Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|4224
Gene name
LocationContig_28:98224..99012
Strand+
Gene length (bp)788
Transcript length (bp)606
Coding sequence length (bp)606
Protein length (aa) 202

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q2KIX3|TMM42_BOVIN Transmembrane protein 42 OS=Bos taurus GN=TMEM42 PE=2 SV=1 61 153 2.0E-07
sp|Q69YG0|TMM42_HUMAN Transmembrane protein 42 OS=Homo sapiens GN=TMEM42 PE=2 SV=2 63 144 4.0E-06
sp|Q5R7Q1|TMM42_PONAB Transmembrane protein 42 OS=Pongo abelii GN=TMEM42 PE=2 SV=1 63 144 5.0E-06
sp|Q9CR22|TMM42_MOUSE Transmembrane protein 42 OS=Mus musculus GN=Tmem42 PE=2 SV=1 63 144 5.0E-06

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 30 0.5

Transmembrane Domains

Domain # Start End Length
1 15 34 19
2 65 87 22
3 123 142 19

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|4224
MPVSAPPSEPWGFRAQWIGLAVMSGACAAFNGVFAKLTTTDLTSSLAHLIARLLRLSSAERLVDVALRAIFFILN
LTFNGIMWTLFTKALAKGSSTTKVSIVNTSTNFVFTALLGLAVFSESLPSLWWVGAALLVAGNVIIGSKDDKSEP
LKPCDPVPDSLSTAIDADESKPLLRPRIRSVSLVDDDVPHLEPVNDEAGET*
Coding >OphauB2|4224
ATGCCCGTCTCTGCTCCCCCGTCTGAGCCGTGGGGCTTCCGCGCCCAGTGGATAGGCCTCGCCGTGATGAGTGGT
GCTTGCGCCGCTTTCAACGGCGTCTTTGCCAAGCTCACAACAACGGATCTCACCTCGTCTCTTGCTCATCTCATT
GCTCGCCTCTTACGTCTCTCATCCGCAGAGCGTCTTGTTGATGTTGCTCTGCGCGCCATCTTCTTCATTCTCAAC
CTCACCTTTAACGGCATTATGTGGACCCTCTTCACCAAGGCTCTCGCAAAGGGCTCCTCAACCACAAAAGTCTCC
ATTGTCAATACTTCCACAAACTTTGTCTTTACCGCCCTGCTCGGCCTCGCCGTCTTTTCTGAATCCCTGCCTTCG
CTATGGTGGGTTGGTGCTGCGCTTTTGGTTGCTGGCAACGTCATTATTGGCTCCAAGGATGACAAGTCGGAGCCG
CTCAAGCCTTGCGACCCCGTTCCGGATTCTCTTTCAACCGCCATTGATGCCGACGAGTCCAAGCCTCTGTTGCGA
CCGAGGATTCGATCCGTGAGCCTCGTGGACGATGACGTGCCTCATCTCGAACCTGTAAATGACGAGGCTGGGGAG
ACTTGA
Transcript >OphauB2|4224
ATGCCCGTCTCTGCTCCCCCGTCTGAGCCGTGGGGCTTCCGCGCCCAGTGGATAGGCCTCGCCGTGATGAGTGGT
GCTTGCGCCGCTTTCAACGGCGTCTTTGCCAAGCTCACAACAACGGATCTCACCTCGTCTCTTGCTCATCTCATT
GCTCGCCTCTTACGTCTCTCATCCGCAGAGCGTCTTGTTGATGTTGCTCTGCGCGCCATCTTCTTCATTCTCAAC
CTCACCTTTAACGGCATTATGTGGACCCTCTTCACCAAGGCTCTCGCAAAGGGCTCCTCAACCACAAAAGTCTCC
ATTGTCAATACTTCCACAAACTTTGTCTTTACCGCCCTGCTCGGCCTCGCCGTCTTTTCTGAATCCCTGCCTTCG
CTATGGTGGGTTGGTGCTGCGCTTTTGGTTGCTGGCAACGTCATTATTGGCTCCAAGGATGACAAGTCGGAGCCG
CTCAAGCCTTGCGACCCCGTTCCGGATTCTCTTTCAACCGCCATTGATGCCGACGAGTCCAAGCCTCTGTTGCGA
CCGAGGATTCGATCCGTGAGCCTCGTGGACGATGACGTGCCTCATCTCGAACCTGTAAATGACGAGGCTGGGGAG
ACTTGA
Gene >OphauB2|4224
ATGCCCGTCTCTGCTCCCCCGTCTGAGCCGTGGGGCTTCCGCGCCCAGTGGATAGGCCTCGCCGTGATGAGTGGT
GCTTGCGCCGCTTTCAACGGCGTCTTTGCCAAGCTGTAAACCCTCTGGCTCTATTAGCCTCTCTCTCTCGCGCTA
ACAAGTCTCAGCACAACAACGGATCTCACCTCGTCTCTTGCTCATCTCATTGCTCGCCTCTTACGTCTCTCATCC
GCAGAGCGTCTTGTTGATGTTGCTCTGCGCGCCGTATGGGCTTTTTTTTTAATTATCCACGTTTTCTACTTGATG
CCTCTCTCAGACGCTGACTTTTTAACCCGTAGATCTTCTTCATTCTCAACCTCACCTTTAACGGCATTGTACGTT
GTCTAAGCCGTCTATTCTTTCTCCGCATCGACTGACAAGCACGCTTTTAGATGTGGACCCTCTTCACCAAGGCTC
TCGCAAAGGGCTCCTCAACCACAAAAGTCTCCATTGTCAATACTTCCACAAACTTTGTCTTTACCGCCCTGCTCG
GCCTCGCCGTCTTTTCTGAATCCCTGCCTTCGCTATGGTGGGTTGGTGCTGCGCTTTTGGTTGCTGGCAACGTCA
TTATTGGCTCCAAGGATGACAAGTCGGAGCCGCTCAAGCCTTGCGACCCCGTTCCGGATTCTCTTTCAACCGCCA
TTGATGCCGACGAGTCCAAGCCTCTGTTGCGACCGAGGATTCGATCCGTGAGCCTCGTGGACGATGACGTGCCTC
ATCTCGAACCTGTAAATGACGAGGCTGGGGAGACTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail