Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|4227
Gene name
LocationContig_28:103640..104830
Strand-
Gene length (bp)1190
Transcript length (bp)735
Coding sequence length (bp)735
Protein length (aa) 245

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF14580 LRR_9 Leucine-rich repeat 1.7E-50 2 165

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q7S9P4|RU2A_NEUCR U2 small nuclear ribonucleoprotein A' OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=lea-1 PE=3 SV=1 1 244 7.0E-110
sp|Q4WV66|RU2A_ASPFU U2 small nuclear ribonucleoprotein A' OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=lea1 PE=3 SV=1 1 238 1.0E-103
sp|Q5BGW9|RU2A_EMENI U2 small nuclear ribonucleoprotein A' OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=lea1 PE=3 SV=1 1 243 3.0E-82
sp|Q9USX8|RU2A_SCHPO U2 small nuclear ribonucleoprotein A' OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=lea1 PE=1 SV=1 1 233 8.0E-64
sp|Q4P5F9|RU2A_USTMA U2 small nuclear ribonucleoprotein A' OS=Ustilago maydis (strain 521 / FGSC 9021) GN=LEA1 PE=3 SV=1 1 230 2.0E-49
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q7S9P4|RU2A_NEUCR U2 small nuclear ribonucleoprotein A' OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=lea-1 PE=3 SV=1 1 244 7.0E-110
sp|Q4WV66|RU2A_ASPFU U2 small nuclear ribonucleoprotein A' OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=lea1 PE=3 SV=1 1 238 1.0E-103
sp|Q5BGW9|RU2A_EMENI U2 small nuclear ribonucleoprotein A' OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=lea1 PE=3 SV=1 1 243 3.0E-82
sp|Q9USX8|RU2A_SCHPO U2 small nuclear ribonucleoprotein A' OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=lea1 PE=1 SV=1 1 233 8.0E-64
sp|Q4P5F9|RU2A_USTMA U2 small nuclear ribonucleoprotein A' OS=Ustilago maydis (strain 521 / FGSC 9021) GN=LEA1 PE=3 SV=1 1 230 2.0E-49
sp|Q4R8Y8|RU2A_MACFA U2 small nuclear ribonucleoprotein A' OS=Macaca fascicularis GN=SNRPA1 PE=2 SV=1 1 234 8.0E-47
sp|P09661|RU2A_HUMAN U2 small nuclear ribonucleoprotein A' OS=Homo sapiens GN=SNRPA1 PE=1 SV=2 1 234 8.0E-47
sp|P57784|RU2A_MOUSE U2 small nuclear ribonucleoprotein A' OS=Mus musculus GN=Snrpa1 PE=1 SV=2 1 234 1.0E-45
sp|Q9V4Q8|RU2A_DROME Probable U2 small nuclear ribonucleoprotein A' OS=Drosophila melanogaster GN=U2A PE=1 SV=1 1 233 2.0E-45
sp|Q9BLB6|RU2A_CAEEL Probable U2 small nuclear ribonucleoprotein A' OS=Caenorhabditis elegans GN=mog-2 PE=1 SV=1 1 233 1.0E-40
sp|P43333|RU2A_ARATH U2 small nuclear ribonucleoprotein A' OS=Arabidopsis thaliana GN=At1g09760 PE=2 SV=2 1 236 2.0E-40
sp|Q6BT60|RU2A_DEBHA U2 small nuclear ribonucleoprotein A' OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=LEA1 PE=3 SV=2 1 232 5.0E-33
sp|Q6C417|RU2A_YARLI U2 small nuclear ribonucleoprotein A' OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=LEA1 PE=3 SV=1 1 227 7.0E-29
sp|Q5A449|RU2A_CANAL U2 small nuclear ribonucleoprotein A' OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=LEA1 PE=3 SV=1 1 230 1.0E-28
sp|Q08963|RU2A_YEAST U2 small nuclear ribonucleoprotein A' OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LEA1 PE=1 SV=1 41 230 9.0E-13
sp|Q6FV04|RU2A_CANGA U2 small nuclear ribonucleoprotein A' OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=LEA1 PE=3 SV=1 1 217 1.0E-09
sp|Q5Y2C3|H2AY_TETTS Histone H2A.Y OS=Tetrahymena thermophila (strain SB210) GN=HTAY PE=2 SV=2 47 156 6.0E-08
sp|Q755D2|RU2A_ASHGO U2 small nuclear ribonucleoprotein A' OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=LEA1 PE=3 SV=1 45 230 4.0E-07
sp|A8IVX2|DRC3_CHLRE Dynein regulatory complex subunit 3 OS=Chlamydomonas reinhardtii GN=DRC3 PE=1 SV=1 22 158 6.0E-07
sp|A2AL36|CNTRL_MOUSE Centriolin OS=Mus musculus GN=Cntrl PE=1 SV=2 45 182 2.0E-06
sp|Q7Z7A1|CNTRL_HUMAN Centriolin OS=Homo sapiens GN=CNTRL PE=1 SV=2 30 182 4.0E-06
sp|Q8IW35|CEP97_HUMAN Centrosomal protein of 97 kDa OS=Homo sapiens GN=CEP97 PE=1 SV=1 23 164 4.0E-06
sp|Q9H2I8|CJ011_HUMAN Leucine-rich repeat-containing protein C10orf11 OS=Homo sapiens GN=C10orf11 PE=1 SV=1 20 175 6.0E-06
sp|Q9CZ62|CEP97_MOUSE Centrosomal protein of 97 kDa OS=Mus musculus GN=Cep97 PE=1 SV=1 23 164 1.0E-05
[Show less]

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup3734
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4973
Ophiocordyceps australis map64 (Brazil) OphauB2|4227 (this protein)
Ophiocordyceps camponoti-floridani Ophcf2|04194
Ophiocordyceps camponoti-rufipedis Ophun1|2455
Ophiocordyceps kimflemingae Ophio5|1206
Ophiocordyceps subramaniannii Hirsu2|7288

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|4227
MKLTPDLIESALSYLNPLKERELDLRGQHIDSIENLGVAGPHDAIDFTDNDVSVLGNFPLSPRITTLLLARNRVS
SIQPALGKAIPNLQNLVLASNDLAELADLDVLGLFARLTHLVLTDNPVTKLQHYRYWVLWRCPSVRFLDYQKVKD
VEREKSRELFGSAEEPTALATKILSKKSSFFERSAANGSAQSKLSRIKLTPAERKRIQERIQNATNLQEIMALEK
ELNEGRLPSGIHDDDVMQE*
Coding >OphauB2|4227
ATGAAGCTGACGCCCGACTTGATTGAGAGCGCCTTGTCGTATTTGAATCCGCTCAAGGAGCGCGAACTGGACCTA
CGAGGACAGCACATTGACTCTATAGAAAATCTTGGCGTCGCGGGCCCGCACGACGCCATTGACTTTACCGACAAC
GATGTCAGCGTCTTGGGCAACTTTCCCCTCTCGCCGCGCATAACGACGCTGCTGCTGGCGCGGAACCGCGTCTCG
AGTATTCAGCCTGCTCTCGGCAAGGCGATTCCAAATCTGCAAAACTTGGTGCTTGCGTCGAATGACTTGGCGGAG
CTGGCTGATCTCGATGTCCTGGGTCTGTTTGCGCGGCTGACGCACTTGGTCCTGACGGATAATCCCGTGACCAAG
CTTCAACACTACCGATACTGGGTCCTCTGGCGATGTCCCTCGGTCCGTTTTCTCGACTATCAAAAGGTCAAGGAT
GTTGAGCGGGAAAAGAGCCGGGAATTGTTTGGATCGGCAGAAGAGCCAACTGCTCTGGCAACCAAGATTCTAAGC
AAAAAATCAAGCTTTTTCGAGAGAAGCGCTGCCAATGGCTCAGCACAGTCGAAGCTGTCTCGGATTAAACTCACG
CCGGCGGAGAGGAAGCGCATTCAAGAAAGGATTCAAAACGCCACCAATCTACAGGAAATCATGGCGCTGGAAAAG
GAGCTCAATGAGGGGCGTTTGCCGTCTGGCATTCACGACGACGACGTCATGCAAGAGTAA
Transcript >OphauB2|4227
ATGAAGCTGACGCCCGACTTGATTGAGAGCGCCTTGTCGTATTTGAATCCGCTCAAGGAGCGCGAACTGGACCTA
CGAGGACAGCACATTGACTCTATAGAAAATCTTGGCGTCGCGGGCCCGCACGACGCCATTGACTTTACCGACAAC
GATGTCAGCGTCTTGGGCAACTTTCCCCTCTCGCCGCGCATAACGACGCTGCTGCTGGCGCGGAACCGCGTCTCG
AGTATTCAGCCTGCTCTCGGCAAGGCGATTCCAAATCTGCAAAACTTGGTGCTTGCGTCGAATGACTTGGCGGAG
CTGGCTGATCTCGATGTCCTGGGTCTGTTTGCGCGGCTGACGCACTTGGTCCTGACGGATAATCCCGTGACCAAG
CTTCAACACTACCGATACTGGGTCCTCTGGCGATGTCCCTCGGTCCGTTTTCTCGACTATCAAAAGGTCAAGGAT
GTTGAGCGGGAAAAGAGCCGGGAATTGTTTGGATCGGCAGAAGAGCCAACTGCTCTGGCAACCAAGATTCTAAGC
AAAAAATCAAGCTTTTTCGAGAGAAGCGCTGCCAATGGCTCAGCACAGTCGAAGCTGTCTCGGATTAAACTCACG
CCGGCGGAGAGGAAGCGCATTCAAGAAAGGATTCAAAACGCCACCAATCTACAGGAAATCATGGCGCTGGAAAAG
GAGCTCAATGAGGGGCGTTTGCCGTCTGGCATTCACGACGACGACGTCATGCAAGAGTAA
Gene >OphauB2|4227
ATGAAGCTGACGCCCGACTTGATTGAGAGCGCCTTGTCGTATTTGAATCCGCTCAAGGAGCGCGAACTGGACCTA
CGAGGTGCGTTTAAATTGAAAGGAGCAGATGCTACAGGAATGATCGTGTCCAAGAAGGAGGCAGAGTTGATGCGA
ACAATGCATGCCGTCTTGGCTGCTGCCCACGAATAGGACAGCACATTGACTCTATAGAAAATCTTGGCGTCGCGG
GCGTGAGTATAACCTTTTTTTTTTTTTTTTTCCCTCTCTCTCTTTTTCTCTCTCTCTCTTCTTCTTCTCCGCAGC
AAAGGAGAGCTAGGCTAACGTGTCACAACAATAAAGCCGCACGACGCCATTGACTTTACCGACAACGATGTCAGC
GTCTTGGGCAACTTTCCCCTCTCGCCGCGCATAACGACGCTGCTGCTGGCGCGGAACCGCGTCTCGAGTATTCAG
CCTGCTCTCGGCAAGGCGATTCCAAATCTGCAAAACTTGGTGCTTGCGTCGAATGACTTGGCGGAGCTGGCTGAT
CTCGATGTCCTGGGTCTGTTTGCGCGGCTGACGCACTTGGTCCTGACGGATAATCCCGTGACCAAGCTTCAAGTA
GGGCTCTCTTTTTTTGTTTTGTTTTGTGTTTTCCTTTTCTTTTTTTTTTCTTTTTTTTTTTCTTTAATAATTTGG
GTTTATAATTTTTCTGGGCATCAGCTTTTGCAGTGGTCAATGTCTAGCTGACGAAGCGTCTGATGCTTTTTTTTT
CTTTTTTAAAAAAACAGCACTACCGATACTGGGTCCTCTGGCGATGTCCCTCGGTCCGTTTTCTCGACTATCAAA
AGGTCAAGGATGTTGAGCGGGAAAAGAGCCGGGAATTGTTTGGATCGGCAGAAGAGCCAACTGCTCTGGCAACCA
AGGCAAGAATAGTACCCCTTTTTTTTTTTTTGGACATTTGCGGCGCCACACCATCTAACACTCTGGGACAGATTC
TAAGCAAAAAATCAAGCTTTTTCGAGAGAAGCGCTGCCAATGGCTCAGCACAGTCGAAGCTGTCTCGGATTAAAC
TCACGCCGGCGGAGAGGAAGCGCATTCAAGAAAGGATTCAAAACGCCACCAATCTACAGGAAATCATGGCGCTGG
AAAAGGAGCTCAATGAGGGGCGTTTGCCGTCTGGCATTCACGACGACGACGTCATGCAAGAGTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail