Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|4226
Gene name
LocationContig_28:102451..103253
Strand+
Gene length (bp)802
Transcript length (bp)600
Coding sequence length (bp)600
Protein length (aa) 200

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00808 CBFD_NFYB_HMF Histone-like transcription factor (CBF/NF-Y) and archaeal histone 1.7E-10 19 84

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|C6Y4D0|YCGV_SCHPO Putative transcription factor C16C4.22 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC16C4.22 PE=3 SV=1 16 96 4.0E-20
sp|Q6BX14|DPB3_DEBHA DNA polymerase epsilon subunit C OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=DPB3 PE=3 SV=1 20 106 6.0E-18
sp|Q9FMV5|NFYC4_ARATH Nuclear transcription factor Y subunit C-4 OS=Arabidopsis thaliana GN=NFYC4 PE=2 SV=1 19 99 8.0E-12
sp|Q8LCG7|NFYC2_ARATH Nuclear transcription factor Y subunit C-2 OS=Arabidopsis thaliana GN=NFYC2 PE=2 SV=2 20 99 9.0E-12
sp|Q9SMP0|NFYC1_ARATH Nuclear transcription factor Y subunit C-1 OS=Arabidopsis thaliana GN=NFYC1 PE=1 SV=1 19 99 1.0E-11
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|C6Y4D0|YCGV_SCHPO Putative transcription factor C16C4.22 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC16C4.22 PE=3 SV=1 16 96 4.0E-20
sp|Q6BX14|DPB3_DEBHA DNA polymerase epsilon subunit C OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=DPB3 PE=3 SV=1 20 106 6.0E-18
sp|Q9FMV5|NFYC4_ARATH Nuclear transcription factor Y subunit C-4 OS=Arabidopsis thaliana GN=NFYC4 PE=2 SV=1 19 99 8.0E-12
sp|Q8LCG7|NFYC2_ARATH Nuclear transcription factor Y subunit C-2 OS=Arabidopsis thaliana GN=NFYC2 PE=2 SV=2 20 99 9.0E-12
sp|Q9SMP0|NFYC1_ARATH Nuclear transcription factor Y subunit C-1 OS=Arabidopsis thaliana GN=NFYC1 PE=1 SV=1 19 99 1.0E-11
sp|Q9FGP7|NFYC6_ARATH Nuclear transcription factor Y subunit C-6 OS=Arabidopsis thaliana GN=NFYC6 PE=2 SV=1 19 99 2.0E-11
sp|Q02516|HAP5_YEAST Transcriptional activator HAP5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HAP5 PE=1 SV=1 20 99 1.0E-10
sp|Q9ZVL3|NFYC3_ARATH Nuclear transcription factor Y subunit C-3 OS=Arabidopsis thaliana GN=NFYC3 PE=2 SV=1 20 99 2.0E-10
sp|Q9NR33|DPOE4_HUMAN DNA polymerase epsilon subunit 4 OS=Homo sapiens GN=POLE4 PE=1 SV=2 2 94 2.0E-10
sp|Q62725|NFYC_RAT Nuclear transcription factor Y subunit gamma OS=Rattus norvegicus GN=Nfyc PE=2 SV=1 19 99 3.0E-10
sp|P70353|NFYC_MOUSE Nuclear transcription factor Y subunit gamma OS=Mus musculus GN=Nfyc PE=1 SV=2 19 99 3.0E-10
sp|Q5E9X1|NFYC_BOVIN Nuclear transcription factor Y subunit gamma OS=Bos taurus GN=NFYC PE=2 SV=1 19 99 3.0E-10
sp|Q5RA23|NFYC_PONAB Nuclear transcription factor Y subunit gamma OS=Pongo abelii GN=NFYC PE=2 SV=1 19 99 3.0E-10
sp|Q8L4B2|NFYC9_ARATH Nuclear transcription factor Y subunit C-9 OS=Arabidopsis thaliana GN=NFYC9 PE=2 SV=1 20 99 4.0E-10
sp|Q9CQ36|DPOE4_MOUSE DNA polymerase epsilon subunit 4 OS=Mus musculus GN=Pole4 PE=1 SV=1 18 94 5.0E-10
sp|A6QQ14|DPOE4_BOVIN DNA polymerase epsilon subunit 4 OS=Bos taurus GN=POLE4 PE=3 SV=1 18 94 5.0E-10
sp|Q13952|NFYC_HUMAN Nuclear transcription factor Y subunit gamma OS=Homo sapiens GN=NFYC PE=1 SV=3 19 99 7.0E-10
sp|P79007|HAP5_SCHPO Transcriptional activator hap5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=hap5 PE=2 SV=1 20 140 8.0E-10
sp|Q9JKP8|CHRC1_MOUSE Chromatin accessibility complex protein 1 OS=Mus musculus GN=Chrac1 PE=1 SV=1 20 101 2.0E-08
sp|Q9NRG0|CHRC1_HUMAN Chromatin accessibility complex protein 1 OS=Homo sapiens GN=CHRAC1 PE=1 SV=1 20 101 6.0E-08
sp|Q10315|DPB3_SCHPO DNA polymerase epsilon subunit C OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=dpb3 PE=1 SV=1 17 99 2.0E-07
sp|Q6CLM5|DPB3_KLULA DNA polymerase epsilon subunit C OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=DPB3 PE=3 SV=1 19 100 3.0E-07
sp|Q557I1|NFYC_DICDI Nuclear transcription factor Y subunit gamma OS=Dictyostelium discoideum GN=nfyc-1 PE=3 SV=1 19 99 6.0E-07
sp|Q6C6M5|DPB3_YARLI DNA polymerase epsilon subunit C OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=DPB3 PE=3 SV=1 17 99 1.0E-05
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

(None)

Transcription Factor Class

Transcription Factor Class
(based on PFAM domains)
Histone-like TF

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|4226
MPYNTTAIPPRREPTGQTQLPLSRVKKVINQDGDVAMCSNNAAFVITCATEMFIQHLASEAHVQARLERKPRRNV
QYKDLANAISHKDNLEFLQDIVPKTVPFGRIKDIARQTQARLRGEKQAANGFNSPAAELDTIRPFSNGLVGGATI
VNGHASALAVASRSNDDSAMDPNDQLSLEASQAAQQESPFQDSDVRMSS*
Coding >OphauB2|4226
ATGCCTTATAACACAACCGCCATTCCGCCGCGCCGCGAGCCCACCGGCCAGACTCAGCTGCCATTATCGCGGGTC
AAAAAGGTCATCAATCAAGATGGCGACGTGGCAATGTGCTCCAACAATGCCGCCTTTGTCATTACCTGCGCCACC
GAAATGTTTATCCAACACCTCGCCTCAGAGGCCCACGTCCAAGCCCGGCTTGAGCGCAAGCCCCGGCGCAACGTC
CAATACAAAGACTTGGCAAACGCCATTTCGCACAAGGACAATCTCGAGTTTCTGCAAGACATTGTCCCCAAGACG
GTCCCCTTTGGCCGCATCAAGGACATTGCGCGTCAGACACAGGCGCGCCTGCGCGGCGAGAAGCAAGCCGCCAAT
GGCTTCAACTCTCCCGCAGCAGAGCTTGATACCATTCGTCCCTTTTCAAACGGCCTCGTGGGCGGCGCCACCATC
GTCAATGGACACGCGTCGGCCTTGGCAGTCGCCTCGCGCTCAAACGACGACTCGGCCATGGACCCCAATGATCAG
CTCAGCCTCGAGGCCAGCCAGGCAGCGCAGCAAGAATCGCCATTTCAAGACTCTGACGTGCGCATGTCGAGCTAG
Transcript >OphauB2|4226
ATGCCTTATAACACAACCGCCATTCCGCCGCGCCGCGAGCCCACCGGCCAGACTCAGCTGCCATTATCGCGGGTC
AAAAAGGTCATCAATCAAGATGGCGACGTGGCAATGTGCTCCAACAATGCCGCCTTTGTCATTACCTGCGCCACC
GAAATGTTTATCCAACACCTCGCCTCAGAGGCCCACGTCCAAGCCCGGCTTGAGCGCAAGCCCCGGCGCAACGTC
CAATACAAAGACTTGGCAAACGCCATTTCGCACAAGGACAATCTCGAGTTTCTGCAAGACATTGTCCCCAAGACG
GTCCCCTTTGGCCGCATCAAGGACATTGCGCGTCAGACACAGGCGCGCCTGCGCGGCGAGAAGCAAGCCGCCAAT
GGCTTCAACTCTCCCGCAGCAGAGCTTGATACCATTCGTCCCTTTTCAAACGGCCTCGTGGGCGGCGCCACCATC
GTCAATGGACACGCGTCGGCCTTGGCAGTCGCCTCGCGCTCAAACGACGACTCGGCCATGGACCCCAATGATCAG
CTCAGCCTCGAGGCCAGCCAGGCAGCGCAGCAAGAATCGCCATTTCAAGACTCTGACGTGCGCATGTCGAGCTAG
Gene >OphauB2|4226
ATGCCTTATAACACAACCGCCATTCCGCCGCGCCGCGAGCCCACCGGCCAGACTCAGCTGCCATGTAAGCATCAG
CGTTTTTTACACTCACCTTGGATGTTTCCGTTCTAACTTGGGCAGTATCGCGGGTCAAAAAGGTCATCAATCAAG
ATGGCGACGTGGCAATGTGCTCCAACAATGCCGCCTTTGTCATTACCTGCGCCACCGTCCGTCCCGCGTCCCTCC
TCCCCTGCTCACACCACCTCTAACCTTTACCGCTATACAGGAAATGTTTATCCAACACCTCGCCTCAGAGGCCCA
CGTCCAAGCCCGGCTTGAGCGCAAGCCCCGGCGCAACGTCCAATACAAAGACTTGGGTACGCAGCCCCTTGTATC
CCTTTCCCCCCTTTGTTTTCCATTGCCTTGCTTTCCCAAAAATACTCACGTCCTTTTCCCCGCCGCAGCAAACGC
CATTTCGCACAAGGACAATCTCGAGTTTCTGCAAGACATTGTCCCCAAGACGGTCCCCTTTGGCCGCATCAAGGA
CATTGCGCGTCAGACACAGGCGCGCCTGCGCGGCGAGAAGCAAGCCGCCAATGGCTTCAACTCTCCCGCAGCAGA
GCTTGATACCATTCGTCCCTTTTCAAACGGCCTCGTGGGCGGCGCCACCATCGTCAATGGACACGCGTCGGCCTT
GGCAGTCGCCTCGCGCTCAAACGACGACTCGGCCATGGACCCCAATGATCAGCTCAGCCTCGAGGCCAGCCAGGC
AGCGCAGCAAGAATCGCCATTTCAAGACTCTGACGTGCGCATGTCGAGCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail