTTG
TCGCGGCCCAAAATATGGGAGCTGGCTGATCTCGCCGCCAGATTTACCATGCATCCCAGCATTTGGATCCGCGAG
TCGGCGGCAGAATTCCTCGCCATGTCAGCCAAGTACCTTGATGCATCAGATGTGCAATGTGTCCTGATGCCGTCA
ATCAAGGCCTATCTGAGAGTGGCCACGTTGCCGGACCTGGATGAGCTGACCATTCTTGACGCTCTCAAGGCACCT
CTGTCGCGAGCCGTCTTTGAGCAAGCGGTTGCCTGGGCGACGCAGGCGGAGCGAGGCTTGTTTTGGAAGCCGCTG
CAGGAAGCGCCGTCATTGTCGCTTGGCTCATGCCCAGGCCCGGCTGGCCGCCCATCTAGAGACTTGCATCAAGAC
TGTCTGAGCAAAGTCGGCCGCAACGACGAGGACAACCAATGGCTTGAAAAGTTGAGAAATCTAGGCCTCAAGGCG
GACGACGAGGTCAAGCTTGTTGCCCTGGCCGAGTATATTTGGCGGACGAGCAGAGCGCGATTACGAGACTCTGCC
GTCAGTAGCCAAGGAGCCATGACTTCAGGACTCGTCTCTCTCAAGGCAATAGGCATAACGCCGCAGACTGTCTTT
TTCAATGATGCTCCAGTCTTGGATCCGTCAATCAAGCCCCAGCTGGATCCGCTGCCAGGTCCGTATACCATTGCC
GAGGCTTTGCTGGATGCCTCGATGGCTCTTGATGACGGGCATGGCAACAAGAAGCGCGTGGCTCTGAGACAGCGA
GTGCAAAGCATTGGTCCTGGGCCGGTACACAGCTCTCGACAGCCTGCATCATCGCCCATTAGGTCTGCATCGCGC
TTGTCGGAGAGGCTGCCGCGCACAAGCCAGACGCGCGGACCACTAGAGGCCGAAGGATTGACGCCAGAAGGCCCT
GGGGGCAGGCGAGGCATGCGGCACCAGCCCAGTGTGTTGAGTCTTTTGGATGGCAGGGACAAGAATATCAAGTCG
GCAGCAGAAACAGGCACGAGCGATGCCGAGGCATTTGGGCAGGTGGAGGGAGGGTTTGCTGCCACGTCGCCGGCA
TCGACGGGGTTTGCAGGCAGGCGAGAAGACGAGGAGCGGCAGGCTGGGCCCAGACAATGCAAACACAGCTATGAA
GGGCGCGATCCGCACATTCAAAAGATGCTGGACAGAATGTATACTGACAACTTTCCGCGGGATGTGGTAGAGTTT
GGGCCCATGGTGCAGCCGGTAGGATCAAGCGGCAAGGTCAGGGTGGTTGATGGCAGTGTGGGGGGAGAGTGGAGG
CCTCTGGGCCATCTTGTGGCGACGTTTGCAGAGCACAAGGGCGCCATCAACCGCGTCGTGGCATCGCCAGACGAC
GTCTTTTTCATCACGGCGGGCAGTGACGGAGCAGTCAAGGTGTGGGACACGGCGCGGCTGGAGCGCAACATTACG
CAGCGGTCGAGGCAGACGCACCGACATGGAGCAGGAGCGCGGGTGCTGAGTGTGTGCTTTGTGGAAAACTCGCAC
TGCTTCATCAGCTGCGGGAGCGACGGCAGCATCCAGGCGGTCAAGGTGGACACGTGGCACAGCAGCGGAGTGGTC
AAGTATGGCAAGCTGCGCGTGGTGCGCGACTATGAGCTGCCCAAGGGCGAGCACGGCGTGTGGTGCGAGCATTTC
CGACACGACTCCATGTCGGTGCTGGTGGTGGCGACGAACCGGTCGCGAGTGGTGGGCCTGGATCTGAGGACCATG
GCGCGCCTCTTTGCGCTGGAGAACCCGGTGCAGCACGGGACGCCAACGTGCCTGTGCGTGGACCGGAAGCGCAAC
TGGCTCTGCGTGGGCACCAGCCACGGCATAGTGTCTCTGTGGGATCTGCGCTTCAAGATGCGCCTCAAGAGCTGG
GGCCTGCCGGGCAAGCGCTGGATCCACCGCATGAGCATCCATCCCACCAAGGGCCGCGGCAAATGGATCTGCGTG
GCTGGCGGCACCGCGCCGGGCGAGATGACGGTGTGGGACGTGGAGCGCACCAAGTGTCGCGAAATCTACCGCATC
AGCGGCAAGCGTGACGGCGCCAAGACGTATAGCGGCTGCGAGGTGGATGGGGCGGTCGGCATGCTTGCGTCGTTT
GCCACCGACGTGGAGAGGGGCGATGCGGCTGATGGAGGCGTGCGAGCCATGGCCATGGGCATGGCGCTGGGCGGC
GACGGCTCGGGCGATGTGCGCCACGCCTATTTTGCTACGGGCGGATCAGACTGCAAGCTGCGCTTTTGGGACATG
ACGCACATTGACGACTCGAGGGTCTATAGCGGTCTGGAGCCAGACGAGCCGCAGCCAACGTACTCGACCGTCTAT
CCCGCTGCGGGCGTCAGTCTAAGCACGGAGAAGAAGTCGAGGCACGCGGGGCCGGCATCGCTGTCATCCACGTCG
TCGACGTCGACCTTGTCCTCATCAGCAGCCGCGACTGCAGCAGCAGCAGCAGCAGCAGCAGCAGCAGCAAGCAAC
GGCGGGCGGCCCAAGAGCAGTGCGGGCGGGAGTGGGCGGCCGGCTCGGTCGACTGTTATATCGATGCAGCAGCAG
CATTTGCTGCAGTCGCACCAAGATGCGGTTCTCGACATGGCGATTATTGAGTATCCGTACACGATGAGTGTGTCT
GTTGATAGGTCTGGAGTTGTCTTTGTTTTTCAGTAG
Transcript >OphauB2|4228
ATGGGCCAAGGCTTTTCGCTCGCGACACCGTCGGCTGGCTCAGCCGGCATCGACATTGCGCAGCTACAAGACATT
CAGTACGAAAAGAGCATTGGCAATGCACGCTTCATGAAGAGCATCCGCGGGCGGCACGAAAACGGCGTGGTGCTG
GTCAAGGTGCTGGTCAAGCCCTTTGCCGAGGTCAAGCTGGACGAGTACAAGCGCGAAATCCTCAAGCAAACAAAG
GCCCTGAGCGCAGTTCCCAATGCTCTCGCTTTTGAACGCGTGATTGAGACGGAAACAAATGGCTATCTGGTACGG
CAGTACATGTACAGCTCCCTCTACGACAGACTCAGCACTCGGCCCTTTCTCGAAGACATTGAAAAGAAGTGGCTG
GCCTTTCAGCTGCTGTGCGCCTTGCGAGACTGCCATGCCCGCGATGTCTACCACGGCGACATCAAGGCACAAAAC
GTGCTTGTCACGTCGTGGAACTGGCTCTACCTGACAGACTTTTCCTCGTGCTACAAGCCTGTCGTGCTGCCCGAC
GACAACCCAGGCGACTTTTCCTACTTTTTCGACACGTCTGGCCGCCGCACCTGCTACCTGGCCCCTGAGCGCTTC
CATGGCGCAGGCGAGAGCTGCCAGCCCGAGGCCAAGATGACGTGGGCCATGGACATTTTTAGCGCTGGCTGCGTC
ATTGCTCAGCTCTTTCTCGAGTCGGAGCTTTTTAGCCTTGCCCAGCTCTTCAAGTATCGTCGCGGCGAGTATGAT
GCGGTGGGGGACCATGTCAGCCTGCTGGCCGACGCCGATGTGCGCGACATGATTGCACACATGATTCAGCTGGAT
CCTGAGAAGCGCTACTCGGCCGATCAATACCTTGACTTTTGGAAGGGCAAGGTGTTTCCGGCCTACTTTTACACC
TTTTTGCACCAGTACATGGAGCTCATTACCGATCCATCGTCGGGCATGAGCCCCATGTCGAGCGCGCAGAGGAAC
CTGGGCGAGTCGGACGACCGTATCGACCGAGTATTTCACGACTTTGACAAGATTTCCTTCTTTCTTGGCTACCAG
CCCGACCAGCACCCGCCCGCATCTCCCATGCCTGCCTCTCGCCTTCATCTTGGACATTTTCCTCTTCGCCTGAGC
ATGGCCAACCACGAGCATTTTGCGTGCGCCCAGCTGGAGCCGCCACAAGACGACGGCACCCTCATCTTTCTCAAC
CTCATTGTTTCTTCCATTCGCACAACAGCGCGGGCCTCGTCTCGAGTTCGCGCCTGTGACATCTTGCTGGCCTTT
GCTGAGAGACTGACGGACGAGGCCAAGCTGGACCGAGTCTTGCCCTATGTCATGACTCTACTGCGCAGAGACGAA
GTCGACATTGTCTTGGTGTCTGCCATTCGCACCATTACGCAGCTGCTACAACTGGTGCGCACTCCAACGCCCATC
AACTCTCACGTCTTGGTTGAGTATGTGCTGCCGCGCATGGAGGTGGCGCTGGTGTCGGGCTCTCAGCCTTCGAAC
CCTCTGGTCCGAGCCACGTATGCCTCGTGCCTGGGGAGCCTGGCCTCGTCGGGCCAGCGCTTTCTCGAGGTGGCG
TCGACGCTGGGGGCTGATGGCTCCATGCCGCTCAACGACCCCGAGGTGGAGCCTGGAGCCAACATGGAGGCCAAT
TTTGACAGCCTCTTTGACACGGCTGGCAGAGATCTTGCCGAGATGCTGGAAAGCCACGCCAAGCAATTGGTTGAA
GATGCAGACGTGCAGGTCCGCCGGGCCTTTTTGACCTCGGTGCCAGAGCTGTGCATGTTTTTCCGCGAGCAGTCA
AACGACATTTTGCTCACCCACCTCAATACATATCTCAACGACCGAGACTGGACTCTCAAGTGCGCCTTTTTTGAC
ACGGTGGTGGCAATAGCCGTCTTTATCGGAAGCACAAGCCTCGAGGAGTTTATGCTGCCGCTAATGGTGCAGGCG
CTGGCCGACGCTGAAGAGTTTGTGGTGCAAGCTGCCCTACATGCCTTGGCCCAGCTTGCCGGCCTGGGCCTCTTG
TCGCGGCCCAAAATATGGGAGCTGGCTGATCTCGCCGCCAGATTTACCATGCATCCCAGCATTTGGATCCGCGAG
TCGGCGGCAGAATTCCTCGCCATGTCAGCCAAGTACCTTGATGCATCAGATGTGCAATGTGTCCTGATGCCGTCA
ATCAAGGCCTATCTGAGAGTGGCCACGTTGCCGGACCTGGATGAGCTGACCATTCTTGACGCTCTCAAGGCACCT
CTGTCGCGAGCCGTCTTTGAGCAAGCGGTTGCCTGGGCGACGCAGGCGGAGCGAGGCTTGTTTTGGAAGCCGCTG
CAGGAAGCGCCGTCATTGTCGCTTGGCTCATGCCCAGGCCCGGCTGGCCGCCCATCTAGAGACTTGCATCAAGAC
TGTCTGAGCAAAGTCGGCCGCAACGACGAGGACAACCAATGGCTTGAAAAGTTGAGAAATCTAGGCCTCAAGGCG
GACGACGAGGTCAAGCTTGTTGCCCTGGCCGAGTATATTTGGCGGACGAGCAGAGCGCGATTACGAGACTCTGCC
GTCAGTAGCCAAGGAGCCATGACTTCAGGACTCGTCTCTCTCAAGGCAATAGGCATAACGCCGCAGACTGTCTTT
TTCAATGATGCTCCAGTCTTGGATCCGTCAATCAAGCCCCAGCTGGATCCGCTGCCAGGTCCGTATACCATTGCC
GAGGCTTTGCTGGATGCCTCGATGGCTCTTGATGACGGGCATGGCAACAAGAAGCGCGTGGCTCTGAGACAGCGA
GTGCAAAGCATTGGTCCTGGGCCGGTACACAGCTCTCGACAGCCTGCATCATCGCCCATTAGGTCTGCATCGCGC
TTGTCGGAGAGGCTGCCGCGCACAAGCCAGACGCGCGGACCACTAGAGGCCGAAGGATTGACGCCAGAAGGCCCT
GGGGGCAGGCGAGGCATGCGGCACCAGCCCAGTGTGTTGAGTCTTTTGGATGGCAGGGACAAGAATATCAAGTCG
GCAGCAGAAACAGGCACGAGCGATGCCGAGGCATTTGGGCAGGTGGAGGGAGGGTTTGCTGCCACGTCGCCGGCA
TCGACGGGGTTTGCAGGCAGGCGAGAAGACGAGGAGCGGCAGGCTGGGCCCAGACAATGCAAACACAGCTATGAA
GGGCGCGATCCGCACATTCAAAAGATGCTGGACAGAATGTATACTGACAACTTTCCGCGGGATGTGGTAGAGTTT
GGGCCCATGGTGCAGCCGGTAGGATCAAGCGGCAAGGTCAGGGTGGTTGATGGCAGTGTGGGGGGAGAGTGGAGG
CCTCTGGGCCATCTTGTGGCGACGTTTGCAGAGCACAAGGGCGCCATCAACCGCGTCGTGGCATCGCCAGACGAC
GTCTTTTTCATCACGGCGGGCAGTGACGGAGCAGTCAAGGTGTGGGACACGGCGCGGCTGGAGCGCAACATTACG
CAGCGGTCGAGGCAGACGCACCGACATGGAGCAGGAGCGCGGGTGCTGAGTGTGTGCTTTGTGGAAAACTCGCAC
TGCTTCATCAGCTGCGGGAGCGACGGCAGCATCCAGGCGGTCAAGGTGGACACGTGGCACAGCAGCGGAGTGGTC
AAGTATGGCAAGCTGCGCGTGGTGCGCGACTATGAGCTGCCCAAGGGCGAGCACGGCGTGTGGTGCGAGCATTTC
CGACACGACTCCATGTCGGTGCTGGTGGTGGCGACGAACCGGTCGCGAGTGGTGGGCCTGGATCTGAGGACCATG
GCGCGCCTCTTTGCGCTGGAGAACCCGGTGCAGCACGGGACGCCAACGTGCCTGTGCGTGGACCGGAAGCGCAAC
TGGCTCTGCGTGGGCACCAGCCACGGCATAGTGTCTCTGTGGGATCTGCGCTTCAAGATGCGCCTCAAGAGCTGG
GGCCTGCCGGGCAAGCGCTGGATCCACCGCATGAGCATCCATCCCACCAAGGGCCGCGGCAAATGGATCTGCGTG
GCTGGCGGCACCGCGCCGGGCGAGATGACGGTGTGGGACGTGGAGCGCACCAAGTGTCGCGAAATCTACCGCATC
AGCGGCAAGCGTGACGGCGCCAAGACGTATAGCGGCTGCGAGGTGGATGGGGCGGTCGGCATGCTTGCGTCGTTT
GCCACCGACGTGGAGAGGGGCGATGCGGCTGATGGAGGCGTGCGAGCCATGGCCATGGGCATGGCGCTGGGCGGC
GACGGCTCGGGCGATGTGCGCCACGCCTATTTTGCTACGGGCGGATCAGACTGCAAGCTGCGCTTTTGGGACATG
ACGCACATTGACGACTCGAGGGTCTATAGCGGTCTGGAGCCAGACGAGCCGCAGCCAACGTACTCGACCGTCTAT
CCCGCTGCGGGCGTCAGTCTAAGCACGGAGAAGAAGTCGAGGCACGCGGGGCCGGCATCGCTGTCATCCACGTCG
TCGACGTCGACCTTGTCCTCATCAGCAGCCGCGACTGCAGCAGCAGCAGCAGCAGCAGCAGCAGCAGCAAGCAAC
GGCGGGCGGCCCAAGAGCAGTGCGGGCGGGAGTGGGCGGCCGGCTCGGTCGACTGTTATATCGATGCAGCAGCAG
CATTTGCTGCAGTCGCACCAAGATGCGGTTCTCGACATGGCGATTATTGAGTATCCGTACACGATGAGTGTGTCT
GTTGATAGGTCTGGAGTTGTCTTTGTTTTTCAGTAG
Gene >OphauB2|4228
ATGGGCCAAGGCTTTTCGCTCGCGACACCGTCGGCTGGCTCAGCCGGCATCGACATTGCGCAGCTACAAGACATT
CAGTACGAAAAGAGCATTGGCAATGCACGCTTCATGAAGAGCATCCGCGGGCGGCACGAAAACGGCGTGGTGCTG
GTCAAGGTGCTGGTCAAGCCCTTTGCCGAGGTCAAGCTGGACGAGTACAAGCGCGAAATCCTCAGTGAGCGAGGA
CTACCACGGGTGTGCGGCCAGGAGCTGCTGCTAACGCGTCTGCAGAGCAAACAAAGGCCCTGAGCGCAGTTCCCA
ATGCTCTCGCTTTTGAACGCGTGATTGAGACGGAAACAAATGGCTATCTGGTACGGCAGTACATGTACAGCTCCC
TCTACGACAGACTCAGCACTCGGCCCTTTCTCGAAGACATTGAAAAGAAGTGGCTGGCCTTTCAGCTGCTGTGCG
CCTTGCGAGACTGCCATGCCCGCGATGTCTACCACGGCGACATCAAGGCACAAAACGTGCTTGTCACGTCGTGGA
ACTGGCTCTACCTGACAGACTTTTCCTCGTGCTACAAGCCTGTCGTGCTGCCCGACGACAACCCAGGCGACTTTT
CCTACTTTTTCGACACGTCTGGCCGCCGCACCTGCTACCTGGCCCCTGAGCGCTTCCATGGCGCAGGCGAGAGCT
GCCAGCCCGAGGCCAAGATGACGTGGGCCATGGACATTTTTAGCGCTGGCTGCGTCATTGCTCAGCTCTTTCTCG
AGTCGGAGCTTTTTAGCCTTGCCCAGCTCTTCAAGTATCGTCGCGGCGAGTATGATGCGGTGGGGGACCATGTCA
GCCTGCTGGCCGACGCCGATGTGCGCGACATGATTGCACACATGATTCAGCTGGATCCTGAGAAGCGCTACTCGG
CCGATCAATACCTTGACTTTTGGAAGGGCAAGGTGTTTCCGGCCTACTTTTACACCTTTTTGCACCAGTACATGG
AGCTCATTACCGATCCATCGTCGGGCATGAGCCCCATGTCGAGCGCGCAGAGGAACCTGGGCGAGTCGGACGACC
GTATCGACCGAGTATTTCACGACTTTGACAAGATTTCCTTCTTTCTTGGCTACCAGCCCGACCAGCACCCGCCCG
CATCTCCCATGCCTGCCTCTCGCCTTCATCTTGGACATTTTCCTCTTCGCCTGAGCATGGCCAACCACGAGCATT
TTGCGTGCGCCCAGCTGGAGCCGCCACAAGACGACGGCACCCTCATCTTTCTCAACCTCATTGTTTCTTCCATTC
GCACAACAGCGCGGGCCTCGTCTCGAGTTCGCGCCTGTGACATCTTGCTGGCCTTTGCTGAGAGACTGACGGACG
AGGCCAAGCTGGACCGAGTCTTGCCCTATGTCATGACTCTACTGCGCAGAGACGAAGTCGACATTGTCTTGGTGT
CTGCCATTCGCACCATTACGCAGCTGCTACAACTGGTGCGCACTCCAACGCCCATCAACTCTCACGTCTTGGTTG
AGTATGTGCTGCCGCGCATGGAGGTGGCGCTGGTGTCGGGCTCTCAGCCTTCGAACCCTCTGGTCCGAGCCACGT
ATGCCTCGTGCCTGGGGAGCCTGGCCTCGTCGGGCCAGCGCTTTCTCGAGGTGGCGTCGACGCTGGGGGCTGATG
GCTCCATGCCGCTCAACGACCCCGAGGTGGAGCCTGGAGCCAACATGGAGGCCAATTTTGACAGCCTCTTTGACA
CGGCTGGCAGAGATCTTGCCGAGATGCTGGAAAGCCACGCCAAGCAATTGGTTGAAGATGCAGACGTGCAGGTCC
GCCGGGCCTTTTTGACCTCGGTGCCAGAGCTGTGCATGTTTTTCCGCGAGCAGTCAAACGACATTTTGCTCACCC
ACCTCAATACATATCTCAACGACCGAGACTGGACTCTCAAGTGCGCCTTTTTTGACACGGTGGTGGCAATAGCCG
TCTTTATCGGAAGCACAAGCCTCGAGGAGTTTATGCTGCCGCTAATGGTGCAGGCGCTGGCCGACGCTGAAGAGT
TTGTGGTGCAAGCTGCCCTACATGCCTTGGCCCAGCTTGCCGGCCTGGGCCTCTTGTCGCGGCCCAAAATATGGG
AGCTGGCTGATCTCGCCGCCAGATTTACCATGCATCCCAGCATTTGGATCCGCGAGTCGGCGGCAGAATTCCTCG
CCATGTCAGCCAAGTACCTTGATGCATCAGATGTGCAATGTGTCCTGATGCCGTCAATCAAGGCCTATCTGAGAG
TGGCCACGTTGCCGGACCTGGATGAGCTGACCATTCTTGACGCTCTCAAGGCACCTCTGTCGCGAGCCGTCTTTG
AGCAAGCGGTTGCCTGGGCGACGCAGGCGGAGCGAGGCTTGTTTTGGAAGCCGCTGCAGGAAGCGCCGTCATTGT
CGCTTGGCTCATGCCCAGGCCCGGCTGGCCGCCCATCTAGAGACTTGCATCAAGACTGTCTGAGCAAAGTCGGCC
GCAACGACGAGGACAACCAATGGCTTGAAAAGTTGAGAAATCTAGGCCTCAAGGCGGACGACGAGGTCAAGCTTG
TTGCCCTGGCCGAGTATATTTGGCGGACGAGCAGAGCGCGATTACGAGACTCTGCCGTCAGTAGCCAAGGAGCCA
TGACTTCAGGACTCGTCTCTCTCAAGGCAATAGGCATAACGCCGCAGACTGTCTTTTTCAATGATGCTCCAGTCT
TGGATCCGTCAATCAAGCCCCAGCTGGATCCGCTGCCAGGTCCGTATACCATTGCCGAGGCTTTGCTGGATGCCT
CGATGGCTCTTGATGACGGGCATGGCAACAAGAAGCGCGTGGCTCTGAGACAGCGAGTGCAAAGCATTGGTCCTG
GGCCGGTACACAGCTCTCGACAGCCTGCATCATCGCCCATTAGGTCTGCATCGCGCTTGTCGGAGAGGCTGCCGC
GCACAAGCCAGACGCGCGGACCACTAGAGGCCGAAGGATTGACGCCAGAAGGCCCTGGGGGCAGGCGAGGCATGC
GGCACCAGCCCAGTGTGTTGAGTCTTTTGGATGGCAGGGACAAGAATATCAAGTCGGCAGCAGAAACAGGCACGA
GCGATGCCGAGGCATTTGGGCAGGTGGAGGGAGGGTTTGCTGCCACGTCGCCGGCATCGACGGGGTTTGCAGGCA
GGCGAGAAGACGAGGAGCGGCAGGCTGGGCCCAGACAATGCAAACACAGCTATGAAGGGCGCGATCCGCACATTC
AAAAGATGCTGGACAGAATGTATACTGACAACTTTCCGCGGGATGTGGTAGAGTTTGGGCCCATGGTGCAGCCGG
TAGGATCAAGCGGCAAGGTCAGGGTGGTTGATGGCAGTGTGGGGGGAGAGTGGAGGCCTCTGGGCCATCTTGTGG
CGACGTTTGCAGAGCACAAGGGCGCCATCAACCGCGTCGTGGCATCGCCAGACGACGTCTTTTTCATCACGGCGG
GCAGTGACGGAGCAGTCAAGGTGTGGGACACGGCGCGGCTGGAGCGCAACATTACGCAGCGGTCGAGGCAGACGC
ACCGACATGGAGCAGGAGCGCGGGTGCTGAGTGTGTGCTTTGTGGAAAACTCGCACTGCTTCATCAGCTGCGGGA
GCGACGGCAGCATCCAGGCGGTCAAGGTGGACACGTGGCACAGCAGCGGAGTGGTCAAGTATGGCAAGCTGCGCG
TGGTGCGCGACTATGAGCTGCCCAAGGGCGAGCACGGCGTGTGGTGCGAGCATTTCCGACACGACTCCATGTCGG
TGCTGGTGGTGGCGACGAACCGGTCGCGAGTGGTGGGCCTGGATCTGAGGACCATGGCGCGCCTCTTTGCGCTGG
AGAACCCGGTGCAGCACGGGACGCCAACGTGCCTGTGCGTGGACCGGAAGCGCAACTGGCTCTGCGTGGGCACCA
GCCACGGCATAGTGTCTCTGTGGGATCTGCGCTTCAAGATGCGCCTCAAGAGCTGGGGCCTGCCGGGCAAGCGCT
GGATCCACCGCATGAGCATCCATCCCACCAAGGGCCGCGGCAAATGGATCTGCGTGGCTGGCGGCACCGCGCCGG
GCGAGATGACGGTGTGGGACGTGGAGCGCACCAAGTGTCGCGAAATCTACCGCATCAGCGGCAAGCGTGACGGCG
CCAAGACGTATAGCGGCTGCGAGGTGGATGGGGCGGTCGGCATGCTTGCGTCGTTTGCCACCGACGTGGAGAGGG
GCGATGCGGCTGATGGAGGCGTGCGAGCCATGGCCATGGGCATGGCGCTGGGCGGCGACGGCTCGGGCGATGTGC
GCCACGCCTATTTTGCTACGGGCGGATCAGACTGCAAGCTGCGCTTTTGGGACATGACGCACATTGACGACTCGA
GGGTCTATAGCGGTCTGGAGCCAGACGAGCCGCAGCCAACGTACTCGACCGTCTATCCCGCTGCGGGCGTCAGTC
TAAGCACGGAGAAGAAGTCGAGGCACGCGGGGCCGGCATCGCTGTCATCCACGTCGTCGACGTCGACCTTGTCCT
CATCAGCAGCCGCGACTGCAGCAGCAGCAGCAGCAGCAGCAGCAGCAGCAAGCAACGGCGGGCGGCCCAAGAGCA
GTGCGGGCGGGAGTGGGCGGCCGGCTCGGTCGACTGTTATATCGATGCAGCAGCAGCATTTGCTGCAGTCGCACC
AAGATGCGGTTCTCGACATGGCGATTATTGAGTATCCGTACACGATGAGTGTGTCTGTTGATAGGTCTGGAGTTG
TCTTTGTTTTTCAGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail